A0A077Z220_TRITR Loading...

Guanine nucleotide-binding protein subunit gamma

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.

AlphaFold DB , UniProt , Accession A0A077Z220, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 64 aa.

						>A0A077Z220_TRITR|A0A077Z220
MDKAELQRLVDSLRRQLKMHRVAVSVSANELRNFVEENQPHDPLVDNSDKKVNPWAERAKCVLL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	68.7	Low	93.7	Very high	150 Å²	150	104.4 Å²	104.4	74%	0.739	52%	0.516	S	S	*	.				0	124.8	0	-63.9	-165.8	-77.7	0	0	108.6	E5 L6 L9	M1-E5 WeakPolarHBondContact CA-OE2 3.43Å; M1-E5 HydrophobicContact CB-CB 4.41Å; M1-E5 HydrophobicContact CB-CG 4.32Å; M1-E5 WeakPolarHBondContact CB-OE2 3.46Å; M1-E5 HydrophobicContact CG-CG 4.4Å; M1-E5 VanDerWaalsContact CG-OE2 3.31Å; M1-E5 WeakPolarHBondContact CG-OE2 3.29Å; M1-E5 HydrophobicContact SD-CG 4.41Å; M1-L6 HydrophobicContact CB-CD2 4.27Å; M1-L6 HydrophobicContact CB-CG 4.25Å; M1-L6 HydrophobicContact CE-CD2 3.7Å; M1-L6 HydrophobicContact SD-CD2 4.28Å; M1-L9 HydrophobicContact CE-CD1 4.22Å; M1-L9 HydrophobicContact SD-CD1 3.49Å; M1-L9 WeakPolarHBondContact SD-CD1 3.5Å
2	D	90.8	Very high	94	Very high	103 Å²	103	98.4 Å²	98.4	55%	0.551	49%	0.492	S	S	*	.			trans	-75.2	166.5	175.5	68.9	41.2	0	0	0	110.9	A4 E5 L6	D2-A4 PolarHBondContact O-N 3.36Å; D2-A4 WeakPolarHBondContact OD1-CA 3.27Å; D2-A4 WeakPolarHBondContact OD1-CB 3.42Å; D2-A4 PolarHBondContact OD1-N 3.01Å; D2-E5 PolarHBondContact N-OE2 3.5Å; D2-E5 WeakPolarHBondContact O-CB 3.49Å; D2-E5 PolarHBondContact O-N 3.25Å; D2-E5 WeakPolarHBondContact OD1-CB 2.99Å; D2-E5 PolarHBondContact OD1-N 3.3Å; D2-L6 PolarHBondContact O-N 3.38Å
3	K	94.9	Very high	94.4	Very high	184 Å²	184	99.2 Å²	99.2	80%	0.8	50%	0.498	S	S	*	.	H	α-helix	trans	-59.3	-32.2	-179.1	-176.9	179.2	176.6	-178.1	0	112.1	Q7	K3-Q7 WeakPolarHBondContact O-CB 3.17Å; K3-Q7 PolarHBondContact O-N 2.95Å
4	A	95.8	Very high	94.6	Very high	64 Å²	64	102.5 Å²	102.5	53%	0.529	50%	0.502	S	S	.	.	H	α-helix	trans	-72.2	-39.2	-179.7	0	0	0	0	0	111.2	D2 Q7 R8	D2-A4 PolarHBondContact O-N 3.36Å; D2-A4 WeakPolarHBondContact OD1-CA 3.27Å; D2-A4 WeakPolarHBondContact OD1-CB 3.42Å; D2-A4 PolarHBondContact OD1-N 3.01Å; A4-Q7 PolarHBondContact O-N 3.15Å; A4-R8 WeakPolarHBondContact O-CG 3.47Å; A4-R8 PolarHBondContact O-N 3.45Å
5	E	96.8	Very high	94.8	Very high	86 Å²	86	106.1 Å²	106.1	40%	0.402	51%	0.508	S	S	.	.	H	α-helix	trans	-62.1	-46.7	173.1	-172.2	-178.7	-174.7	0	0	111.1	M1 D2 Q7 R8 L9	M1-E5 WeakPolarHBondContact CA-OE2 3.43Å; M1-E5 HydrophobicContact CB-CB 4.41Å; M1-E5 HydrophobicContact CB-CG 4.32Å; M1-E5 WeakPolarHBondContact CB-OE2 3.46Å; M1-E5 HydrophobicContact CG-CG 4.4Å; M1-E5 VanDerWaalsContact CG-OE2 3.31Å; M1-E5 WeakPolarHBondContact CG-OE2 3.29Å; M1-E5 HydrophobicContact SD-CG 4.41Å; D2-E5 PolarHBondContact N-OE2 3.5Å; D2-E5 WeakPolarHBondContact O-CB 3.49Å; D2-E5 PolarHBondContact O-N 3.25Å; D2-E5 WeakPolarHBondContact OD1-CB 2.99Å; D2-E5 PolarHBondContact OD1-N 3.3Å; E5-Q7 VanDerWaalsContact C-N 3.3Å; E5-Q7 PolarHBondContact O-N 2.96Å; E5-R8 WeakPolarHBondContact O-CB 3.23Å; E5-R8 PolarHBondContact O-N 2.89Å; E5-L9 WeakPolarHBondContact O-CG 3.38Å; E5-L9 PolarHBondContact O-N 3.2Å
6	L	97.2	Very high	95	Very high	84 Å²	84	105.1 Å²	105.1	44%	0.44	50%	0.502	S	S	.	.	H	α-helix	trans	-58.4	-42.5	174.7	-72	175.2	0	0	0	111.9	M1 D2 L9 V10	M1-L6 HydrophobicContact CB-CD2 4.27Å; M1-L6 HydrophobicContact CB-CG 4.25Å; M1-L6 HydrophobicContact CE-CD2 3.7Å; M1-L6 HydrophobicContact SD-CD2 4.28Å; D2-L6 PolarHBondContact O-N 3.38Å; L6-L9 PolarHBondContact O-N 3.24Å; L6-V10 WeakPolarHBondContact O-CG2 3.4Å; L6-V10 PolarHBondContact O-N 2.86Å
