A0A077Z270_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077Z270, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 114 aa.

						>A0A077Z270_TRITR|A0A077Z270
MMMMMPLRLRWLPQQCLLPLLVLLLLPLLLLLLLLLQLLLLLLLLAMTGRNGGRLSSAVVIVTRSELIAVDTATSTGRPLSMGQRRGLINSGAPVHWTNWGQVVIRDDGGAFRN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.2	Low	60.8	Low	236 Å²	236	185.9 Å²	185.9	100%	1.163	88%	0.878	S	S	*	*				0	105.1	0	-85.6	168.5	153.6	0	0	108.3
2	M	54.1	Low	60.9	Low	199 Å²	199	183.4 Å²	183.4	98%	0.98	87%	0.873	S	S	*	*			trans	-87.7	112.3	174.3	-77.2	172.8	165.8	0	0	108.5
3	M	61.3	Low	61.2	Low	175 Å²	175	174.9 Å²	174.9	86%	0.862	84%	0.842	S	S	*	*			trans	-99.5	109.4	169.4	-74.5	-174.2	172.2	0	0	108.7	M5	M3-M5 PolarHBondContact O-N 2.82Å
4	M	67.8	Low	61.7	Low	189 Å²	189	175 Å²	175	93%	0.931	84%	0.841	S	S	*	*			trans	-73.8	114.7	170.6	-71.6	-179.3	166.7	0	0	109.1
5	M	64.8	Low	62.3	Low	179 Å²	179	174.5 Å²	174.5	88%	0.882	84%	0.837	S	S	*	*			trans	-80.5	142.1	171.3	-82.3	-178.3	159.3	0	0	110.8	M3	M3-M5 PolarHBondContact O-N 2.82Å
6	P	65	Low	62.8	Low	113 Å²	113	168.5 Å²	168.5	73%	0.734	82%	0.818	S	S	*	*			trans	-75.1	137.4	-170.2	30.3	-33.9	0	0	0	112.1	R8	P6-R8 PolarHBondContact O-N 3.05Å
7	L	61.6	Low	63.8	Low	172 Å²	172	165.4 Å²	165.4	90%	0.901	81%	0.805	S	S	*	*			trans	-56.9	104.4	176.7	-72.1	152.5	0	0	0	110.7	L9	L7-L9 PolarHBondContact O-N 3.41Å; L7-L9 VanDerWaalsContact O-N 3.12Å
8	R	57.9	Low	64.9	Low	186 Å²	186	162.8 Å²	162.8	70%	0.702	80%	0.795	S	S	*	*			trans	-74.5	98.3	171.3	-69.3	-162.6	175.9	-171.4	1	109.7	P6 R10	P6-R8 PolarHBondContact O-N 3.05Å; R8-R10 HydrophobicContact CB-CB 4.47Å; R8-R10 HydrophobicContact CB-CG 4.38Å; R8-R10 PolarHBondContact O-N 3.28Å
9	L	60.4	Low	66	Low	171 Å²	171	158.2 Å²	158.2	90%	0.895	78%	0.779	S	S	*	*			trans	-67.1	57.4	161.9	-76.8	158.7	0	0	0	111	L7	L7-L9 PolarHBondContact O-N 3.41Å; L7-L9 VanDerWaalsContact O-N 3.12Å
10	R	63.9	Low	67	Low	191 Å²	191	156.3 Å²	156.3	72%	0.721	77%	0.771	S	S	*	*			trans	-108.9	5.3	180	-75.6	-167.1	178.7	-160.4	-1.4	113.9	R8	R8-R10 HydrophobicContact CB-CB 4.47Å; R8-R10 HydrophobicContact CB-CG 4.38Å; R8-R10 PolarHBondContact O-N 3.28Å
11	W	59.7	Low	68.1	Low	234 Å²	234	153.5 Å²	153.5	89%	0.886	76%	0.759	S	S	*	*			trans	-121.1	45.3	-172.3	-69.1	101.7	0	0	0	112.8	P13	W11-P13 WeakPolarHBondContact O-CD 3.21Å
