A0A077Z227_TRITR Loading...

Zf-C3HC4 3 domain containing protein

AlphaFold DB , UniProt , Accession A0A077Z227, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 101 aa.

						>A0A077Z227_TRITR|A0A077Z227
MLLKVLRGCLSSKMWYRSNPFVTWYANLVSDSLSSAVAEWGDDQEEQDECKICMVSRVDSAFYPCGHYSMCYPCAKLTFRKQGVCPICRKPIRDVLKIFKS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48.3	Very low	47.4	Very low	248 Å²	248	160.2 Å²	160.2	100%	1.222	85%	0.851	S	S	*	*				0	37.4	0	-78.2	170	159.1	0	0	112.6
2	L	46.7	Very low	47.9	Very low	166 Å²	166	153.6 Å²	153.6	87%	0.869	83%	0.827	S	S	*	*			trans	-140.9	33.1	-178.8	-93.6	163.3	0	0	0	112.7
3	L	43.5	Very low	48.1	Very low	178 Å²	178	154.2 Å²	154.2	93%	0.932	82%	0.818	S	S	*	*	S	Bend	trans	-141.7	47	174.6	-88.5	161.5	0	0	0	110.5
4	K	41	Very low	48.4	Very low	206 Å²	206	152.4 Å²	152.4	90%	0.896	81%	0.805	S	S	*	*			trans	-141.2	43	176.7	-96.7	-179.5	173.7	166	0	111.8
5	V	50.1	Low	48.7	Very low	128 Å²	128	155.9 Å²	155.9	78%	0.776	80%	0.803	S	S	*	*	S	Bend	trans	-126.2	19.3	179	-164.2	0	0	0	0	112.8
6	L	47.6	Very low	49	Very low	175 Å²	175	155.6 Å²	155.6	92%	0.916	79%	0.79	S	S	*	*	S	Bend	trans	-132.5	34.6	175.3	-66.9	174.9	0	0	0	113.2
7	R	46.8	Very low	49.4	Very low	247 Å²	247	157.5 Å²	157.5	93%	0.932	79%	0.785	S	S	*	*			trans	-127.8	25.3	168.6	-76.8	-170.5	171.6	-177.5	-2.1	113.2
8	G	40.8	Very low	50.5	Low	68 Å²	68	153.8 Å²	153.8	70%	0.701	78%	0.776	S	S	*	*	S	Bend	trans	-100.7	128.7	171.1	0	0	0	0	0	111.1
9	C	49.4	Very low	51.8	Low	90 Å²	90	149.4 Å²	149.4	61%	0.608	76%	0.755	S	S	*	*			trans	72.8	66.2	170.9	-70.6	0	0	0	0	118.3
10	L	52.6	Low	53.4	Low	159 Å²	159	146.9 Å²	146.9	83%	0.832	75%	0.75	S	S	*	*	S	Bend	trans	-77.1	-4.2	152.4	-95.4	89	0	0	0	113.5
11	S	54.7	Low	54.8	Low	97 Å²	97	146.6 Å²	146.6	68%	0.678	74%	0.743	S	S	*	*	S	Bend	trans	-86.4	-26.5	-178.7	-161	0	0	0	0	113.8	K13	S11-K13 PolarHBondContact O-N 2.95Å
12	S	53.2	Low	56.3	Low	81 Å²	81	135.2 Å²	135.2	57%	0.566	69%	0.688	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.1	-9.6	-175.3	-53	0	0	0	0	114.7	M14	S12-M14 VanDerWaalsContact C-N 3.32Å
13	K	50.7	Low	58.1	Low	162 Å²	162	129.7 Å²	129.7	70%	0.704	66%	0.661	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.8	-10	176.9	-63.3	-172.6	-177.9	-177.3	0	113.4	S11	S11-K13 PolarHBondContact O-N 2.95Å
14	M	52.8	Low	60.2	Low	128 Å²	128	128.3 Å²	128.3	63%	0.631	64%	0.644	S	S	*	*	H	α-helix	trans	-80.1	-27.2	-176.2	-152	117.9	95.9	0	0	113	S12 Y16 R17	S12-M14 VanDerWaalsContact C-N 3.32Å; M14-Y16 PolarHBondContact O-N 2.96Å; M14-R17 PolarHBondContact O-N 3.13Å
15	W	52.5	Low	62.2	Low	206 Å²	206	125 Å²	125	78%	0.78	63%	0.626	S	S	*	*	H	α-helix	trans	-69.2	-31.7	-179.3	-75.4	77.1	0	0	0	113.4	R17 S18 N19	W15-R17 PolarHBondContact O-N 2.86Å; W15-S18 PolarHBondContact O-OG 3.33Å; W15-N19 PolarHBondContact O-N 3.44Å
16	Y	53.8	Low	63.8	Low	150 Å²	150	121 Å²	121	59%	0.588	61%	0.608	S	S	*	*	H	α-helix	trans	-69.4	-28	176.8	-149.7	-113.9	0	0	0	110.7	M14 V22	M14-Y16 PolarHBondContact O-N 2.96Å; Y16-V22 HydrophobicContact CD1-CB 4.39Å; Y16-V22 HydrophobicContact CD1-CG1 3.1Å; Y16-V22 HydrophobicContact CD2-CB 4.23Å; Y16-V22 HydrophobicContact CD2-CG1 3.66Å; Y16-V22 HydrophobicContact CD2-CG2 3.68Å; Y16-V22 HydrophobicContact CE1-CB 4.13Å; Y16-V22 HydrophobicContact CE1-CG1 2.95Å; Y16-V22 HydrophobicContact CE1-CG2 4.26Å; Y16-V22 HydrophobicContact CE2-CB 3.94Å; Y16-V22 HydrophobicContact CE2-CG1 3.52Å; Y16-V22 HydrophobicContact CE2-CG2 3.2Å; Y16-V22 HydrophobicContact CG-CB 4.41Å; Y16-V22 HydrophobicContact CG-CG1 3.43Å; Y16-V22 VanDerWaalsContact CG-CG1 3.43Å; Y16-V22 HydrophobicContact CG-CG2 4.35Å; Y16-V22 VanDerWaalsContact CZ-CG2 3.49Å; Y16-V22 WeakPolarHBondContact O-CG1 3.47Å
17	R	55.4	Low	65.7	Low	189 Å²	189	118 Å²	118	71%	0.713	59%	0.593	S	S	*	*	H	α-helix	trans	-83	-14.7	-177.4	-162.1	148	67.6	-148.3	5.7	114.3	M14 W15	M14-R17 PolarHBondContact O-N 3.13Å; W15-R17 PolarHBondContact O-N 2.86Å
18	S	69	Low	67.4	Low	90 Å²	90	109.9 Å²	109.9	63%	0.629	57%	0.567	S	S	*	*	T	Hydrogen-bonded Turn	trans	-101.8	-2	173.2	53.6	0	0	0	0	113.5	W15 P20	W15-S18 PolarHBondContact O-OG 3.33Å; S18-P20 VanDerWaalsContact O-CD 3.27Å; S18-P20 WeakPolarHBondContact O-CD 3.28Å
19	N	76	Confident	69.6	Low	70 Å²	70	110 Å²	110	37%	0.374	55%	0.554	S	S	.	*			trans	-87.9	109.5	176.5	-174.8	-19.9	0	0	0	109.6	W15 F21 V22 T23	W15-N19 PolarHBondContact O-N 3.44Å; N19-F21 PolarHBondContact O-N 3.09Å; N19-F21 WeakPolarHBondContact OD1-CB 3.46Å; N19-F21 PolarHBondContact OD1-N 2.8Å; N19-F21 VanDerWaalsContact OD1-N 3.08Å; N19-V22 HydrophobicContact CB-CB 3.96Å; N19-V22 HydrophobicContact CB-CG2 3.94Å; N19-V22 WeakPolarHBondContact O-CB 3.28Å; N19-V22 PolarHBondContact O-N 3.32Å; N19-V22 VanDerWaalsContact O-N 3.11Å; N19-T23 PolarHBondContact O-N 3.18Å; N19-T23 VanDerWaalsContact O-N 3.09Å; N19-T23 PolarHBondContact O-OG1 2.87Å
20	P	82.2	Confident	71.1	Confident	100 Å²	100	109.3 Å²	109.3	65%	0.649	55%	0.55	S	S	*	.	H	α-helix	trans	-62	-28.3	-176.1	23.8	-32.8	0	0	0	113.2	S18 V22 T23 W24	S18-P20 VanDerWaalsContact O-CD 3.27Å; S18-P20 WeakPolarHBondContact O-CD 3.28Å; P20-V22 VanDerWaalsContact C-N 3.34Å; P20-T23 WeakPolarHBondContact CA-OG1 2.97Å; P20-T23 PolarHBondContact O-OG1 3.11Å; P20-W24 WeakPolarHBondContact O-CB 3.33Å; P20-W24 PolarHBondContact O-N 3.2Å
21	F	83.5	Confident	72.6	Confident	140 Å²	140	106.7 Å²	106.7	61%	0.614	54%	0.537	S	S	*	.	H	α-helix	trans	-67.2	-40.4	177.1	-179.9	-106	0	0	0	111.8	N19 Y25	N19-F21 PolarHBondContact O-N 3.09Å; N19-F21 WeakPolarHBondContact OD1-CB 3.46Å; N19-F21 PolarHBondContact OD1-N 2.8Å; N19-F21 VanDerWaalsContact OD1-N 3.08Å; F21-Y25 PolarHBondContact O-N 3.44Å