7	Q	97.1	Very high	95.2	Very high	91 Å²	91	106.3 Å²	106.3	43%	0.425	51%	0.511	S	S	.	.	H	α-helix	trans	-63.5	-43.3	176.9	-173.1	56	55.2	0	0	111.6	K3 A4 E5 L9 V10 D11	K3-Q7 WeakPolarHBondContact O-CB 3.17Å; K3-Q7 PolarHBondContact O-N 2.95Å; A4-Q7 PolarHBondContact O-N 3.15Å; E5-Q7 VanDerWaalsContact C-N 3.3Å; E5-Q7 PolarHBondContact O-N 2.96Å; Q7-L9 VanDerWaalsContact C-N 3.32Å; Q7-L9 PolarHBondContact O-N 3.36Å; Q7-V10 PolarHBondContact O-N 2.91Å; Q7-D11 VanDerWaalsContact NE2-CG 3.31Å; Q7-D11 PolarHBondContact NE2-OD1 2.82Å; Q7-D11 PolarHBondContact NE2-OD2 3.07Å; Q7-D11 VanDerWaalsContact O-CG 3.28Å; Q7-D11 PolarHBondContact O-N 3.07Å
8	R	97	Very high	95.3	Very high	193 Å²	193	110.6 Å²	110.6	73%	0.728	53%	0.527	S	S	*	.	H	α-helix	trans	-60.5	-39.9	174.9	-73.8	179.2	64.7	144	1.9	112.4	A4 E5 D11 S12	A4-R8 WeakPolarHBondContact O-CG 3.47Å; A4-R8 PolarHBondContact O-N 3.45Å; E5-R8 WeakPolarHBondContact O-CB 3.23Å; E5-R8 PolarHBondContact O-N 2.89Å; R8-D11 PolarHBondContact O-N 3.12Å; R8-S12 WeakPolarHBondContact O-CB 3.45Å; R8-S12 PolarHBondContact O-N 2.87Å
9	L	97.5	Very high	95.4	Very high	80 Å²	80	110.6 Å²	110.6	42%	0.419	53%	0.528	S	S	.	.	H	α-helix	trans	-64.3	-47.9	175.7	-71.2	173.9	0	0	0	111.2	M1 E5 L6 Q7 D11 S12 L13	M1-L9 HydrophobicContact CE-CD1 4.22Å; M1-L9 HydrophobicContact SD-CD1 3.49Å; M1-L9 WeakPolarHBondContact SD-CD1 3.5Å; E5-L9 WeakPolarHBondContact O-CG 3.38Å; E5-L9 PolarHBondContact O-N 3.2Å; L6-L9 PolarHBondContact O-N 3.24Å; Q7-L9 VanDerWaalsContact C-N 3.32Å; Q7-L9 PolarHBondContact O-N 3.36Å; L9-D11 VanDerWaalsContact C-N 3.31Å; L9-D11 PolarHBondContact O-N 3.11Å; L9-S12 WeakPolarHBondContact O-CB 3.37Å; L9-S12 PolarHBondContact O-N 2.83Å; L9-S12 VanDerWaalsContact O-N 3.14Å; L9-L13 WeakPolarHBondContact O-CG 3.41Å; L9-L13 PolarHBondContact O-N 3.29Å
10	V	97.7	Very high	95.5	Very high	57 Å²	57	113.7 Å²	113.7	35%	0.345	54%	0.542	S	S	.	.	H	α-helix	trans	-57.9	-44.8	176.2	169.9	0	0	0	0	111.1	L6 Q7 S12 L13 R14	L6-V10 WeakPolarHBondContact O-CG2 3.4Å; L6-V10 PolarHBondContact O-N 2.86Å; Q7-V10 PolarHBondContact O-N 2.91Å; V10-S12 VanDerWaalsContact C-N 3.32Å; V10-S12 PolarHBondContact O-N 2.92Å; V10-L13 PolarHBondContact O-N 3.23Å; V10-R14 WeakPolarHBondContact O-CG 3.27Å; V10-R14 PolarHBondContact O-N 2.99Å
11	D	97.6	Very high	95.6	Very high	56 Å²	56	115.6 Å²	115.6	30%	0.299	54%	0.544	S	S	.	.	H	α-helix	trans	-68.3	-33.2	179.1	-65.6	-29.3	0	0	0	112	Q7 R8 L9 R14 R15	Q7-D11 VanDerWaalsContact NE2-CG 3.31Å; Q7-D11 PolarHBondContact NE2-OD1 2.82Å; Q7-D11 PolarHBondContact NE2-OD2 3.07Å; Q7-D11 VanDerWaalsContact O-CG 3.28Å; Q7-D11 PolarHBondContact O-N 3.07Å; R8-D11 PolarHBondContact O-N 3.12Å; L9-D11 VanDerWaalsContact C-N 3.31Å; L9-D11 PolarHBondContact O-N 3.11Å; D11-R14 IonicContact OD1-NH1 3Å; D11-R14 PolarHBondContact OD1-NH1 3.18Å; D11-R15 WeakPolarHBondContact O-CG 3.42Å; D11-R15 PolarHBondContact O-N 2.93Å; D11-R15 VanDerWaalsContact O-N 3.1Å; D11-R15 PolarHBondContact O-NH1 3.15Å
12	S	97.7	Very high	96.9	Very high	33 Å²	33	112.3 Å²	112.3	23%	0.231	53%	0.532	C	S	.	.	H	α-helix	trans	-62.9	-47.2	170.4	-168.8	0	0	0	0	112.2	R8 L9 V10 R14 R15 Q16	R8-S12 WeakPolarHBondContact O-CB 3.45Å; R8-S12 PolarHBondContact O-N 2.87Å; L9-S12 WeakPolarHBondContact O-CB 3.37Å; L9-S12 PolarHBondContact O-N 2.83Å; L9-S12 VanDerWaalsContact O-N 3.14Å; V10-S12 VanDerWaalsContact C-N 3.32Å; V10-S12 PolarHBondContact O-N 2.92Å; S12-R14 PolarHBondContact O-N 3.29Å; S12-R15 WeakPolarHBondContact O-CB 3.41Å; S12-R15 PolarHBondContact O-N 3.42Å; S12-Q16 WeakPolarHBondContact O-CG 3.49Å; S12-Q16 PolarHBondContact O-N 2.93Å; S12-Q16 PolarHBondContact OG-NE2 2.96Å