12	L	62.3	Low	70	Confident	156 Å²	156	145.8 Å²	145.8	82%	0.817	73%	0.725	S	S	*	*			trans	-79.1	110.5	159.8	-98.8	149.7	0	0	0	107.1	Q14	L12-Q14 PolarHBondContact O-N 3.36Å; L12-Q14 VanDerWaalsContact O-N 3.14Å
13	P	64.8	Low	71.8	Confident	73 Å²	73	142.4 Å²	142.4	47%	0.474	71%	0.71	S	S	.	*			trans	-61.4	120.7	178.7	24.9	-32.6	0	0	0	108.7	W11 Q15 C16	W11-P13 WeakPolarHBondContact O-CD 3.21Å; P13-Q15 PolarHBondContact O-N 2.93Å; P13-C16 HydrophobicContact CG-CB 4.48Å; P13-C16 PolarHBondContact O-N 2.97Å
14	Q	67.4	Low	73.3	Confident	176 Å²	176	140.2 Å²	140.2	82%	0.822	70%	0.701	S	S	*	*	G	3₁₀ helix	trans	-54.8	-23.4	-178.9	-165.8	174.3	-14.8	0	0	112.6	L12 C16 L17	L12-Q14 PolarHBondContact O-N 3.36Å; L12-Q14 VanDerWaalsContact O-N 3.14Å; Q14-C16 VanDerWaalsContact C-N 3.28Å; Q14-C16 PolarHBondContact O-N 3.14Å; Q14-L17 PolarHBondContact O-N 3.12Å
15	Q	71	Confident	74.6	Confident	168 Å²	168	136 Å²	136	79%	0.785	68%	0.682	S	S	*	*	G	3₁₀ helix	trans	-64.4	-24.2	175.6	-63.8	175.8	-9.3	0	0	113.9	P13 P19	P13-Q15 PolarHBondContact O-N 2.93Å; Q15-P19 WeakPolarHBondContact O-CD 3.44Å
16	C	71.4	Confident	76	Confident	78 Å²	78	132.9 Å²	132.9	53%	0.527	67%	0.668	S	S	.	*	G	3₁₀ helix	trans	-79.9	-23.6	177	-71.2	0	0	0	0	113	P13 Q14 P19	P13-C16 HydrophobicContact CG-CB 4.48Å; P13-C16 PolarHBondContact O-N 2.97Å; Q14-C16 VanDerWaalsContact C-N 3.28Å; Q14-C16 PolarHBondContact O-N 3.14Å; C16-P19 WeakPolarHBondContact O-CD 3.39Å; C16-P19 WeakPolarHBondContact O-CG 2.93Å
17	L	79.1	Confident	77.4	Confident	115 Å²	115	130.9 Å²	130.9	60%	0.602	66%	0.655	S	S	*	*	H	α-helix	trans	-78.7	-32.9	-177.1	-165.7	138.4	0	0	0	112	Q14 L20 L21	Q14-L17 PolarHBondContact O-N 3.12Å; L17-L20 PolarHBondContact O-N 2.96Å; L17-L21 WeakPolarHBondContact O-CB 3.36Å; L17-L21 PolarHBondContact O-N 3.47Å
18	L	84	Confident	79	Confident	120 Å²	120	128.2 Å²	128.2	63%	0.628	64%	0.641	S	S	*	*	H	α-helix	trans	-61.9	-51.9	179.2	-161.8	151.9	0	0	0	113.5	L20 L21 V22	L18-L20 VanDerWaalsContact C-N 3.3Å; L18-L20 PolarHBondContact O-N 3.43Å; L18-L21 PolarHBondContact O-N 2.96Å; L18-V22 HydrophobicContact CD2-CG2 3.98Å; L18-V22 WeakPolarHBondContact O-CG2 3.27Å; L18-V22 PolarHBondContact O-N 3.43Å
19	P	85.2	Confident	80.8	Confident	75 Å²	75	124.4 Å²	124.4	49%	0.487	64%	0.635	S	S	.	*	H	α-helix	trans	-64.9	-34.8	178.9	25.8	-34.4	0	0	0	112.1	Q15 C16 V22 L23	Q15-P19 WeakPolarHBondContact O-CD 3.44Å; C16-P19 WeakPolarHBondContact O-CD 3.39Å; C16-P19 WeakPolarHBondContact O-CG 2.93Å; P19-V22 PolarHBondContact O-N 2.95Å; P19-L23 VanDerWaalsContact O-CB 3.27Å; P19-L23 WeakPolarHBondContact O-CB 3.44Å; P19-L23 PolarHBondContact O-N 3.08Å