22	V	80.3	Confident	74	Confident	10 Å²	10	105.6 Å²	105.6	6%	0.061	53%	0.529	C	S	.	.	H	α-helix	trans	-71.6	-45.4	-178.8	156.7	0	0	0	0	111.9	Y16 N19 P20 W24 Y25 A26	Y16-V22 HydrophobicContact CD1-CB 4.39Å; Y16-V22 HydrophobicContact CD1-CG1 3.1Å; Y16-V22 HydrophobicContact CD2-CB 4.23Å; Y16-V22 HydrophobicContact CD2-CG1 3.66Å; Y16-V22 HydrophobicContact CD2-CG2 3.68Å; Y16-V22 HydrophobicContact CE1-CB 4.13Å; Y16-V22 HydrophobicContact CE1-CG1 2.95Å; Y16-V22 HydrophobicContact CE1-CG2 4.26Å; Y16-V22 HydrophobicContact CE2-CB 3.94Å; Y16-V22 HydrophobicContact CE2-CG1 3.52Å; Y16-V22 HydrophobicContact CE2-CG2 3.2Å; Y16-V22 HydrophobicContact CG-CB 4.41Å; Y16-V22 HydrophobicContact CG-CG1 3.43Å; Y16-V22 VanDerWaalsContact CG-CG1 3.43Å; Y16-V22 HydrophobicContact CG-CG2 4.35Å; Y16-V22 VanDerWaalsContact CZ-CG2 3.49Å; Y16-V22 WeakPolarHBondContact O-CG1 3.47Å; N19-V22 HydrophobicContact CB-CB 3.96Å; N19-V22 HydrophobicContact CB-CG2 3.94Å; N19-V22 WeakPolarHBondContact O-CB 3.28Å; N19-V22 PolarHBondContact O-N 3.32Å; N19-V22 VanDerWaalsContact O-N 3.11Å; P20-V22 VanDerWaalsContact C-N 3.34Å; V22-W24 VanDerWaalsContact C-N 3.31Å; V22-Y25 PolarHBondContact O-N 3.47Å; V22-A26 WeakPolarHBondContact O-CB 3.36Å; V22-A26 PolarHBondContact O-N 3.41Å
23	T	83.3	Confident	75.2	Confident	50 Å²	50	107.2 Å²	107.2	31%	0.307	53%	0.531	S	S	.	.	H	α-helix	trans	-67	-38	178.9	55.6	0	0	0	0	110.5	N19 P20 A26 N27	N19-T23 PolarHBondContact O-N 3.18Å; N19-T23 VanDerWaalsContact O-N 3.09Å; N19-T23 PolarHBondContact O-OG1 2.87Å; P20-T23 WeakPolarHBondContact CA-OG1 2.97Å; P20-T23 PolarHBondContact O-OG1 3.11Å; T23-A26 PolarHBondContact O-N 3.44Å; T23-N27 WeakPolarHBondContact O-CB 3.39Å; T23-N27 VanDerWaalsContact O-CG 3.23Å; T23-N27 PolarHBondContact O-N 2.91Å; T23-N27 PolarHBondContact O-ND2 2.93Å
24	W	88.6	Confident	76.6	Confident	148 Å²	148	102.7 Å²	102.7	56%	0.561	52%	0.519	S	S	*	.	H	α-helix	trans	-59.7	-48.4	171.8	176.3	83	0	0	0	112	P20 V22 N27 L28	P20-W24 WeakPolarHBondContact O-CB 3.33Å; P20-W24 PolarHBondContact O-N 3.2Å; V22-W24 VanDerWaalsContact C-N 3.31Å; W24-N27 PolarHBondContact O-N 3.22Å; W24-L28 HydrophobicContact CD2-CD1 3.9Å; W24-L28 VanDerWaalsContact CE2-CD1 3.43Å; W24-L28 HydrophobicContact CE3-CD1 4Å; W24-L28 HydrophobicContact CH2-CD1 3.26Å; W24-L28 HydrophobicContact CZ2-CD1 3.13Å; W24-L28 HydrophobicContact CZ2-CG 4.34Å; W24-L28 HydrophobicContact CZ3-CD1 3.69Å; W24-L28 PolarHBondContact O-N 2.87Å
25	Y	82.3	Confident	77.7	Confident	136 Å²	136	99.5 Å²	99.5	53%	0.533	51%	0.51	S	S	.	.	H	α-helix	trans	-60.8	-49.5	177.9	-172.9	-101.2	0	0	0	111.2	F21 V22 N27 L28 V29	F21-Y25 PolarHBondContact O-N 3.44Å; V22-Y25 PolarHBondContact O-N 3.47Å; Y25-N27 VanDerWaalsContact C-N 3.3Å; Y25-N27 PolarHBondContact O-N 3.4Å; Y25-L28 WeakPolarHBondContact O-CB 3.37Å; Y25-L28 PolarHBondContact O-N 2.99Å; Y25-L28 VanDerWaalsContact O-N 3.08Å; Y25-V29 HydrophobicContact CD1-CG2 3.73Å; Y25-V29 HydrophobicContact CE1-CG2 3.58Å; Y25-V29 HydrophobicContact CG-CG2 4.3Å; Y25-V29 WeakPolarHBondContact O-CG2 3.36Å; Y25-V29 PolarHBondContact O-N 2.97Å
26	A	84.3	Confident	78.8	Confident	46 Å²	46	92 Å²	92	38%	0.38	49%	0.492	S	S	.	.	H	α-helix	trans	-58	-39.6	178.7	0	0	0	0	0	113.1	V22 T23 S30	V22-A26 WeakPolarHBondContact O-CB 3.36Å; V22-A26 PolarHBondContact O-N 3.41Å; T23-A26 PolarHBondContact O-N 3.44Å; A26-S30 WeakPolarHBondContact O-CB 3.28Å; A26-S30 PolarHBondContact O-N 2.9Å; A26-S30 PolarHBondContact O-OG 2.78Å
27	N	87	Confident	79.5	Confident	112 Å²	112	89.1 Å²	89.1	60%	0.599	49%	0.49	S	S	*	.	H	α-helix	trans	-67.2	-42.4	174.3	-73	-25.1	0	0	0	111.5	T23 W24 Y25 V29 S30 D31	T23-N27 WeakPolarHBondContact O-CB 3.39Å; T23-N27 VanDerWaalsContact O-CG 3.23Å; T23-N27 PolarHBondContact O-N 2.91Å; T23-N27 PolarHBondContact O-ND2 2.93Å; W24-N27 PolarHBondContact O-N 3.22Å; Y25-N27 VanDerWaalsContact C-N 3.3Å; Y25-N27 PolarHBondContact O-N 3.4Å; N27-V29 PolarHBondContact O-N 2.91Å; N27-S30 PolarHBondContact O-N 2.89Å; N27-D31 WeakPolarHBondContact O-CB 3.45Å; N27-D31 PolarHBondContact O-N 3.33Å
28	L	83.7	Confident	80.2	Confident	76 Å²	76	83.9 Å²	83.9	40%	0.398	49%	0.487	S	S	.	.	H	α-helix	trans	-60	-45.1	175.2	-107.6	174.1	0	0	0	112.4	W24 Y25 S30 D31 S32	W24-L28 HydrophobicContact CD2-CD1 3.9Å; W24-L28 VanDerWaalsContact CE2-CD1 3.43Å; W24-L28 HydrophobicContact CE3-CD1 4Å; W24-L28 HydrophobicContact CH2-CD1 3.26Å; W24-L28 HydrophobicContact CZ2-CD1 3.13Å; W24-L28 HydrophobicContact CZ2-CG 4.34Å; W24-L28 HydrophobicContact CZ3-CD1 3.69Å; W24-L28 PolarHBondContact O-N 2.87Å; Y25-L28 WeakPolarHBondContact O-CB 3.37Å; Y25-L28 PolarHBondContact O-N 2.99Å; Y25-L28 VanDerWaalsContact O-N 3.08Å; L28-S30 VanDerWaalsContact C-N 3.28Å; L28-S30 PolarHBondContact O-N 3.35Å; L28-D31 PolarHBondContact O-N 3.44Å; L28-S32 VanDerWaalsContact O-CB 3.22Å; L28-S32 WeakPolarHBondContact O-CB 3.34Å; L28-S32 PolarHBondContact O-N 3.49Å
29	V	85.4	Confident	79.9	Confident	71 Å²	71	87.7 Å²	87.7	43%	0.43	50%	0.495	S	S	.	.	H	α-helix	trans	-66.1	-36	177.6	-145.4	0	0	0	0	110.6	Y25 N27 L33	Y25-V29 HydrophobicContact CD1-CG2 3.73Å; Y25-V29 HydrophobicContact CE1-CG2 3.58Å; Y25-V29 HydrophobicContact CG-CG2 4.3Å; Y25-V29 WeakPolarHBondContact O-CG2 3.36Å; Y25-V29 PolarHBondContact O-N 2.97Å; N27-V29 PolarHBondContact O-N 2.91Å; V29-L33 VanDerWaalsContact O-CB 3.24Å; V29-L33 WeakPolarHBondContact O-CB 3.49Å; V29-L33 PolarHBondContact O-N 3.23Å