13	L	98.1	Very high	97.3	Very high	109 Å²	109	110 Å²	110	57%	0.571	53%	0.527	S	S	*	.	H	α-helix	trans	-63.4	-40.9	178.3	-67.9	172.2	0	0	0	111.5	L9 V10 R15 Q16 L17	L9-L13 WeakPolarHBondContact O-CG 3.41Å; L9-L13 PolarHBondContact O-N 3.29Å; V10-L13 PolarHBondContact O-N 3.23Å; L13-R15 VanDerWaalsContact C-N 3.3Å; L13-R15 PolarHBondContact O-N 3.41Å; L13-Q16 PolarHBondContact O-N 3.4Å; L13-L17 WeakPolarHBondContact O-CB 3.36Å; L13-L17 PolarHBondContact O-N 2.93Å
14	R	98	Very high	97.5	Very high	145 Å²	145	106.8 Å²	106.8	55%	0.547	52%	0.522	S	S	.	.	H	α-helix	trans	-61.5	-36.3	174.5	-75	172.4	176	157.5	-4.2	112.6	V10 D11 S12 K18	V10-R14 WeakPolarHBondContact O-CG 3.27Å; V10-R14 PolarHBondContact O-N 2.99Å; D11-R14 IonicContact OD1-NH1 3Å; D11-R14 PolarHBondContact OD1-NH1 3.18Å; S12-R14 PolarHBondContact O-N 3.29Å; R14-K18 WeakPolarHBondContact O-CG 3.49Å
15	R	97.7	Very high	97.6	Very high	157 Å²	157	108 Å²	108	59%	0.592	53%	0.527	S	S	*	.	H	α-helix	trans	-67.7	-47.4	173	-72.4	-170.7	-56.8	-87	2.7	111.3	D11 S12 L13 L17 K18	D11-R15 WeakPolarHBondContact O-CG 3.42Å; D11-R15 PolarHBondContact O-N 2.93Å; D11-R15 VanDerWaalsContact O-N 3.1Å; D11-R15 PolarHBondContact O-NH1 3.15Å; S12-R15 WeakPolarHBondContact O-CB 3.41Å; S12-R15 PolarHBondContact O-N 3.42Å; L13-R15 VanDerWaalsContact C-N 3.3Å; L13-R15 PolarHBondContact O-N 3.41Å; R15-L17 VanDerWaalsContact C-N 3.31Å; R15-L17 PolarHBondContact O-N 3.36Å; R15-K18 PolarHBondContact O-N 2.77Å
16	Q	97.8	Very high	97.7	Very high	90 Å²	90	107 Å²	107	42%	0.421	53%	0.527	S	S	.	.	H	α-helix	trans	-64.2	-34.6	179.9	-69.6	171.7	10.8	0	0	112.9	S12 L13 K18 M19 R21	S12-Q16 WeakPolarHBondContact O-CG 3.49Å; S12-Q16 PolarHBondContact O-N 2.93Å; S12-Q16 PolarHBondContact OG-NE2 2.96Å; L13-Q16 PolarHBondContact O-N 3.4Å; Q16-K18 VanDerWaalsContact C-N 3.25Å; Q16-K18 PolarHBondContact O-N 3.36Å; Q16-M19 HydrophobicContact CB-CE 3.86Å; Q16-M19 HydrophobicContact CG-CE 4.12Å; Q16-M19 WeakPolarHBondContact O-CB 3.29Å; Q16-M19 WeakPolarHBondContact O-CE 3.5Å; Q16-M19 WeakPolarHBondContact O-CG 3.42Å; Q16-M19 PolarHBondContact O-N 3.36Å; Q16-R21 PolarHBondContact O-NH2 3Å
17	L	97.8	Very high	97.7	Very high	125 Å²	125	105.4 Å²	105.4	65%	0.654	52%	0.522	S	S	*	.	H	α-helix	trans	-59	-39	177.2	-177.5	62.2	0	0	0	111.8	L13 R15 M19 R21	L13-L17 WeakPolarHBondContact O-CB 3.36Å; L13-L17 PolarHBondContact O-N 2.93Å; R15-L17 VanDerWaalsContact C-N 3.31Å; R15-L17 PolarHBondContact O-N 3.36Å; L17-M19 VanDerWaalsContact C-N 3.26Å; L17-M19 PolarHBondContact O-N 2.95Å; L17-R21 PolarHBondContact O-NH1 3.48Å; L17-R21 VanDerWaalsContact O-NH1 3.15Å
18	K	97.5	Very high	97.8	Very high	184 Å²	184	103.5 Å²	103.5	80%	0.8	52%	0.523	S	S	*	.	T	Hydrogen-bonded Turn	trans	-75.8	-5	-178.4	-66.5	179	-178.2	-174.4	0	114.4	R14 R15 Q16 H20	R14-K18 WeakPolarHBondContact O-CG 3.49Å; R15-K18 PolarHBondContact O-N 2.77Å; Q16-K18 VanDerWaalsContact C-N 3.25Å; Q16-K18 PolarHBondContact O-N 3.36Å; K18-H20 PolarHBondContact O-N 3.3Å