20	L	87.2	Confident	82.5	Confident	120 Å²	120	122 Å²	122	63%	0.628	62%	0.622	S	S	*	*	H	α-helix	trans	-62.7	-44.2	174.8	-169.5	83.1	0	0	0	111.2	L17 L18 L23 L24	L17-L20 PolarHBondContact O-N 2.96Å; L18-L20 VanDerWaalsContact C-N 3.3Å; L18-L20 PolarHBondContact O-N 3.43Å; L20-L23 PolarHBondContact O-N 3.39Å; L20-L24 PolarHBondContact O-N 2.9Å; L20-L24 VanDerWaalsContact O-N 3.08Å
21	L	89.7	Confident	84	Confident	97 Å²	97	117.7 Å²	117.7	51%	0.508	61%	0.612	S	S	.	*	H	α-helix	trans	-65.9	-42.1	178	-171.9	145.2	0	0	0	111.6	L17 L18 L24 L25	L17-L21 WeakPolarHBondContact O-CB 3.36Å; L17-L21 PolarHBondContact O-N 3.47Å; L18-L21 PolarHBondContact O-N 2.96Å; L21-L24 PolarHBondContact O-N 3.27Å; L21-L25 VanDerWaalsContact O-CB 3.26Å; L21-L25 WeakPolarHBondContact O-CB 3.35Å; L21-L25 PolarHBondContact O-N 3.33Å
22	V	92.3	Very high	85.8	Confident	75 Å²	75	112 Å²	112	46%	0.455	60%	0.599	S	S	.	*	H	α-helix	trans	-63.6	-43.6	176.2	173.1	0	0	0	0	111.1	L18 P19 L24 L25 L26	L18-V22 HydrophobicContact CD2-CG2 3.98Å; L18-V22 WeakPolarHBondContact O-CG2 3.27Å; L18-V22 PolarHBondContact O-N 3.43Å; P19-V22 PolarHBondContact O-N 2.95Å; V22-L24 PolarHBondContact O-N 2.84Å; V22-L25 PolarHBondContact O-N 3.28Å; V22-L26 WeakPolarHBondContact O-CB 3.26Å; V22-L26 PolarHBondContact O-N 3.22Å
23	L	91.6	Very high	87.4	Confident	127 Å²	127	108.8 Å²	108.8	67%	0.665	58%	0.582	S	S	*	*	H	α-helix	trans	-61.2	-33.3	177.3	-175.8	66.8	0	0	0	112.2	P19 L20 P27	P19-L23 VanDerWaalsContact O-CB 3.27Å; P19-L23 WeakPolarHBondContact O-CB 3.44Å; P19-L23 PolarHBondContact O-N 3.08Å; L20-L23 PolarHBondContact O-N 3.39Å; L23-P27 WeakPolarHBondContact O-CD 2.94Å; L23-P27 WeakPolarHBondContact O-CG 3.33Å
24	L	92.5	Very high	88.8	Confident	130 Å²	130	110.1 Å²	110.1	68%	0.681	59%	0.585	S	S	*	*	H	α-helix	trans	-79.5	-39.5	175.4	-176.2	67.2	0	0	0	112.7	L20 L21 V22 P27	L20-L24 PolarHBondContact O-N 2.9Å; L20-L24 VanDerWaalsContact O-N 3.08Å; L21-L24 PolarHBondContact O-N 3.27Å; V22-L24 PolarHBondContact O-N 2.84Å; L24-P27 WeakPolarHBondContact O-CD 3.49Å; L24-P27 WeakPolarHBondContact O-CG 3.48Å