30	S	82.7	Confident	79.3	Confident	74 Å²	74	94.6 Å²	94.6	52%	0.517	52%	0.516	S	S	.	.	H	α-helix	trans	-68.7	-42.2	177	-60	0	0	0	0	112.2	A26 N27 L28 L33 S34	A26-S30 WeakPolarHBondContact O-CB 3.28Å; A26-S30 PolarHBondContact O-N 2.9Å; A26-S30 PolarHBondContact O-OG 2.78Å; N27-S30 PolarHBondContact O-N 2.89Å; L28-S30 VanDerWaalsContact C-N 3.28Å; L28-S30 PolarHBondContact O-N 3.35Å; S30-L33 PolarHBondContact O-N 3.12Å; S30-S34 WeakPolarHBondContact O-CB 3.39Å; S30-S34 PolarHBondContact O-N 3.29Å; S30-S34 PolarHBondContact O-OG 2.84Å
31	D	83.3	Confident	78.1	Confident	105 Å²	105	92.6 Å²	92.6	56%	0.561	51%	0.514	S	S	*	.	H	α-helix	trans	-65.8	-46.3	176.7	-172.6	68	0	0	0	111	N27 L28 L33 S34 S35	N27-D31 WeakPolarHBondContact O-CB 3.45Å; N27-D31 PolarHBondContact O-N 3.33Å; L28-D31 PolarHBondContact O-N 3.44Å; D31-L33 VanDerWaalsContact C-N 3.32Å; D31-L33 PolarHBondContact O-N 3.25Å; D31-S34 WeakPolarHBondContact CA-OG 3.49Å; D31-S34 PolarHBondContact O-N 3.48Å; D31-S34 PolarHBondContact O-OG 3.39Å; D31-S35 PolarHBondContact O-N 2.68Å; D31-S35 PolarHBondContact O-OG 2.7Å
32	S	83.1	Confident	76.9	Confident	73 Å²	73	91 Å²	91	51%	0.51	51%	0.511	S	S	.	.	H	α-helix	trans	-61.5	-37.8	174.4	-176.4	0	0	0	0	112.6	L28 S35 A36	L28-S32 VanDerWaalsContact O-CB 3.22Å; L28-S32 WeakPolarHBondContact O-CB 3.34Å; L28-S32 PolarHBondContact O-N 3.49Å; S32-S35 VanDerWaalsContact CA-OG 3.3Å; S32-S35 WeakPolarHBondContact CA-OG 3.17Å; S32-S35 PolarHBondContact O-OG 3.26Å; S32-A36 WeakPolarHBondContact O-CB 3.45Å; S32-A36 PolarHBondContact O-N 2.81Å; S32-A36 VanDerWaalsContact O-N 3.15Å
33	L	80.3	Confident	75.9	Confident	115 Å²	115	95.6 Å²	95.6	60%	0.602	54%	0.536	S	S	*	.	H	α-helix	trans	-70.6	-42.3	174.2	-176	64	0	0	0	110.9	V29 S30 D31 S35 A36 V37	V29-L33 VanDerWaalsContact O-CB 3.24Å; V29-L33 WeakPolarHBondContact O-CB 3.49Å; V29-L33 PolarHBondContact O-N 3.23Å; S30-L33 PolarHBondContact O-N 3.12Å; D31-L33 VanDerWaalsContact C-N 3.32Å; D31-L33 PolarHBondContact O-N 3.25Å; L33-S35 VanDerWaalsContact C-N 3.33Å; L33-S35 PolarHBondContact O-N 2.85Å; L33-A36 PolarHBondContact O-N 2.9Å; L33-V37 HydrophobicContact CD1-CG2 4.2Å; L33-V37 HydrophobicContact CG-CG2 4.29Å; L33-V37 WeakPolarHBondContact O-CG2 3.39Å; L33-V37 PolarHBondContact O-N 3.26Å
34	S	78.8	Confident	74.7	Confident	67 Å²	67	99.1 Å²	99.1	47%	0.469	55%	0.548	S	S	.	.	H	α-helix	trans	-64.3	-37.1	179.3	66.5	0	0	0	0	112.8	S30 D31 V37 A38	S30-S34 WeakPolarHBondContact O-CB 3.39Å; S30-S34 PolarHBondContact O-N 3.29Å; S30-S34 PolarHBondContact O-OG 2.84Å; D31-S34 WeakPolarHBondContact CA-OG 3.49Å; D31-S34 PolarHBondContact O-N 3.48Å; D31-S34 PolarHBondContact O-OG 3.39Å; S34-V37 PolarHBondContact O-N 3.3Å; S34-A38 WeakPolarHBondContact O-CB 3.29Å; S34-A38 PolarHBondContact O-N 3.41Å
35	S	76.2	Confident	73.3	Confident	61 Å²	61	99.2 Å²	99.2	43%	0.427	56%	0.555	S	S	.	*	H	α-helix	trans	-68.5	-40.5	174	40.5	0	0	0	0	111.6	D31 S32 L33 A38	D31-S35 PolarHBondContact O-N 2.68Å; D31-S35 PolarHBondContact O-OG 2.7Å; S32-S35 VanDerWaalsContact CA-OG 3.3Å; S32-S35 WeakPolarHBondContact CA-OG 3.17Å; S32-S35 PolarHBondContact O-OG 3.26Å; L33-S35 VanDerWaalsContact C-N 3.33Å; L33-S35 PolarHBondContact O-N 2.85Å; S35-A38 PolarHBondContact O-N 3.46Å
36	A	75.2	Confident	72.3	Confident	50 Å²	50	98.9 Å²	98.9	41%	0.413	56%	0.558	S	S	.	*	H	α-helix	trans	-65.1	-37.7	174.3	0	0	0	0	0	113.2	S32 L33	S32-A36 WeakPolarHBondContact O-CB 3.45Å; S32-A36 PolarHBondContact O-N 2.81Å; S32-A36 VanDerWaalsContact O-N 3.15Å; L33-A36 PolarHBondContact O-N 2.9Å
37	V	69.6	Low	71.7	Confident	88 Å²	88	103.3 Å²	103.3	53%	0.533	57%	0.571	S	S	.	*	H	α-helix	trans	-75.4	-30.1	179	177.7	0	0	0	0	111.6	L33 S34 E39 W40	L33-V37 HydrophobicContact CD1-CG2 4.2Å; L33-V37 HydrophobicContact CG-CG2 4.29Å; L33-V37 WeakPolarHBondContact O-CG2 3.39Å; L33-V37 PolarHBondContact O-N 3.26Å; S34-V37 PolarHBondContact O-N 3.3Å; V37-E39 PolarHBondContact O-N 2.88Å; V37-W40 PolarHBondContact O-N 3.2Å; V37-W40 VanDerWaalsContact O-N 3.08Å
38	A	68.6	Low	71.6	Confident	80 Å²	80	100 Å²	100	66%	0.661	55%	0.554	S	S	*	*	H	α-helix	trans	-63.7	-27.2	177	0	0	0	0	0	113.2	S34 S35 W40	S34-A38 WeakPolarHBondContact O-CB 3.29Å; S34-A38 PolarHBondContact O-N 3.41Å; S35-A38 PolarHBondContact O-N 3.46Å; A38-W40 VanDerWaalsContact C-N 3.34Å
39	E	64.1	Low	72	Confident	170 Å²	170	99.4 Å²	99.4	79%	0.794	55%	0.549	S	S	*	.	T	Hydrogen-bonded Turn	trans	-78.8	-16.6	174.9	-65.5	-166.6	160.8	0	0	113.1	V37 G41	V37-E39 PolarHBondContact O-N 2.88Å; E39-G41 PolarHBondContact O-N 2.86Å
40	W	62.5	Low	72.5	Confident	215 Å²	215	96 Å²	96	81%	0.814	53%	0.528	S	S	*	.	S	Bend	trans	-94.1	59	178	-64.8	15.4	0	0	0	109.4	V37 A38 D42	V37-W40 PolarHBondContact O-N 3.2Å; V37-W40 VanDerWaalsContact O-N 3.08Å; A38-W40 VanDerWaalsContact C-N 3.34Å; W40-D42 PolarHBondContact O-N 3.36Å; W40-D42 VanDerWaalsContact O-N 3.13Å
41	G	57	Low	72.9	Confident	58 Å²	58	97.4 Å²	97.4	60%	0.598	53%	0.525	S	S	*	.			trans	-73	97.5	-178.5	0	0	0	0	0	112.5	E39 D43	E39-G41 PolarHBondContact O-N 2.86Å; G41-D43 PolarHBondContact O-N 3.1Å
42	D	59.3	Low	73.4	Confident	105 Å²	105	96.9 Å²	96.9	56%	0.561	52%	0.521	S	S	*	.			trans	44	65.5	152.9	-151.2	34.9	0	0	0	118.2	W40 Q44	W40-D42 PolarHBondContact O-N 3.36Å; W40-D42 VanDerWaalsContact O-N 3.13Å; D42-Q44 PolarHBondContact O-N 3.19Å; D42-Q44 WeakPolarHBondContact OD1-CB 3.28Å; D42-Q44 WeakPolarHBondContact OD1-CG 3.14Å; D42-Q44 PolarHBondContact OD1-NE2 2.73Å
43	D	58.6	Low	73.9	Confident	108 Å²	108	95.6 Å²	95.6	58%	0.578	51%	0.512	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.2	15.2	165.7	-56.6	-43.7	0	0	0	113.6	G41 E45 E46 Q47	G41-D43 PolarHBondContact O-N 3.1Å; D43-E45 PolarHBondContact O-N 3.37Å; D43-E46 PolarHBondContact O-N 3.21Å; D43-E46 VanDerWaalsContact O-N 3.15Å; D43-Q47 PolarHBondContact O-N 2.76Å; D43-Q47 VanDerWaalsContact O-N 3.16Å