19	M	97	Very high	97.8	Very high	111 Å²	111	97.7 Å²	97.7	55%	0.547	51%	0.506	S	S	.	.	S	Bend	trans	-65.7	130.7	176.9	-62.7	-173.6	-56.8	0	0	110.2	Q16 L17 R21	Q16-M19 HydrophobicContact CB-CE 3.86Å; Q16-M19 HydrophobicContact CG-CE 4.12Å; Q16-M19 WeakPolarHBondContact O-CB 3.29Å; Q16-M19 WeakPolarHBondContact O-CE 3.5Å; Q16-M19 WeakPolarHBondContact O-CG 3.42Å; Q16-M19 PolarHBondContact O-N 3.36Å; L17-M19 VanDerWaalsContact C-N 3.26Å; L17-M19 PolarHBondContact O-N 2.95Å; M19-R21 PolarHBondContact O-NH1 2.93Å
20	H	97	Very high	97.9	Very high	171 Å²	171	99.4 Å²	99.4	79%	0.792	51%	0.512	S	S	*	.			trans	-63.6	137.8	173.1	-179.1	71.4	0	0	0	109.7	K18	K18-H20 PolarHBondContact O-N 3.3Å
21	R	97.1	Very high	97.9	Very high	155 Å²	155	102 Å²	102	59%	0.585	52%	0.523	S	S	*	.			trans	-121.8	141.9	179.2	-65.6	175	-176.1	73.6	2.5	108.5	Q16 L17 M19	Q16-R21 PolarHBondContact O-NH2 3Å; L17-R21 PolarHBondContact O-NH1 3.48Å; L17-R21 VanDerWaalsContact O-NH1 3.15Å; M19-R21 PolarHBondContact O-NH1 2.93Å
22	V	97.5	Very high	97.9	Very high	80 Å²	80	105 Å²	105	49%	0.485	53%	0.53	S	S	.	.			trans	-104.4	160.1	169.5	-63.9	0	0	0	0	109.8
23	A	98.4	Very high	98	Very high	54 Å²	54	106 Å²	106	45%	0.446	53%	0.533	S	S	.	.			trans	-64.4	143.6	173.8	0	0	0	0	0	110.3	S25 V26 S27	A23-S25 PolarHBondContact O-N 2.75Å; A23-V26 HydrophobicContact CB-CG2 4.2Å; A23-V26 WeakPolarHBondContact O-CB 3.45Å; A23-V26 PolarHBondContact O-N 2.73Å; A23-S27 PolarHBondContact O-N 3.32Å
24	V	98.3	Very high	98	Very high	117 Å²	117	106.7 Å²	106.7	71%	0.709	53%	0.532	S	S	*	.	H	α-helix	trans	-56.5	-40	179.2	175.3	0	0	0	0	111	V26 S27 A28	V24-V26 VanDerWaalsContact C-N 3.26Å; V24-V26 PolarHBondContact O-N 2.94Å; V24-S27 WeakPolarHBondContact CA-OG 3.48Å; V24-S27 PolarHBondContact O-N 3.47Å; V24-S27 PolarHBondContact O-OG 3.14Å; V24-A28 WeakPolarHBondContact O-CB 3.39Å; V24-A28 PolarHBondContact O-N 3.46Å
25	S	98.4	Very high	97.9	Very high	90 Å²	90	103.5 Å²	103.5	63%	0.629	53%	0.528	S	S	*	.	H	α-helix	trans	-57	-36.3	176.1	52.2	0	0	0	0	113.6	A23 N29	A23-S25 PolarHBondContact O-N 2.75Å; S25-N29 WeakPolarHBondContact O-CB 3.31Å; S25-N29 PolarHBondContact O-N 3.32Å
26	V	98.3	Very high	97.9	Very high	66 Å²	66	100.8 Å²	100.8	40%	0.4	52%	0.522	S	S	.	.	H	α-helix	trans	-70.6	-56.3	177	176.5	0	0	0	0	109.7	A23 V24 A28 N29 E30	A23-V26 HydrophobicContact CB-CG2 4.2Å; A23-V26 WeakPolarHBondContact O-CB 3.45Å; A23-V26 PolarHBondContact O-N 2.73Å; V24-V26 VanDerWaalsContact C-N 3.26Å; V24-V26 PolarHBondContact O-N 2.94Å; V26-A28 VanDerWaalsContact C-N 3.29Å; V26-A28 PolarHBondContact O-N 3.49Å; V26-N29 PolarHBondContact O-N 3.1Å; V26-E30 WeakPolarHBondContact O-CG 3.2Å; V26-E30 PolarHBondContact O-N 2.95Å
27	S	98.1	Very high	97.9	Very high	49 Å²	49	103 Å²	103	34%	0.343	53%	0.532	S	S	.	.	H	α-helix	trans	-61.1	-34.9	-179.2	57.6	0	0	0	0	113.5	A23 V24 E30 L31	A23-S27 PolarHBondContact O-N 3.32Å; V24-S27 WeakPolarHBondContact CA-OG 3.48Å; V24-S27 PolarHBondContact O-N 3.47Å; V24-S27 PolarHBondContact O-OG 3.14Å; S27-E30 PolarHBondContact O-N 2.95Å; S27-L31 WeakPolarHBondContact O-CB 2.96Å; S27-L31 PolarHBondContact O-N 2.92Å
28	A	98.5	Very high	97.8	Very high	52 Å²	52	100.3 Å²	100.3	43%	0.43	52%	0.519	S	S	.	.	H	α-helix	trans	-68.8	-37.9	176	0	0	0	0	0	111.6	V24 V26 L31 R32	V24-A28 WeakPolarHBondContact O-CB 3.39Å; V24-A28 PolarHBondContact O-N 3.46Å; V26-A28 VanDerWaalsContact C-N 3.29Å; V26-A28 PolarHBondContact O-N 3.49Å; A28-L31 PolarHBondContact O-N 3.42Å; A28-R32 WeakPolarHBondContact O-CB 3.34Å; A28-R32 PolarHBondContact O-N 3.47Å