25	L	94.9	Very high	90.1	Very high	100 Å²	100	106.2 Å²	106.2	52%	0.524	57%	0.569	S	S	.	*	H	α-helix	trans	-72.2	-36.8	-176	-167.7	107.7	0	0	0	112.2	L21 V22 L28 L29	L21-L25 VanDerWaalsContact O-CB 3.26Å; L21-L25 WeakPolarHBondContact O-CB 3.35Å; L21-L25 PolarHBondContact O-N 3.33Å; V22-L25 PolarHBondContact O-N 3.28Å; L25-L28 WeakPolarHBondContact O-CB 3.32Å; L25-L28 PolarHBondContact O-N 2.97Å; L25-L29 WeakPolarHBondContact O-CB 3.39Å; L25-L29 PolarHBondContact O-N 3.4Å
26	L	94.2	Very high	91.2	Very high	114 Å²	114	102.7 Å²	102.7	60%	0.597	56%	0.555	S	S	*	*	H	α-helix	trans	-57.6	-52.6	-179	-170.5	76.3	0	0	0	113.7	V22 L28 L29 L30	V22-L26 WeakPolarHBondContact O-CB 3.26Å; V22-L26 PolarHBondContact O-N 3.22Å; L26-L28 VanDerWaalsContact C-N 3.3Å; L26-L28 PolarHBondContact O-N 3.31Å; L26-L29 PolarHBondContact O-N 3.34Å; L26-L30 PolarHBondContact O-N 3.29Å
27	P	94.9	Very high	92.3	Very high	71 Å²	71	104 Å²	104	46%	0.461	55%	0.554	S	S	.	*	H	α-helix	trans	-67.2	-31.5	177.9	26.9	-35.3	0	0	0	112.2	L23 L24 L30 L31	L23-P27 WeakPolarHBondContact O-CD 2.94Å; L23-P27 WeakPolarHBondContact O-CG 3.33Å; L24-P27 WeakPolarHBondContact O-CD 3.49Å; L24-P27 WeakPolarHBondContact O-CG 3.48Å; P27-L30 PolarHBondContact O-N 3.42Å; P27-L31 WeakPolarHBondContact O-CB 3.47Å; P27-L31 PolarHBondContact O-N 2.96Å
28	L	95.3	Very high	92.9	Very high	115 Å²	115	103 Å²	103	60%	0.602	55%	0.548	S	S	*	.	H	α-helix	trans	-64.5	-43.8	175.5	-171.9	72.1	0	0	0	111.3	L25 L26 L31 L32	L25-L28 WeakPolarHBondContact O-CB 3.32Å; L25-L28 PolarHBondContact O-N 2.97Å; L26-L28 VanDerWaalsContact C-N 3.3Å; L26-L28 PolarHBondContact O-N 3.31Å; L28-L31 PolarHBondContact O-N 3.03Å; L28-L32 PolarHBondContact O-N 3.5Å
29	L	95.5	Very high	93.3	Very high	107 Å²	107	102.7 Å²	102.7	56%	0.56	55%	0.546	S	S	*	.	H	α-helix	trans	-64.2	-42.2	175.8	-176	67.5	0	0	0	111.6	L25 L26 L32 L33	L25-L29 WeakPolarHBondContact O-CB 3.39Å; L25-L29 PolarHBondContact O-N 3.4Å; L26-L29 PolarHBondContact O-N 3.34Å; L29-L32 PolarHBondContact O-N 2.92Å; L29-L33 PolarHBondContact O-N 3.43Å
30	L	95.8	Very high	93.5	Very high	121 Å²	121	103.3 Å²	103.3	63%	0.634	55%	0.545	S	S	*	.	H	α-helix	trans	-61.8	-44	176.8	-173.1	71.1	0	0	0	111.6	L26 P27 L32 L33 L34	L26-L30 PolarHBondContact O-N 3.29Å; P27-L30 PolarHBondContact O-N 3.42Å; L30-L32 VanDerWaalsContact C-N 3.35Å; L30-L32 PolarHBondContact O-N 3.33Å; L30-L33 PolarHBondContact O-N 3.49Å; L30-L34 WeakPolarHBondContact O-CB 3.49Å; L30-L34 PolarHBondContact O-N 3.33Å