44	Q	59.2	Low	74.6	Confident	123 Å²	123	94.9 Å²	94.9	58%	0.575	51%	0.507	S	S	*	.	H	α-helix	trans	-62.2	-32.9	-178.7	-79.6	-177.4	52.3	0	0	112.1	D42 E46 Q47 D48	D42-Q44 PolarHBondContact O-N 3.19Å; D42-Q44 WeakPolarHBondContact OD1-CB 3.28Å; D42-Q44 WeakPolarHBondContact OD1-CG 3.14Å; D42-Q44 PolarHBondContact OD1-NE2 2.73Å; Q44-E46 VanDerWaalsContact C-N 3.33Å; Q44-E46 PolarHBondContact O-N 3.48Å; Q44-Q47 PolarHBondContact O-N 2.87Å; Q44-D48 PolarHBondContact O-N 3.29Å
45	E	58.9	Low	75.2	Confident	150 Å²	150	97.3 Å²	97.3	70%	0.701	52%	0.518	S	S	*	.	H	α-helix	trans	-64.9	-37.7	175.9	-66.9	-162.3	153.9	0	0	112	D43 D48	D43-E45 PolarHBondContact O-N 3.37Å; E45-D48 PolarHBondContact O-N 3.17Å
46	E	61.3	Low	76	Confident	129 Å²	129	97 Å²	97	60%	0.603	52%	0.516	S	S	*	.	H	α-helix	trans	-66.9	-36.9	174.2	-89.4	-163.5	172.9	0	0	111.8	D43 Q44 D48 E49 K51	D43-E46 PolarHBondContact O-N 3.21Å; D43-E46 VanDerWaalsContact O-N 3.15Å; Q44-E46 VanDerWaalsContact C-N 3.33Å; Q44-E46 PolarHBondContact O-N 3.48Å; E46-D48 PolarHBondContact O-N 2.66Å; E46-E49 PolarHBondContact O-N 3.34Å; E46-K51 PolarHBondContact O-NZ 2.91Å
47	Q	70.7	Confident	76.9	Confident	140 Å²	140	102.7 Å²	102.7	65%	0.654	53%	0.527	S	S	*	.	H	α-helix	trans	-65.1	-28.8	177.3	-68.9	-173.7	22.3	0	0	112.3	D43 Q44 E49	D43-Q47 PolarHBondContact O-N 2.76Å; D43-Q47 VanDerWaalsContact O-N 3.16Å; Q44-Q47 PolarHBondContact O-N 2.87Å; Q47-E49 VanDerWaalsContact C-N 3.3Å; Q47-E49 PolarHBondContact O-N 3.48Å
48	D	85.4	Confident	78.1	Confident	42 Å²	42	99.1 Å²	99.1	23%	0.225	51%	0.505	C	S	.	.	T	Hydrogen-bonded Turn	trans	-82.5	-0.3	178.4	-93.3	-7.1	0	0	0	113.6	Q44 E45 E46 R57 V58 K100	Q44-D48 PolarHBondContact O-N 3.29Å; E45-D48 PolarHBondContact O-N 3.17Å; E46-D48 PolarHBondContact O-N 2.66Å; D48-R57 CarbonylContact O-C 3.37Å; D48-R57 WeakPolarHBondContact O-CA 3.41Å; D48-R57 WeakPolarHBondContact O-CB 3.19Å; D48-V58 PolarHBondContact O-N 3.43Å; D48-K100 IonicContact OD1-NZ 2.68Å; D48-K100 PolarHBondContact OD1-NZ 2.68Å; D48-K100 IonicContact OD2-NZ 2.76Å; D48-K100 PolarHBondContact OD2-NZ 3.21Å
49	E	92.8	Very high	79.4	Confident	64 Å²	64	97.2 Å²	97.2	30%	0.299	48%	0.484	S	S	.	.	B	Isolated β-bridge	trans	-94.7	138.7	179.1	-167	172.9	-150.7	0	0	113.4	E46 Q47 K51 M54 V55 V58	E46-E49 PolarHBondContact O-N 3.34Å; Q47-E49 VanDerWaalsContact C-N 3.3Å; Q47-E49 PolarHBondContact O-N 3.48Å; E49-K51 PolarHBondContact O-N 3.24Å; E49-K51 VanDerWaalsContact O-N 3.1Å; E49-M54 WeakPolarHBondContact OE1-CA 3.08Å; E49-M54 VanDerWaalsContact OE1-O 3.07Å; E49-V55 PolarHBondContact OE1-N 3.17Å; E49-V58 VanDerWaalsContact C-CG2 3.49Å; E49-V58 WeakPolarHBondContact O-CG2 3.42Å
50	C	94.8	Very high	80.9	Confident	0 Å²	0	89.1 Å²	89.1	0%	0	45%	0.446	C	S	.	.			trans	-63.6	113.3	178.1	171.7	0	0	0	0	111.5	I52 C53 M54 S56 C71	C50-I52 PolarHBondContact O-N 2.75Å; C50-C53 PolarHBondContact O-N 3.45Å; C50-M54 WeakPolarHBondContact O-CA 3.47Å; C50-M54 PolarHBondContact O-N 3.15Å; C50-M54 VanDerWaalsContact O-SD 3.42Å; C50-S56 WeakPolarHBondContact CB-O 3.26Å; C50-S56 PolarHBondContact N-O 3.08Å; C50-C71 HydrophobicContact CB-CB 3.82Å; C50-C71 PolarHBondContact SG-N 3.31Å
51	K	91.3	Very high	82.5	Confident	103 Å²	103	79.4 Å²	79.4	45%	0.448	41%	0.411	S	S	.	.	T	Hydrogen-bonded Turn	trans	-65.9	1.2	-177.8	-53.7	-59.3	174.4	-173.2	0	116	E46 E49 M54 S69	E46-K51 PolarHBondContact O-NZ 2.91Å; E49-K51 PolarHBondContact O-N 3.24Å; E49-K51 VanDerWaalsContact O-N 3.1Å; K51-M54 HydrophobicContact CB-CE 4.35Å; K51-M54 HydrophobicContact CD-CE 4.38Å; K51-M54 WeakPolarHBondContact O-CE 3.28Å; K51-S69 PolarHBondContact N-O 3.16Å
52	I	93.5	Very high	84.4	Confident	93 Å²	93	76.7 Å²	76.7	48%	0.477	38%	0.383	S	S	.	.	T	Hydrogen-bonded Turn	trans	-103.6	-56.5	176.3	-63.9	-172.4	0	0	0	111.5	C50 M70 C74	C50-I52 PolarHBondContact O-N 2.75Å; I52-M70 HydrophobicContact CD1-CE 3.71Å; I52-M70 HydrophobicContact CD1-CG 4.33Å; I52-M70 HydrophobicContact CD1-SD 3.28Å; I52-M70 WeakPolarHBondContact CD1-SD 3.35Å; I52-M70 HydrophobicContact CG1-SD 3.99Å; I52-C74 HydrophobicContact CB-CB 4.06Å; I52-C74 HydrophobicContact CD1-CB 4.14Å; I52-C74 HydrophobicContact CG2-CB 4.22Å
53	C	94.8	Very high	86.2	Confident	46 Å²	46	77.1 Å²	77.1	31%	0.311	38%	0.378	S	S	.	.	T	Hydrogen-bonded Turn	trans	-90.3	-25	-177.9	63.8	0	0	0	0	113.9	C50 V55	C50-C53 PolarHBondContact O-N 3.45Å; C53-V55 WeakPolarHBondContact O-CG2 3.13Å; C53-V55 PolarHBondContact O-N 3.13Å
54	M	93.3	Very high	88	Confident	101 Å²	101	75.1 Å²	75.1	50%	0.498	37%	0.37	S	S	.	.	S	Bend	trans	50.6	43.1	-173.7	-47.9	-62.5	-171.7	0	0	112.2	E49 C50 K51	E49-M54 WeakPolarHBondContact OE1-CA 3.08Å; E49-M54 VanDerWaalsContact OE1-O 3.07Å; C50-M54 WeakPolarHBondContact O-CA 3.47Å; C50-M54 PolarHBondContact O-N 3.15Å; C50-M54 VanDerWaalsContact O-SD 3.42Å; K51-M54 HydrophobicContact CB-CE 4.35Å; K51-M54 HydrophobicContact CD-CE 4.38Å; K51-M54 WeakPolarHBondContact O-CE 3.28Å
55	V	92	Very high	89.8	Confident	118 Å²	118	70.7 Å²	70.7	72%	0.715	35%	0.353	S	S	*	.	S	Bend	trans	-137.8	-44.5	179.9	174.9	0	0	0	0	110.6	E49 C53	E49-V55 PolarHBondContact OE1-N 3.17Å; C53-V55 WeakPolarHBondContact O-CG2 3.13Å; C53-V55 PolarHBondContact O-N 3.13Å
56	S	93.3	Very high	91.6	Very high	53 Å²	53	65.8 Å²	65.8	37%	0.371	34%	0.343	S	S	.	.	S	Bend	trans	-104.6	151.1	-177.8	-53.5	0	0	0	0	110.8	C50	C50-S56 WeakPolarHBondContact CB-O 3.26Å; C50-S56 PolarHBondContact N-O 3.08Å