29	N	98.4	Very high	97.6	Very high	71 Å²	71	96.1 Å²	96.1	38%	0.38	50%	0.502	S	S	.	.	H	α-helix	trans	-69.3	-39	175.7	-172.9	66	0	0	0	111.8	S25 V26 R32 N33	S25-N29 WeakPolarHBondContact O-CB 3.31Å; S25-N29 PolarHBondContact O-N 3.32Å; V26-N29 PolarHBondContact O-N 3.1Å; N29-R32 PolarHBondContact O-N 3.25Å; N29-R32 PolarHBondContact OD1-NE 2.81Å; N29-R32 PolarHBondContact OD1-NH2 3.28Å; N29-N33 PolarHBondContact O-N 2.96Å; N29-N33 PolarHBondContact O-OD1 3.49Å
30	E	98.3	Very high	97.4	Very high	115 Å²	115	94.5 Å²	94.5	54%	0.537	50%	0.5	S	S	.	.	H	α-helix	trans	-61.1	-45.8	173	-70.6	171.9	175.4	0	0	111.5	V26 S27 R32 N33 F34	V26-E30 WeakPolarHBondContact O-CG 3.2Å; V26-E30 PolarHBondContact O-N 2.95Å; S27-E30 PolarHBondContact O-N 2.95Å; E30-R32 VanDerWaalsContact C-N 3.35Å; E30-R32 PolarHBondContact O-N 2.98Å; E30-N33 PolarHBondContact O-N 3.24Å; E30-F34 WeakPolarHBondContact O-CB 3.37Å; E30-F34 PolarHBondContact O-N 3.49Å
31	L	98.4	Very high	97.1	Very high	113 Å²	113	93.2 Å²	93.2	59%	0.592	49%	0.494	S	S	*	.	H	α-helix	trans	-61.5	-43	175.9	-178.1	63.2	0	0	0	111.8	S27 A28 F34 V35	S27-L31 WeakPolarHBondContact O-CB 2.96Å; S27-L31 PolarHBondContact O-N 2.92Å; A28-L31 PolarHBondContact O-N 3.42Å; L31-F34 PolarHBondContact O-N 3.18Å; L31-V35 WeakPolarHBondContact O-CG2 3.37Å; L31-V35 PolarHBondContact O-N 3.18Å
32	R	98.1	Very high	96.8	Very high	117 Å²	117	88.8 Å²	88.8	44%	0.442	48%	0.482	S	S	.	.	H	α-helix	trans	-59.6	-49.9	176.3	-178.4	-174.7	67.7	88.5	5.1	111.2	A28 N29 E30 F34 V35 E36	A28-R32 WeakPolarHBondContact O-CB 3.34Å; A28-R32 PolarHBondContact O-N 3.47Å; N29-R32 PolarHBondContact O-N 3.25Å; N29-R32 PolarHBondContact OD1-NE 2.81Å; N29-R32 PolarHBondContact OD1-NH2 3.28Å; E30-R32 VanDerWaalsContact C-N 3.35Å; E30-R32 PolarHBondContact O-N 2.98Å; R32-F34 VanDerWaalsContact C-N 3.3Å; R32-F34 PolarHBondContact O-N 3.42Å; R32-V35 PolarHBondContact O-N 2.86Å; R32-E36 WeakPolarHBondContact CD-OE1 3.39Å; R32-E36 HydrophobicContact CG-CG 4.42Å; R32-E36 VanDerWaalsContact CG-OE1 3.29Å; R32-E36 WeakPolarHBondContact CG-OE1 3.41Å; R32-E36 IonicContact CZ-OE1 3.99Å; R32-E36 IonicContact CZ-OE2 2.75Å; R32-E36 IonicContact NE-OE1 3.17Å; R32-E36 VanDerWaalsContact NH1-CD 3.27Å; R32-E36 IonicContact NH1-OE1 3.7Å; R32-E36 PolarHBondContact NH1-OE1 3.05Å; R32-E36 IonicContact NH1-OE2 3.88Å; R32-E36 PolarHBondContact NH1-OE2 2.96Å; R32-E36 WeakPolarHBondContact O-CG 3.39Å; R32-E36 PolarHBondContact O-N 3.24Å
33	N	98.2	Very high	96.5	Very high	55 Å²	55	88.6 Å²	88.6	29%	0.294	48%	0.482	S	S	.	.	H	α-helix	trans	-58.6	-44.5	178.5	-69.1	-4	0	0	0	111	N29 E30 V35 E36 E37	N29-N33 PolarHBondContact O-N 2.96Å; N29-N33 PolarHBondContact O-OD1 3.49Å; E30-N33 PolarHBondContact O-N 3.24Å; N33-V35 VanDerWaalsContact C-N 3.34Å; N33-V35 PolarHBondContact O-N 3.37Å; N33-E36 PolarHBondContact O-N 3.37Å; N33-E37 WeakPolarHBondContact O-CB 3.42Å; N33-E37 VanDerWaalsContact O-CG 3.27Å; N33-E37 WeakPolarHBondContact O-CG 3.43Å; N33-E37 PolarHBondContact O-N 3.29Å
34	F	98.4	Very high	96.1	Very high	124 Å²	124	93.8 Å²	93.8	54%	0.544	50%	0.502	S	S	.	.	H	α-helix	trans	-58.2	-45.5	176.4	178.2	-93.7	0	0	0	112	E30 L31 R32 N38	E30-F34 WeakPolarHBondContact O-CB 3.37Å; E30-F34 PolarHBondContact O-N 3.49Å; L31-F34 PolarHBondContact O-N 3.18Å; R32-F34 VanDerWaalsContact C-N 3.3Å; R32-F34 PolarHBondContact O-N 3.42Å; F34-N38 WeakPolarHBondContact CE2-ND2 3.38Å; F34-N38 WeakPolarHBondContact O-CB 3.48Å; F34-N38 PolarHBondContact O-N 3.06Å; F34-N38 VanDerWaalsContact O-N 3.15Å; F34-N38 PolarHBondContact O-ND2 3.19Å