31	L	95.8	Very high	93.6	Very high	99 Å²	99	103 Å²	103	52%	0.518	54%	0.544	S	S	.	.	H	α-helix	trans	-60.4	-44.7	176.1	-177.4	68.6	0	0	0	111.3	P27 L28 L33 L34 L35	P27-L31 WeakPolarHBondContact O-CB 3.47Å; P27-L31 PolarHBondContact O-N 2.96Å; L28-L31 PolarHBondContact O-N 3.03Å; L31-L33 PolarHBondContact O-N 3.02Å; L31-L34 PolarHBondContact O-N 3.37Å; L31-L35 HydrophobicContact CG-CD1 4.36Å; L31-L35 WeakPolarHBondContact O-CG 3.36Å; L31-L35 PolarHBondContact O-N 3.3Å
32	L	96.2	Very high	93.4	Very high	114 Å²	114	103 Å²	103	60%	0.597	54%	0.544	S	S	*	.	H	α-helix	trans	-62	-43.1	177.6	-176.9	64.6	0	0	0	112	L28 L29 L30 L34 L35 L36	L28-L32 PolarHBondContact O-N 3.5Å; L29-L32 PolarHBondContact O-N 2.92Å; L30-L32 VanDerWaalsContact C-N 3.35Å; L30-L32 PolarHBondContact O-N 3.33Å; L32-L34 VanDerWaalsContact C-N 3.35Å; L32-L34 PolarHBondContact O-N 3.38Å; L32-L35 PolarHBondContact O-N 3.5Å; L32-L36 PolarHBondContact O-N 2.99Å
33	L	96.1	Very high	93.1	Very high	89 Å²	89	104.5 Å²	104.5	47%	0.466	55%	0.549	S	S	.	.	H	α-helix	trans	-62.7	-42.2	177.3	-176.5	65.8	0	0	0	111.7	L29 L30 L31 L36 Q37	L29-L33 PolarHBondContact O-N 3.43Å; L30-L33 PolarHBondContact O-N 3.49Å; L31-L33 PolarHBondContact O-N 3.02Å; L33-L36 PolarHBondContact O-N 3.01Å; L33-Q37 WeakPolarHBondContact O-CG 3.37Å; L33-Q37 PolarHBondContact O-N 2.92Å
34	L	95.6	Very high	92.7	Very high	102 Å²	102	103.6 Å²	103.6	53%	0.534	54%	0.544	S	S	.	.	H	α-helix	trans	-64	-42.5	177.9	-173.5	144	0	0	0	111.7	L30 L31 L32 L36 Q37 L38	L30-L34 WeakPolarHBondContact O-CB 3.49Å; L30-L34 PolarHBondContact O-N 3.33Å; L31-L34 PolarHBondContact O-N 3.37Å; L32-L34 VanDerWaalsContact C-N 3.35Å; L32-L34 PolarHBondContact O-N 3.38Å; L34-L36 VanDerWaalsContact C-N 3.35Å; L34-L36 PolarHBondContact O-N 3.01Å; L34-Q37 PolarHBondContact O-N 3.06Å; L34-L38 PolarHBondContact O-N 2.82Å
35	L	94.5	Very high	92	Very high	93 Å²	93	103.1 Å²	103.1	49%	0.487	54%	0.541	S	S	.	.	H	α-helix	trans	-62.5	-41.4	174.6	-72.1	170.8	0	0	0	112	L31 L32 L38 L39	L31-L35 HydrophobicContact CG-CD1 4.36Å; L31-L35 WeakPolarHBondContact O-CG 3.36Å; L31-L35 PolarHBondContact O-N 3.3Å; L32-L35 PolarHBondContact O-N 3.5Å; L35-L38 PolarHBondContact O-N 3.41Å; L35-L39 WeakPolarHBondContact O-CB 3.38Å; L35-L39 PolarHBondContact O-N 3.41Å