57	R	93.5	Very high	93.2	Very high	170 Å²	170	62.9 Å²	62.9	64%	0.642	33%	0.329	S	S	*	.	B	Isolated β-bridge	trans	-68.7	155.8	173.4	-65.9	-173.4	179.9	-163.4	-3.2	112.2	D48 D59 C71	D48-R57 CarbonylContact O-C 3.37Å; D48-R57 WeakPolarHBondContact O-CA 3.41Å; D48-R57 WeakPolarHBondContact O-CB 3.19Å; R57-D59 PolarHBondContact O-N 3.31Å; R57-C71 VanDerWaalsContact O-CB 3.28Å; R57-C71 WeakPolarHBondContact O-CB 3.35Å
58	V	95	Very high	94.4	Very high	13 Å²	13	63.2 Å²	63.2	8%	0.079	33%	0.325	C	S	.	.			trans	-68.7	107.8	172.8	-179.7	0	0	0	0	108.9	D48 E49 Y68	D48-V58 PolarHBondContact O-N 3.43Å; E49-V58 VanDerWaalsContact C-CG2 3.49Å; E49-V58 WeakPolarHBondContact O-CG2 3.42Å; V58-Y68 HydrophobicContact CG1-CD2 3.8Å; V58-Y68 HydrophobicContact CG1-CG 4.43Å
59	D	95.7	Very high	94.7	Very high	40 Å²	40	62.2 Å²	62.2	21%	0.214	32%	0.322	C	S	.	.			trans	-127.9	23.4	-179.5	70.4	-21.9	0	0	0	111.7	R57 C71 Y72 K97 I98	R57-D59 PolarHBondContact O-N 3.31Å; D59-C71 WeakPolarHBondContact OD1-CA 3.02Å; D59-Y72 PolarHBondContact OD1-N 3.03Å; D59-K97 CarbonylContact O-C 3.55Å; D59-K97 WeakPolarHBondContact O-CA 3.16Å; D59-K97 WeakPolarHBondContact O-CG 3.38Å; D59-K97 WeakPolarHBondContact OD2-CE 3.27Å; D59-K97 IonicContact OD2-NZ 3.74Å; D59-I98 PolarHBondContact O-N 2.98Å
60	S	96	Very high	94.8	Very high	0 Å²	0	59.4 Å²	59.4	0%	0	31%	0.309	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.5	146.9	180	72.9	0	0	0	0	114.9	Y68 M70 A75 L96	S60-Y68 WeakPolarHBondContact O-CA 3.06Å; S60-Y68 WeakPolarHBondContact O-CB 3.37Å; S60-M70 PolarHBondContact N-O 3.15Å; S60-M70 PolarHBondContact OG-O 2.77Å; S60-A75 WeakPolarHBondContact OG-CB 3.05Å; S60-L96 CarbonylContact C-O 3.54Å; S60-L96 WeakPolarHBondContact CA-O 3.11Å; S60-L96 WeakPolarHBondContact CB-O 3.38Å
61	A	96.3	Very high	94.9	Very high	11 Å²	11	59.6 Å²	59.6	9%	0.091	31%	0.31	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.4	150.7	175.7	0	0	0	0	0	112	H67 L96 I98	A61-H67 WeakPolarHBondContact CA-O 3.43Å; A61-L96 PolarHBondContact N-O 3.08Å; A61-L96 PolarHBondContact O-N 3.11Å; A61-I98 HydrophobicContact CB-CD1 3.71Å; A61-I98 HydrophobicContact CB-CG1 4.29Å
62	F	97.5	Very high	95.2	Very high	1 Å²	1	57.6 Å²	57.6	0%	0.004	30%	0.3	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.8	122.2	179	-58.6	-63	0	0	0	111.9	C65 G66 H67 M70 A75 C85 P86 I92 V95	F62-C65 PolarHBondContact O-N 3.48Å; F62-C65 PolarHBondContact O-SG 2.9Å; F62-C65 VanDerWaalsContact O-SG 3.33Å; F62-G66 PolarHBondContact O-N 3.18Å; F62-H67 VanDerWaalsContact CD2-O 3.26Å; F62-H67 WeakPolarHBondContact CD2-O 3.46Å; F62-H67 PolarHBondContact N-O 3.26Å; F62-M70 HydrophobicContact CE1-CE 4.16Å; F62-M70 HydrophobicContact CE2-SD 4.42Å; F62-M70 HydrophobicContact CZ-CE 3.5Å; F62-M70 HydrophobicContact CZ-CG 4.29Å; F62-M70 HydrophobicContact CZ-SD 3.87Å; F62-A75 HydrophobicContact CE1-CB 3.9Å; F62-A75 HydrophobicContact CZ-CB 4.28Å; F62-C85 HydrophobicContact CD2-CB 4.4Å; F62-P86 HydrophobicContact CE2-CG 3.75Å; F62-P86 HydrophobicContact CZ-CG 4.16Å; F62-I92 HydrophobicContact CB-CG1 4.16Å; F62-I92 HydrophobicContact CB-CG2 4.41Å; F62-I92 HydrophobicContact CD1-CD1 3.42Å; F62-I92 VanDerWaalsContact CD1-CD1 3.42Å; F62-I92 HydrophobicContact CD1-CG1 3.96Å; F62-I92 HydrophobicContact CD1-CG2 4.11Å; F62-I92 HydrophobicContact CE1-CD1 3.67Å; F62-I92 HydrophobicContact CG-CD1 4Å; F62-I92 HydrophobicContact CG-CG1 4.19Å; F62-I92 HydrophobicContact CZ-CD1 4.44Å; F62-V95 HydrophobicContact CD1-CG2 4.29Å; F62-V95 HydrophobicContact CE1-CG2 4.49Å
63	Y	97	Very high	95.4	Very high	115 Å²	115	57 Å²	57	45%	0.451	30%	0.302	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.8	136.3	173.5	-177.1	-102.9	0	0	0	110.7	R93 D94	Y63-R93 HydrophobicContact CD1-CB 3.86Å; Y63-R93 HydrophobicContact CE1-CB 4.37Å; Y63-R93 PolarHBondContact O-N 3.48Å; Y63-D94 HydrophobicContact CD1-CB 4.49Å; Y63-D94 PolarHBondContact N-O 3.28Å
64	P	96.6	Very high	95.5	Very high	65 Å²	65	55.4 Å²	55.4	42%	0.422	29%	0.292	S	S	.	.	T	Hydrogen-bonded Turn	cis	-95.1	0.1	5.7	37.1	-35.9	0	0	0	115.4	G66	P64-G66 VanDerWaalsContact C-N 3.32Å; P64-G66 PolarHBondContact O-N 2.82Å
65	C	96.9	Very high	95.7	Very high	30 Å²	30	50.6 Å²	50.6	20%	0.203	27%	0.268	C	S	.	.	T	Hydrogen-bonded Turn	trans	-72.9	-20.2	-172.7	59.1	0	0	0	0	115	F62 H67 C85 K90	F62-C65 PolarHBondContact O-N 3.48Å; F62-C65 PolarHBondContact O-SG 2.9Å; F62-C65 VanDerWaalsContact O-SG 3.33Å; C65-H67 PolarHBondContact O-N 3.45Å; C65-C85 VanDerWaalsContact SG-SG 3.67Å; C65-K90 HydrophobicContact CB-CD 4.33Å
66	G	95.6	Very high	95.9	Very high	48 Å²	48	48.8 Å²	48.8	50%	0.495	25%	0.25	S	S	.	.			trans	78.3	-8.2	178.3	0	0	0	0	0	115.6	F62 P64	F62-G66 PolarHBondContact O-N 3.18Å; P64-G66 VanDerWaalsContact C-N 3.32Å; P64-G66 PolarHBondContact O-N 2.82Å
67	H	96	Very high	96	Very high	67 Å²	67	50.6 Å²	50.6	31%	0.31	26%	0.255	S	S	.	.			trans	-62.5	138.6	177.2	-69.8	121.5	0	0	0	112.4	A61 F62 C65 I87 C88	A61-H67 WeakPolarHBondContact CA-O 3.43Å; F62-H67 VanDerWaalsContact CD2-O 3.26Å; F62-H67 WeakPolarHBondContact CD2-O 3.46Å; F62-H67 PolarHBondContact N-O 3.26Å; C65-H67 PolarHBondContact O-N 3.45Å; H67-I87 HydrophobicContact CB-CB 4.16Å; H67-I87 HydrophobicContact CB-CD1 3.74Å; H67-I87 HydrophobicContact CB-CG1 4.12Å; H67-C88 VanDerWaalsContact CE1-CB 3.41Å; H67-C88 WeakPolarHBondContact CE1-CB 3.35Å; H67-C88 VanDerWaalsContact CE1-SG 3.56Å; H67-C88 PolarHBondContact ND1-SG 3.09Å