35	V	97.5	Very high	95.8	Very high	78 Å²	78	92.1 Å²	92.1	47%	0.473	49%	0.492	S	S	.	.	H	α-helix	trans	-63.5	-47.4	177.6	172	0	0	0	0	111	L31 R32 N33 E37 N38 Q39	L31-V35 WeakPolarHBondContact O-CG2 3.37Å; L31-V35 PolarHBondContact O-N 3.18Å; R32-V35 PolarHBondContact O-N 2.86Å; N33-V35 VanDerWaalsContact C-N 3.34Å; N33-V35 PolarHBondContact O-N 3.37Å; V35-E37 VanDerWaalsContact C-N 3.35Å; V35-E37 PolarHBondContact O-N 3.05Å; V35-N38 PolarHBondContact O-N 3.22Å; V35-Q39 WeakPolarHBondContact O-CB 3.48Å; V35-Q39 PolarHBondContact O-N 3.17Å
36	E	96.5	Very high	95.2	Very high	100 Å²	100	92 Å²	92	47%	0.467	48%	0.484	S	S	.	.	H	α-helix	trans	-61.2	-40.8	-179.4	-72.8	173	-174.9	0	0	112.4	R32 N33	R32-E36 WeakPolarHBondContact CD-OE1 3.39Å; R32-E36 HydrophobicContact CG-CG 4.42Å; R32-E36 VanDerWaalsContact CG-OE1 3.29Å; R32-E36 WeakPolarHBondContact CG-OE1 3.41Å; R32-E36 IonicContact CZ-OE1 3.99Å; R32-E36 IonicContact CZ-OE2 2.75Å; R32-E36 IonicContact NE-OE1 3.17Å; R32-E36 VanDerWaalsContact NH1-CD 3.27Å; R32-E36 IonicContact NH1-OE1 3.7Å; R32-E36 PolarHBondContact NH1-OE1 3.05Å; R32-E36 IonicContact NH1-OE2 3.88Å; R32-E36 PolarHBondContact NH1-OE2 2.96Å; R32-E36 WeakPolarHBondContact O-CG 3.39Å; R32-E36 PolarHBondContact O-N 3.24Å; N33-E36 PolarHBondContact O-N 3.37Å
37	E	97.2	Very high	94.3	Very high	135 Å²	135	95.9 Å²	95.9	63%	0.631	50%	0.502	S	S	*	.	H	α-helix	trans	-68.1	-33.3	177.8	-72.8	170.7	-172.4	0	0	112.8	N33 V35	N33-E37 WeakPolarHBondContact O-CB 3.42Å; N33-E37 VanDerWaalsContact O-CG 3.27Å; N33-E37 WeakPolarHBondContact O-CG 3.43Å; N33-E37 PolarHBondContact O-N 3.29Å; V35-E37 VanDerWaalsContact C-N 3.35Å; V35-E37 PolarHBondContact O-N 3.05Å
38	N	96	Very high	93.3	Very high	69 Å²	69	95.8 Å²	95.8	37%	0.369	50%	0.502	S	S	.	.	H	α-helix	trans	-95.8	-17.6	-175.7	-72.1	-86.2	0	0	0	113.6	F34 V35 P40 H41 D42	F34-N38 WeakPolarHBondContact CE2-ND2 3.38Å; F34-N38 WeakPolarHBondContact O-CB 3.48Å; F34-N38 PolarHBondContact O-N 3.06Å; F34-N38 VanDerWaalsContact O-N 3.15Å; F34-N38 PolarHBondContact O-ND2 3.19Å; V35-N38 PolarHBondContact O-N 3.22Å; N38-P40 VanDerWaalsContact C-CD 3.45Å; N38-H41 WeakPolarHBondContact O-CA 3.16Å; N38-H41 WeakPolarHBondContact O-CB 3.39Å; N38-H41 PolarHBondContact O-N 2.92Å; N38-D42 PolarHBondContact O-N 3.06Å
39	Q	94.1	Very high	92.4	Very high	96 Å²	96	97.6 Å²	97.6	45%	0.449	50%	0.504	S	S	.	.	G	3₁₀ helix	trans	-51.5	-44.7	-178.5	-171	-170.8	-70.7	0	0	114	V35 H41 D42 V45	V35-Q39 WeakPolarHBondContact O-CB 3.48Å; V35-Q39 PolarHBondContact O-N 3.17Å; Q39-H41 PolarHBondContact O-N 3.02Å; Q39-H41 VanDerWaalsContact O-N 3.11Å; Q39-D42 PolarHBondContact O-N 2.92Å; Q39-D42 VanDerWaalsContact O-N 3.12Å; Q39-V45 HydrophobicContact CG-CB 4.34Å; Q39-V45 HydrophobicContact CG-CG1 3.63Å
40	P	91.8	Very high	91.4	Very high	77 Å²	77	102.4 Å²	102.4	50%	0.5	52%	0.522	S	S	.	.	G	3₁₀ helix	trans	-65.4	-15.8	179.4	-20.4	34.1	0	0	0	113.8	N38	N38-P40 VanDerWaalsContact C-CD 3.45Å
41	H	90.7	Very high	90.5	Very high	145 Å²	145	105.7 Å²	105.7	67%	0.671	53%	0.534	S	S	*	.	G	3₁₀ helix	trans	-100.6	-4.4	-179.6	-54.7	96.5	0	0	0	112.6	N38 Q39 P43	N38-H41 WeakPolarHBondContact O-CA 3.16Å; N38-H41 WeakPolarHBondContact O-CB 3.39Å; N38-H41 PolarHBondContact O-N 2.92Å; Q39-H41 PolarHBondContact O-N 3.02Å; Q39-H41 VanDerWaalsContact O-N 3.11Å; H41-P43 VanDerWaalsContact O-CD 3.23Å; H41-P43 WeakPolarHBondContact O-CD 3.49Å