68	Y	94.3	Very high	96.1	Very high	147 Å²	147	43.2 Å²	43.2	58%	0.576	23%	0.229	S	C	*	.	E	Extended strand (participates in β ladder)	trans	-127.7	135.1	175	57.9	-84.2	0	0	0	109.2	V58 S60	V58-Y68 HydrophobicContact CG1-CD2 3.8Å; V58-Y68 HydrophobicContact CG1-CG 4.43Å; S60-Y68 WeakPolarHBondContact O-CA 3.06Å; S60-Y68 WeakPolarHBondContact O-CB 3.37Å
69	S	93.3	Very high	96.2	Very high	22 Å²	22	46 Å²	46	15%	0.154	24%	0.241	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-155.1	-1	179.1	59.7	0	0	0	0	114.3	K51	K51-S69 PolarHBondContact N-O 3.16Å
70	M	95	Very high	96.2	Very high	5 Å²	5	53.7 Å²	53.7	3%	0.025	27%	0.266	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-148	157.2	-166.1	-26.7	-172.6	-37.5	0	0	110.2	I52 S60 F62 C74 A75 T78 P86	I52-M70 HydrophobicContact CD1-CE 3.71Å; I52-M70 HydrophobicContact CD1-CG 4.33Å; I52-M70 HydrophobicContact CD1-SD 3.28Å; I52-M70 WeakPolarHBondContact CD1-SD 3.35Å; I52-M70 HydrophobicContact CG1-SD 3.99Å; S60-M70 PolarHBondContact N-O 3.15Å; S60-M70 PolarHBondContact OG-O 2.77Å; F62-M70 HydrophobicContact CE1-CE 4.16Å; F62-M70 HydrophobicContact CE2-SD 4.42Å; F62-M70 HydrophobicContact CZ-CE 3.5Å; F62-M70 HydrophobicContact CZ-CG 4.29Å; F62-M70 HydrophobicContact CZ-SD 3.87Å; M70-C74 HydrophobicContact CB-CB 4.18Å; M70-C74 VanDerWaalsContact CE-C 3.44Å; M70-C74 HydrophobicContact CE-CB 4.33Å; M70-C74 WeakPolarHBondContact CE-O 3.41Å; M70-A75 HydrophobicContact CE-CB 3.74Å; M70-A75 VanDerWaalsContact CE-N 3.32Å; M70-T78 HydrophobicContact CE-CG2 4.37Å; M70-T78 VanDerWaalsContact CE-OG1 3.29Å; M70-T78 WeakPolarHBondContact CE-OG1 3.37Å; M70-P86 HydrophobicContact SD-CG 3.99Å
71	C	96.8	Very high	96.1	Very high	3 Å²	3	61.7 Å²	61.7	2%	0.02	30%	0.301	C	S	.	.			trans	-71.6	158.5	169.5	69.3	0	0	0	0	111	C50 R57 D59 C74 A75	C50-C71 HydrophobicContact CB-CB 3.82Å; C50-C71 PolarHBondContact SG-N 3.31Å; R57-C71 VanDerWaalsContact O-CB 3.28Å; R57-C71 WeakPolarHBondContact O-CB 3.35Å; D59-C71 WeakPolarHBondContact OD1-CA 3.02Å; C71-C74 PolarHBondContact O-N 2.91Å; C71-C74 VanDerWaalsContact O-N 3.12Å; C71-C74 PolarHBondContact SG-SG 2.86Å; C71-A75 WeakPolarHBondContact O-CB 3.33Å; C71-A75 PolarHBondContact O-N 3.25Å
72	Y	96.9	Very high	96	Very high	61 Å²	61	67.4 Å²	67.4	24%	0.239	33%	0.326	C	S	.	.	H	α-helix	trans	-56.8	-41.8	-174.7	-172.2	-104.3	0	0	0	114.2	D59 A75 K76 V95 K97	D59-Y72 PolarHBondContact OD1-N 3.03Å; Y72-A75 PolarHBondContact O-N 2.86Å; Y72-K76 HydrophobicContact CE1-CD 4.23Å; Y72-K76 PolarHBondContact O-N 2.8Å; Y72-K76 WeakPolarHBondContact OH-CE 3.36Å; Y72-K76 PolarHBondContact OH-NZ 2.82Å; Y72-K76 VanDerWaalsContact OH-NZ 3.09Å; Y72-V95 HydrophobicContact CD2-CG1 3.95Å; Y72-V95 HydrophobicContact CE2-CG1 3.97Å; Y72-V95 WeakPolarHBondContact CE2-O 3.09Å; Y72-K97 HydrophobicContact CD1-CD 4.48Å; Y72-K97 HydrophobicContact CD2-CB 3.72Å; Y72-K97 HydrophobicContact CD2-CD 4.45Å; Y72-K97 HydrophobicContact CD2-CG 4.15Å; Y72-K97 HydrophobicContact CE2-CB 3.82Å; Y72-K97 HydrophobicContact CG-CB 4.36Å; Y72-K97 HydrophobicContact CG-CD 4.25Å; Y72-K97 HydrophobicContact CG-CG 4.34Å
73	P	97.1	Very high	95.9	Very high	80 Å²	80	68.3 Å²	68.3	52%	0.519	34%	0.336	S	S	.	.	H	α-helix	trans	-60.4	-47.1	173.4	-22	32.3	0	0	0	112.8	A75 K76 L77	P73-A75 VanDerWaalsContact C-N 3.32Å; P73-A75 PolarHBondContact O-N 2.75Å; P73-K76 PolarHBondContact O-N 3.4Å; P73-L77 PolarHBondContact O-N 3.2Å; P73-L77 VanDerWaalsContact O-N 3.11Å
74	C	97.4	Very high	95.8	Very high	14 Å²	14	65.4 Å²	65.4	10%	0.095	33%	0.33	C	S	.	.	H	α-helix	trans	-64	-39	177.6	-71.8	0	0	0	0	111.1	I52 M70 C71 L77 T78	I52-C74 HydrophobicContact CB-CB 4.06Å; I52-C74 HydrophobicContact CD1-CB 4.14Å; I52-C74 HydrophobicContact CG2-CB 4.22Å; M70-C74 HydrophobicContact CB-CB 4.18Å; M70-C74 VanDerWaalsContact CE-C 3.44Å; M70-C74 HydrophobicContact CE-CB 4.33Å; M70-C74 WeakPolarHBondContact CE-O 3.41Å; C71-C74 PolarHBondContact O-N 2.91Å; C71-C74 VanDerWaalsContact O-N 3.12Å; C71-C74 PolarHBondContact SG-SG 2.86Å; C74-L77 WeakPolarHBondContact O-CB 3.44Å; C74-L77 PolarHBondContact O-N 3.03Å; C74-T78 PolarHBondContact O-N 3.43Å; C74-T78 PolarHBondContact O-OG1 3.4Å
75	A	96.7	Very high	95.8	Very high	0 Å²	0	62.3 Å²	62.3	0%	0	31%	0.31	C	S	.	.	H	α-helix	trans	-63.9	-42.1	176.7	0	0	0	0	0	114	S60 F62 M70 C71 Y72 P73 L77 T78 F79 V95	S60-A75 WeakPolarHBondContact OG-CB 3.05Å; F62-A75 HydrophobicContact CE1-CB 3.9Å; F62-A75 HydrophobicContact CZ-CB 4.28Å; M70-A75 HydrophobicContact CE-CB 3.74Å; M70-A75 VanDerWaalsContact CE-N 3.32Å; C71-A75 WeakPolarHBondContact O-CB 3.33Å; C71-A75 PolarHBondContact O-N 3.25Å; Y72-A75 PolarHBondContact O-N 2.86Å; P73-A75 VanDerWaalsContact C-N 3.32Å; P73-A75 PolarHBondContact O-N 2.75Å; A75-L77 VanDerWaalsContact C-N 3.3Å; A75-L77 PolarHBondContact O-N 2.9Å; A75-T78 PolarHBondContact O-N 3.43Å; A75-F79 WeakPolarHBondContact O-CB 3.21Å; A75-F79 PolarHBondContact O-N 3.08Å; A75-V95 HydrophobicContact CB-CG1 3.49Å; A75-V95 VanDerWaalsContact CB-CG1 3.49Å; A75-V95 HydrophobicContact CB-CG2 4.5Å
76	K	96.6	Very high	95.7	Very high	80 Å²	80	64 Å²	64	35%	0.348	32%	0.32	S	S	.	.	H	α-helix	trans	-62.7	-38.6	171.2	-77.2	-159.2	-177.3	176.7	0	112.7	Y72 P73 F79 R80	Y72-K76 HydrophobicContact CE1-CD 4.23Å; Y72-K76 PolarHBondContact O-N 2.8Å; Y72-K76 WeakPolarHBondContact OH-CE 3.36Å; Y72-K76 PolarHBondContact OH-NZ 2.82Å; Y72-K76 VanDerWaalsContact OH-NZ 3.09Å; P73-K76 PolarHBondContact O-N 3.4Å; K76-F79 PolarHBondContact O-N 2.91Å; K76-R80 WeakPolarHBondContact O-CB 3.3Å; K76-R80 VanDerWaalsContact O-CG 3.28Å; K76-R80 WeakPolarHBondContact O-CG 3.22Å; K76-R80 PolarHBondContact O-N 3.33Å