42	D	92.5	Very high	89.8	Confident	61 Å²	61	105.2 Å²	105.2	33%	0.326	54%	0.536	S	S	.	.			trans	-88.7	105.9	177.9	-172.8	-19.7	0	0	0	109.8	N38 Q39 L44 V45 D46	N38-D42 PolarHBondContact O-N 3.06Å; Q39-D42 PolarHBondContact O-N 2.92Å; Q39-D42 VanDerWaalsContact O-N 3.12Å; D42-L44 PolarHBondContact O-N 3.41Å; D42-L44 VanDerWaalsContact O-N 3.07Å; D42-L44 VanDerWaalsContact OD1-CB 3.29Å; D42-L44 WeakPolarHBondContact OD1-CB 3.37Å; D42-L44 PolarHBondContact OD1-N 3.39Å; D42-V45 HydrophobicContact CB-CB 4.15Å; D42-V45 HydrophobicContact CB-CG2 4.17Å; D42-V45 PolarHBondContact O-N 2.89Å; D42-V45 WeakPolarHBondContact OD2-CG2 3.44Å; D42-D46 PolarHBondContact O-N 3.28Å
43	P	90.4	Very high	89.2	Confident	76 Å²	76	102.4 Å²	102.4	49%	0.494	53%	0.529	S	S	.	.	T	Hydrogen-bonded Turn	trans	-65.2	-14.2	-177.8	-19.1	34.6	0	0	0	113.8	H41 D46	H41-P43 VanDerWaalsContact O-CD 3.23Å; H41-P43 WeakPolarHBondContact O-CD 3.49Å; P43-D46 CarbonylContact C-O 3.45Å; P43-D46 WeakPolarHBondContact CA-O 3.36Å
44	L	90.8	Very high	88.6	Confident	164 Å²	164	103.8 Å²	103.8	86%	0.859	54%	0.542	S	S	*	.	T	Hydrogen-bonded Turn	trans	-89.2	-19.9	178.5	-56	179.3	0	0	0	112.4	D42	D42-L44 PolarHBondContact O-N 3.41Å; D42-L44 VanDerWaalsContact O-N 3.07Å; D42-L44 VanDerWaalsContact OD1-CB 3.29Å; D42-L44 WeakPolarHBondContact OD1-CB 3.37Å; D42-L44 PolarHBondContact OD1-N 3.39Å
45	V	91.7	Very high	88	Confident	82 Å²	82	108.6 Å²	108.6	50%	0.497	56%	0.556	S	S	.	*	T	Hydrogen-bonded Turn	trans	-103.3	-52.2	177.6	-178.3	0	0	0	0	110.4	Q39 D42	Q39-V45 HydrophobicContact CG-CB 4.34Å; Q39-V45 HydrophobicContact CG-CG1 3.63Å; D42-V45 HydrophobicContact CB-CB 4.15Å; D42-V45 HydrophobicContact CB-CG2 4.17Å; D42-V45 PolarHBondContact O-N 2.89Å; D42-V45 WeakPolarHBondContact OD2-CG2 3.44Å
46	D	85.7	Confident	87.3	Confident	87 Å²	87	106.2 Å²	106.2	47%	0.465	55%	0.545	S	S	.	.	T	Hydrogen-bonded Turn	trans	-97.8	117.2	172.9	-157.1	-9.6	0	0	0	108.9	D42 P43 S48	D42-D46 PolarHBondContact O-N 3.28Å; P43-D46 CarbonylContact C-O 3.45Å; P43-D46 WeakPolarHBondContact CA-O 3.36Å; D46-S48 PolarHBondContact O-N 3.17Å
47	N	78.4	Confident	86.5	Confident	147 Å²	147	109.4 Å²	109.4	79%	0.786	56%	0.56	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.4	100.2	-172.4	-79.2	-80.2	0	0	0	109.9
48	S	78	Confident	85.4	Confident	47 Å²	47	113.9 Å²	113.9	33%	0.329	57%	0.571	S	S	.	*			trans	-59.2	147.5	170.5	65.4	0	0	0	0	111	D46 K50	D46-S48 PolarHBondContact O-N 3.17Å; S48-K50 PolarHBondContact O-N 3.4Å
49	D	78.8	Confident	84.4	Confident	91 Å²	91	114.3 Å²	114.3	49%	0.487	58%	0.584	S	S	.	*			trans	-52.5	135.4	178.7	-174.5	-21.4	0	0	0	110	K51 V52 N53	D49-K51 PolarHBondContact O-N 3.28Å; D49-K51 WeakPolarHBondContact OD1-CG 3.47Å; D49-K51 PolarHBondContact OD1-N 2.84Å; D49-V52 HydrophobicContact CB-CG2 4.12Å; D49-V52 WeakPolarHBondContact O-CG2 3.4Å; D49-V52 PolarHBondContact O-N 3.41Å; D49-N53 PolarHBondContact O-N 3.34Å
50	K	77.5	Confident	83.3	Confident	171 Å²	171	118.7 Å²	118.7	74%	0.743	60%	0.601	S	S	*	*	T	Hydrogen-bonded Turn	trans	-51.9	-26.6	175.8	-66.8	-174.4	178.7	-175.6	0	112.4	S48 N53 A56	S48-K50 PolarHBondContact O-N 3.4Å; K50-N53 PolarHBondContact O-N 2.91Å; K50-A56 HydrophobicContact CB-CB 4.41Å; K50-A56 WeakPolarHBondContact O-CB 3.37Å
51	K	80.2	Confident	82.4	Confident	184 Å²	184	120.1 Å²	120.1	80%	0.8	61%	0.612	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.5	-31.8	175.6	-66.5	177.1	-176.1	171.1	0	114	D49	D49-K51 PolarHBondContact O-N 3.28Å; D49-K51 WeakPolarHBondContact OD1-CG 3.47Å; D49-K51 PolarHBondContact OD1-N 2.84Å
52	V	84	Confident	81.6	Confident	103 Å²	103	118.5 Å²	118.5	62%	0.624	61%	0.612	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.2	-19.3	177.8	-69.5	0	0	0	0	112.5	D49 P54	D49-V52 HydrophobicContact CB-CG2 4.12Å; D49-V52 WeakPolarHBondContact O-CG2 3.4Å; D49-V52 PolarHBondContact O-N 3.41Å; V52-P54 VanDerWaalsContact O-CD 3.27Å; V52-P54 WeakPolarHBondContact O-CD 3.49Å
53	N	85.9	Confident	80.8	Confident	58 Å²	58	123.2 Å²	123.2	31%	0.31	64%	0.637	S	S	.	*			trans	-68.9	113.5	174.9	-179	-10.3	0	0	0	111.1	D49 K50 W55 A56	D49-N53 PolarHBondContact O-N 3.34Å; K50-N53 PolarHBondContact O-N 2.91Å; N53-W55 PolarHBondContact O-N 3.22Å; N53-W55 WeakPolarHBondContact OD1-CA 3.35Å; N53-W55 WeakPolarHBondContact OD1-CB 3.35Å; N53-W55 VanDerWaalsContact OD1-CE3 3.3Å; N53-W55 PolarHBondContact OD1-N 3.33Å; N53-A56 HydrophobicContact CB-CB 4.12Å; N53-A56 WeakPolarHBondContact O-CB 3.47Å; N53-A56 PolarHBondContact O-N 3.15Å; N53-A56 VanDerWaalsContact O-N 3.15Å; N53-A56 PolarHBondContact OD1-N 3.34Å
54	P	85	Confident	79.6	Confident	85 Å²	85	130.9 Å²	130.9	55%	0.552	67%	0.672	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.5	-17	-178	28.8	-34.1	0	0	0	113.5	V52	V52-P54 VanDerWaalsContact O-CD 3.27Å; V52-P54 WeakPolarHBondContact O-CD 3.49Å
55	W	84.9	Confident	79.1	Confident	224 Å²	224	129.2 Å²	129.2	85%	0.848	66%	0.663	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.7	-2.4	177.4	-55.7	-78.2	0	0	0	113.5	N53 E57	N53-W55 PolarHBondContact O-N 3.22Å; N53-W55 WeakPolarHBondContact OD1-CA 3.35Å; N53-W55 WeakPolarHBondContact OD1-CB 3.35Å; N53-W55 VanDerWaalsContact OD1-CE3 3.3Å; N53-W55 PolarHBondContact OD1-N 3.33Å; W55-E57 PolarHBondContact O-N 3.06Å
56	A	82.8	Confident	78.4	Confident	28 Å²	28	131.7 Å²	131.7	23%	0.231	67%	0.672	C	S	.	*	S	Bend	trans	-62.2	128.6	173.2	0	0	0	0	0	109.6	K50 N53 R58	K50-A56 HydrophobicContact CB-CB 4.41Å; K50-A56 WeakPolarHBondContact O-CB 3.37Å; N53-A56 HydrophobicContact CB-CB 4.12Å; N53-A56 WeakPolarHBondContact O-CB 3.47Å; N53-A56 PolarHBondContact O-N 3.15Å; N53-A56 VanDerWaalsContact O-N 3.15Å; N53-A56 PolarHBondContact OD1-N 3.34Å; A56-R58 PolarHBondContact O-N 3.28Å
57	E	80.8	Confident	78	Confident	167 Å²	167	134.2 Å²	134.2	78%	0.78	68%	0.683	S	S	*	*			trans	-56.4	113.6	176.6	-73.1	-173	172.9	0	0	110.1	W55	W55-E57 PolarHBondContact O-N 3.06Å
58	R	73.5	Confident	78	Confident	229 Å²	229	133.4 Å²	133.4	86%	0.864	68%	0.677	S	S	*	*	S	Bend	trans	-79.5	-23.3	177.2	-62.3	-174.4	179.7	-164.3	-1.5	112.3	A56	A56-R58 PolarHBondContact O-N 3.28Å
59	A	74.2	Confident	78	Confident	78 Å²	78	138.8 Å²	138.8	65%	0.645	70%	0.699	S	S	*	*	S	Bend	trans	-153.3	152	177.8	0	0	0	0	0	109.6	C61	A59-C61 PolarHBondContact O-N 3.32Å
60	K	71.6	Confident	77.9	Confident	188 Å²	188	142 Å²	142	82%	0.817	71%	0.713	S	S	*	*			trans	-63.3	128.1	172.8	-65.5	-176.6	178.6	-177.6	0	109	V62	K60-V62 PolarHBondContact O-N 2.98Å
61	C	72.5	Confident	77.9	Confident	108 Å²	108	139.9 Å²	139.9	73%	0.73	71%	0.711	S	S	*	*			trans	-65.3	118.1	167.8	-175.3	0	0	0	0	108.5	A59	A59-C61 PolarHBondContact O-N 3.32Å
62	V	74.3	Confident	77.8	Confident	111 Å²	111	136.5 Å²	136.5	67%	0.673	70%	0.704	S	S	*	*			trans	-99	109	168.8	-177.2	0	0	0	0	106.1	K60 L64	K60-V62 PolarHBondContact O-N 2.98Å; V62-L64 PolarHBondContact O-N 3.23Å
63	L	75.5	Confident	77.2	Confident	160 Å²	160	139.3 Å²	139.3	84%	0.838	71%	0.71	S	S	*	*			trans	-68.2	118.3	164.7	-68.9	167.6	0	0	0	106.8
64	L	66	Low	76.5	Confident	236 Å²	236	146.7 Å²	146.7	100%	1.236	75%	0.747	S	S	*	*			trans	-81.7	0	171.6	-72	170.9	0	0	0	110.5	V62	V62-L64 PolarHBondContact O-N 3.23Å

Retrieved 64 of 64 residues in 117.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).