77	L	96.5	Very high	95.6	Very high	90 Å²	90	66 Å²	66	47%	0.471	32%	0.319	S	S	.	.	H	α-helix	trans	-62.3	-47.5	177.1	-102.7	149.9	0	0	0	111.5	P73 C74 A75 R80 K81	P73-L77 PolarHBondContact O-N 3.2Å; P73-L77 VanDerWaalsContact O-N 3.11Å; C74-L77 WeakPolarHBondContact O-CB 3.44Å; C74-L77 PolarHBondContact O-N 3.03Å; A75-L77 VanDerWaalsContact C-N 3.3Å; A75-L77 PolarHBondContact O-N 2.9Å; L77-R80 PolarHBondContact O-N 3.5Å; L77-K81 HydrophobicContact CD2-CD 4.35Å; L77-K81 WeakPolarHBondContact O-CB 3.32Å; L77-K81 WeakPolarHBondContact O-CG 3.34Å; L77-K81 PolarHBondContact O-N 3.49Å
78	T	95.2	Very high	95.7	Very high	16 Å²	16	64.7 Å²	64.7	10%	0.098	32%	0.317	C	S	.	.	H	α-helix	trans	-64.1	-41.1	176.4	-59.8	0	0	0	0	111.9	M70 C74 A75 R80 K81 Q82 G83	M70-T78 HydrophobicContact CE-CG2 4.37Å; M70-T78 VanDerWaalsContact CE-OG1 3.29Å; M70-T78 WeakPolarHBondContact CE-OG1 3.37Å; C74-T78 PolarHBondContact O-N 3.43Å; C74-T78 PolarHBondContact O-OG1 3.4Å; A75-T78 PolarHBondContact O-N 3.43Å; T78-R80 VanDerWaalsContact C-N 3.34Å; T78-R80 PolarHBondContact O-N 2.98Å; T78-K81 PolarHBondContact O-N 2.96Å; T78-Q82 PolarHBondContact O-N 3.02Å; T78-G83 PolarHBondContact O-N 3.45Å
79	F	95.8	Very high	95.8	Very high	72 Å²	72	67.8 Å²	67.8	32%	0.316	33%	0.328	S	S	.	.	H	α-helix	trans	-59.7	-44.2	175.4	176.8	-127.9	0	0	0	111.9	A75 K76 G83 I92 V95	A75-F79 WeakPolarHBondContact O-CB 3.21Å; A75-F79 PolarHBondContact O-N 3.08Å; K76-F79 PolarHBondContact O-N 2.91Å; F79-G83 VanDerWaalsContact O-CA 3.28Å; F79-G83 WeakPolarHBondContact O-CA 3.24Å; F79-G83 PolarHBondContact O-N 3.31Å; F79-G83 VanDerWaalsContact O-N 3.13Å; F79-I92 HydrophobicContact CD2-CB 3.71Å; F79-I92 HydrophobicContact CD2-CG2 3.54Å; F79-I92 HydrophobicContact CE2-CB 4.09Å; F79-I92 HydrophobicContact CE2-CG2 3.93Å; F79-I92 WeakPolarHBondContact CE2-O 3.4Å; F79-I92 HydrophobicContact CG-CG2 4.26Å; F79-V95 HydrophobicContact CB-CG2 3.71Å; F79-V95 HydrophobicContact CD1-CG2 4.27Å; F79-V95 HydrophobicContact CG-CG2 4.02Å
80	R	95.6	Very high	95.9	Very high	201 Å²	201	72.8 Å²	72.8	76%	0.758	35%	0.346	S	S	*	.	H	α-helix	trans	-70	-34.7	178	-71.4	172.9	-179.8	177.7	-1.1	113.7	K76 L77 T78	K76-R80 WeakPolarHBondContact O-CB 3.3Å; K76-R80 VanDerWaalsContact O-CG 3.28Å; K76-R80 WeakPolarHBondContact O-CG 3.22Å; K76-R80 PolarHBondContact O-N 3.33Å; L77-R80 PolarHBondContact O-N 3.5Å; T78-R80 VanDerWaalsContact C-N 3.34Å; T78-R80 PolarHBondContact O-N 2.98Å
81	K	95.4	Very high	96	Very high	167 Å²	167	76.9 Å²	76.9	73%	0.726	37%	0.374	S	S	*	.	H	α-helix	trans	-83.8	-48.5	-175.8	-74.4	-177.4	174.7	-175.8	0	113.1	L77 T78	L77-K81 HydrophobicContact CD2-CD 4.35Å; L77-K81 WeakPolarHBondContact O-CB 3.32Å; L77-K81 WeakPolarHBondContact O-CG 3.34Å; L77-K81 PolarHBondContact O-N 3.49Å; T78-K81 PolarHBondContact O-N 2.96Å
82	Q	94.3	Very high	96	Very high	131 Å²	131	77.4 Å²	77.4	61%	0.612	38%	0.376	S	S	*	.	T	Hydrogen-bonded Turn	trans	-113.7	-32.5	-171	-64.2	179.3	-3.5	0	0	112.5	T78 V84	T78-Q82 PolarHBondContact O-N 3.02Å; Q82-V84 HydrophobicContact CB-CG2 3.94Å; Q82-V84 PolarHBondContact O-N 3.34Å
83	G	94.2	Very high	96	Very high	21 Å²	21	83 Å²	83	22%	0.216	40%	0.397	C	S	.	.			trans	66.8	11	-178	0	0	0	0	0	114.8	T78 F79 P91 I92	T78-G83 PolarHBondContact O-N 3.45Å; F79-G83 VanDerWaalsContact O-CA 3.28Å; F79-G83 WeakPolarHBondContact O-CA 3.24Å; F79-G83 PolarHBondContact O-N 3.31Å; F79-G83 VanDerWaalsContact O-N 3.13Å; G83-P91 WeakPolarHBondContact O-CA 3.41Å; G83-I92 PolarHBondContact O-N 3.22Å
84	V	96.4	Very high	96	Very high	54 Å²	54	83.2 Å²	83.2	33%	0.327	39%	0.393	S	S	.	.	B	Isolated β-bridge	trans	-127.7	147.8	-178.8	-67.6	0	0	0	0	111.8	Q82 K90 I92	Q82-V84 HydrophobicContact CB-CG2 3.94Å; Q82-V84 PolarHBondContact O-N 3.34Å; V84-K90 WeakPolarHBondContact CA-O 2.98Å; V84-I92 VanDerWaalsContact O-CD1 3.28Å; V84-I92 WeakPolarHBondContact O-CD1 3.47Å
85	C	96.3	Very high	96	Very high	0 Å²	0	82.8 Å²	82.8	0%	0	39%	0.391	C	S	.	.			trans	-68.6	130.5	178.5	177.2	0	0	0	0	110.7	F62 C65 I87 R89 K90 I92	F62-C85 HydrophobicContact CD2-CB 4.4Å; C65-C85 VanDerWaalsContact SG-SG 3.67Å; C85-I87 PolarHBondContact O-N 3.18Å; C85-I87 PolarHBondContact SG-N 3.38Å; C85-R89 WeakPolarHBondContact O-CA 3.37Å; C85-R89 PolarHBondContact O-N 3.23Å; C85-K90 PolarHBondContact N-O 3.04Å; C85-I92 HydrophobicContact CB-CG1 4.34Å
86	P	93.6	Very high	96	Very high	65 Å²	65	86.7 Å²	86.7	42%	0.422	41%	0.411	S	S	.	.	T	Hydrogen-bonded Turn	trans	-67.3	-21.9	179.5	27.7	-35.2	0	0	0	113.6	F62 M70	F62-P86 HydrophobicContact CE2-CG 3.75Å; F62-P86 HydrophobicContact CZ-CG 4.16Å; M70-P86 HydrophobicContact SD-CG 3.99Å
87	I	94.8	Very high	96	Very high	89 Å²	89	87.7 Å²	87.7	46%	0.456	42%	0.415	S	S	.	.	T	Hydrogen-bonded Turn	trans	-84.4	-56.6	-179.5	-52	-165.5	0	0	0	110.8	H67 C85	H67-I87 HydrophobicContact CB-CB 4.16Å; H67-I87 HydrophobicContact CB-CD1 3.74Å; H67-I87 HydrophobicContact CB-CG1 4.12Å; C85-I87 PolarHBondContact O-N 3.18Å; C85-I87 PolarHBondContact SG-N 3.38Å
88	C	97.2	Very high	95.9	Very high	41 Å²	41	86.7 Å²	86.7	28%	0.277	41%	0.41	S	S	.	.	T	Hydrogen-bonded Turn	trans	-113.2	3.6	-170.3	73.3	0	0	0	0	114.7	H67 K90	H67-C88 VanDerWaalsContact CE1-CB 3.41Å; H67-C88 WeakPolarHBondContact CE1-CB 3.35Å; H67-C88 VanDerWaalsContact CE1-SG 3.56Å; H67-C88 PolarHBondContact ND1-SG 3.09Å; C88-K90 PolarHBondContact O-N 3.43Å
89	R	95.8	Very high	95.7	Very high	212 Å²	212	93.6 Å²	93.6	80%	0.8	44%	0.439	S	S	*	.			trans	57.6	14.8	177.6	-52.5	-177.2	-177.7	-151.7	0.4	115.7	C85	C85-R89 WeakPolarHBondContact O-CA 3.37Å; C85-R89 PolarHBondContact O-N 3.23Å
90	K	96.5	Very high	95.2	Very high	126 Å²	126	97.2 Å²	97.2	55%	0.548	45%	0.454	S	S	.	.	P	Polyproline II helix	trans	-75.8	147.5	174	-68.8	-179.8	-177.7	177.3	0	110	C65 V84 C85 C88 I92	C65-K90 HydrophobicContact CB-CD 4.33Å; V84-K90 WeakPolarHBondContact CA-O 2.98Å; C85-K90 PolarHBondContact N-O 3.04Å; C88-K90 PolarHBondContact O-N 3.43Å; K90-I92 PolarHBondContact O-N 3.48Å
91	P	97	Very high	94.5	Very high	92 Å²	92	96.8 Å²	96.8	60%	0.597	48%	0.482	S	S	*	.	B	Isolated β-bridge	trans	-62.8	134	177	26.3	-33.8	0	0	0	110.6	G83	G83-P91 WeakPolarHBondContact O-CA 3.41Å
92	I	97.4	Very high	94.5	Very high	13 Å²	13	93.3 Å²	93.3	7%	0.067	47%	0.47	C	S	.	.	P	Polyproline II helix	trans	-84.4	133.4	176.4	-57.6	166.1	0	0	0	107.5	F62 F79 G83 V84 C85 K90 D94 V95	F62-I92 HydrophobicContact CB-CG1 4.16Å; F62-I92 HydrophobicContact CB-CG2 4.41Å; F62-I92 HydrophobicContact CD1-CD1 3.42Å; F62-I92 VanDerWaalsContact CD1-CD1 3.42Å; F62-I92 HydrophobicContact CD1-CG1 3.96Å; F62-I92 HydrophobicContact CD1-CG2 4.11Å; F62-I92 HydrophobicContact CE1-CD1 3.67Å; F62-I92 HydrophobicContact CG-CD1 4Å; F62-I92 HydrophobicContact CG-CG1 4.19Å; F62-I92 HydrophobicContact CZ-CD1 4.44Å; F79-I92 HydrophobicContact CD2-CB 3.71Å; F79-I92 HydrophobicContact CD2-CG2 3.54Å; F79-I92 HydrophobicContact CE2-CB 4.09Å; F79-I92 HydrophobicContact CE2-CG2 3.93Å; F79-I92 WeakPolarHBondContact CE2-O 3.4Å; F79-I92 HydrophobicContact CG-CG2 4.26Å; G83-I92 PolarHBondContact O-N 3.22Å; V84-I92 VanDerWaalsContact O-CD1 3.28Å; V84-I92 WeakPolarHBondContact O-CD1 3.47Å; C85-I92 HydrophobicContact CB-CG1 4.34Å; K90-I92 PolarHBondContact O-N 3.48Å; I92-D94 WeakPolarHBondContact CG2-O 3.43Å; I92-V95 HydrophobicContact CG2-CG2 4.31Å
93	R	96.4	Very high	94.5	Very high	179 Å²	179	91.3 Å²	91.3	68%	0.675	46%	0.462	S	S	*	.	S	Bend	trans	-99.6	-37.4	171.9	-70.9	-178.9	-177	178.4	-0.5	111.8	Y63	Y63-R93 HydrophobicContact CD1-CB 3.86Å; Y63-R93 HydrophobicContact CE1-CB 4.37Å; Y63-R93 PolarHBondContact O-N 3.48Å
94	D	96.4	Very high	94.5	Very high	84 Å²	84	95.2 Å²	95.2	45%	0.449	48%	0.476	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-152.2	159.8	178.1	-157.9	0.4	0	0	0	111.3	Y63 I92	Y63-D94 HydrophobicContact CD1-CB 4.49Å; Y63-D94 PolarHBondContact N-O 3.28Å; I92-D94 WeakPolarHBondContact CG2-O 3.43Å
95	V	97.3	Very high	94.4	Very high	6 Å²	6	97.6 Å²	97.6	4%	0.036	49%	0.485	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.2	111.5	175.4	179.7	0	0	0	0	108.5	F62 Y72 A75 F79 I92	F62-V95 HydrophobicContact CD1-CG2 4.29Å; F62-V95 HydrophobicContact CE1-CG2 4.49Å; Y72-V95 HydrophobicContact CD2-CG1 3.95Å; Y72-V95 HydrophobicContact CE2-CG1 3.97Å; Y72-V95 WeakPolarHBondContact CE2-O 3.09Å; A75-V95 HydrophobicContact CB-CG1 3.49Å; A75-V95 VanDerWaalsContact CB-CG1 3.49Å; A75-V95 HydrophobicContact CB-CG2 4.5Å; F79-V95 HydrophobicContact CB-CG2 3.71Å; F79-V95 HydrophobicContact CD1-CG2 4.27Å; F79-V95 HydrophobicContact CG-CG2 4.02Å; I92-V95 HydrophobicContact CG2-CG2 4.31Å
96	L	96.9	Very high	94.2	Very high	82 Å²	82	103.8 Å²	103.8	43%	0.429	52%	0.515	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.2	136.7	-178.4	-54.8	178.6	0	0	0	109.8	S60 A61	S60-L96 CarbonylContact C-O 3.54Å; S60-L96 WeakPolarHBondContact CA-O 3.11Å; S60-L96 WeakPolarHBondContact CB-O 3.38Å; A61-L96 PolarHBondContact N-O 3.08Å; A61-L96 PolarHBondContact O-N 3.11Å
97	K	96	Very high	94.3	Very high	100 Å²	100	106.3 Å²	106.3	44%	0.435	52%	0.521	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.9	127.5	172.4	-169	169.8	-179.2	172.7	0	109.7	D59 Y72 F99	D59-K97 CarbonylContact O-C 3.55Å; D59-K97 WeakPolarHBondContact O-CA 3.16Å; D59-K97 WeakPolarHBondContact O-CG 3.38Å; D59-K97 WeakPolarHBondContact OD2-CE 3.27Å; D59-K97 IonicContact OD2-NZ 3.74Å; Y72-K97 HydrophobicContact CD1-CD 4.48Å; Y72-K97 HydrophobicContact CD2-CB 3.72Å; Y72-K97 HydrophobicContact CD2-CD 4.45Å; Y72-K97 HydrophobicContact CD2-CG 4.15Å; Y72-K97 HydrophobicContact CE2-CB 3.82Å; Y72-K97 HydrophobicContact CG-CB 4.36Å; Y72-K97 HydrophobicContact CG-CD 4.25Å; Y72-K97 HydrophobicContact CG-CG 4.34Å; K97-F99 HydrophobicContact CB-CE2 4.25Å; K97-F99 HydrophobicContact CB-CZ 4.49Å; K97-F99 HydrophobicContact CD-CE1 4.17Å; K97-F99 HydrophobicContact CD-CE2 4.31Å; K97-F99 HydrophobicContact CD-CZ 3.71Å; K97-F99 HydrophobicContact CG-CE1 4.49Å; K97-F99 HydrophobicContact CG-CE2 4.09Å; K97-F99 HydrophobicContact CG-CZ 3.98Å
98	I	94.4	Very high	94.2	Very high	69 Å²	69	107.6 Å²	107.6	35%	0.354	53%	0.526	S	S	.	.	P	Polyproline II helix	trans	-96.8	134.1	179	-59.1	163	0	0	0	108.7	D59 A61	D59-I98 PolarHBondContact O-N 2.98Å; A61-I98 HydrophobicContact CB-CD1 3.71Å; A61-I98 HydrophobicContact CB-CG1 4.29Å
99	F	92.8	Very high	94	Very high	161 Å²	161	112.7 Å²	112.7	71%	0.706	55%	0.545	S	S	*	.			trans	-115.5	122.8	171.5	-59.6	-88.1	0	0	0	108	K97	K97-F99 HydrophobicContact CB-CE2 4.25Å; K97-F99 HydrophobicContact CB-CZ 4.49Å; K97-F99 HydrophobicContact CD-CE1 4.17Å; K97-F99 HydrophobicContact CD-CE2 4.31Å; K97-F99 HydrophobicContact CD-CZ 3.71Å; K97-F99 HydrophobicContact CG-CE1 4.49Å; K97-F99 HydrophobicContact CG-CE2 4.09Å; K97-F99 HydrophobicContact CG-CZ 3.98Å
100	K	84.3	Confident	93.9	Very high	149 Å²	149	104.4 Å²	104.4	65%	0.648	52%	0.524	S	S	*	.			trans	-82.7	130.1	173.3	-62.2	-173.5	-176.3	-172	0	108	D48	D48-K100 IonicContact OD1-NZ 2.68Å; D48-K100 PolarHBondContact OD1-NZ 2.68Å; D48-K100 IonicContact OD2-NZ 2.76Å; D48-K100 PolarHBondContact OD2-NZ 3.21Å
101	S	81.2	Confident	93.6	Very high	192 Å²	192	102.5 Å²	102.5	100%	1.343	52%	0.522	S	S	*	.			trans	-82.6	0	-179.9	61.6	0	0	0	0	112.7

Retrieved 101 of 101 residues in 254.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).