36	L	94.5	Very high	91	Very high	95 Å²	95	101.2 Å²	101.2	50%	0.497	54%	0.54	S	S	.	.	H	α-helix	trans	-63.6	-43.7	177	-176.7	64.9	0	0	0	111.7	L32 L33 L34 L39 L40	L32-L36 PolarHBondContact O-N 2.99Å; L33-L36 PolarHBondContact O-N 3.01Å; L34-L36 VanDerWaalsContact C-N 3.35Å; L34-L36 PolarHBondContact O-N 3.01Å; L36-L39 PolarHBondContact O-N 3.38Å; L36-L40 HydrophobicContact CD1-CD1 4.48Å; L36-L40 HydrophobicContact CG-CD1 4.02Å; L36-L40 WeakPolarHBondContact O-CB 3.27Å; L36-L40 WeakPolarHBondContact O-CD1 3.44Å; L36-L40 WeakPolarHBondContact O-CG 3.37Å; L36-L40 PolarHBondContact O-N 2.84Å
37	Q	93.1	Very high	90	Very high	106 Å²	106	101 Å²	101	50%	0.495	54%	0.538	S	S	.	.	H	α-helix	trans	-60.6	-44.3	175.3	-73.3	174.1	-0.2	0	0	111.6	L33 L34 L40 L41	L33-Q37 WeakPolarHBondContact O-CG 3.37Å; L33-Q37 PolarHBondContact O-N 2.92Å; L34-Q37 PolarHBondContact O-N 3.06Å; Q37-L40 PolarHBondContact O-N 3.34Å; Q37-L41 VanDerWaalsContact O-CG 3.32Å; Q37-L41 WeakPolarHBondContact O-CG 3.47Å; Q37-L41 PolarHBondContact O-N 3.33Å
38	L	92.9	Very high	88.4	Confident	94 Å²	94	100.3 Å²	100.3	49%	0.492	53%	0.532	S	S	.	.	H	α-helix	trans	-61.3	-44.9	176.5	-176.6	67.4	0	0	0	111.6	L34 L35 L41 L42	L34-L38 PolarHBondContact O-N 2.82Å; L35-L38 PolarHBondContact O-N 3.41Å; L38-L41 PolarHBondContact O-N 2.94Å; L38-L42 HydrophobicContact CG-CD1 4.36Å; L38-L42 WeakPolarHBondContact O-CG 3.22Å; L38-L42 PolarHBondContact O-N 3.5Å
39	L	91.7	Very high	86.7	Confident	112 Å²	112	97.4 Å²	97.4	59%	0.586	53%	0.53	S	S	*	.	H	α-helix	trans	-62.8	-43	177.6	-173.7	71.5	0	0	0	111.7	L35 L36 L42 L43	L35-L39 WeakPolarHBondContact O-CB 3.38Å; L35-L39 PolarHBondContact O-N 3.41Å; L36-L39 PolarHBondContact O-N 3.38Å; L39-L42 PolarHBondContact O-N 2.93Å; L39-L43 WeakPolarHBondContact O-CB 3.43Å; L39-L43 PolarHBondContact O-N 2.93Å
40	L	90.3	Very high	84.8	Confident	88 Å²	88	102.9 Å²	102.9	46%	0.461	54%	0.543	S	S	.	.	H	α-helix	trans	-60.6	-43.5	175.1	-79.4	159.5	0	0	0	111.6	L36 Q37 L43 L44	L36-L40 HydrophobicContact CD1-CD1 4.48Å; L36-L40 HydrophobicContact CG-CD1 4.02Å; L36-L40 WeakPolarHBondContact O-CB 3.27Å; L36-L40 WeakPolarHBondContact O-CD1 3.44Å; L36-L40 WeakPolarHBondContact O-CG 3.37Å; L36-L40 PolarHBondContact O-N 2.84Å; Q37-L40 PolarHBondContact O-N 3.34Å; L40-L43 PolarHBondContact O-N 3.35Å; L40-L44 WeakPolarHBondContact O-CB 3.36Å; L40-L44 VanDerWaalsContact O-CG 3.27Å; L40-L44 WeakPolarHBondContact O-CG 3.37Å; L40-L44 PolarHBondContact O-N 2.91Å
41	L	87.7	Confident	82.8	Confident	114 Å²	114	104 Å²	104	60%	0.597	55%	0.55	S	S	*	.	H	α-helix	trans	-61.7	-43.8	175.5	-73.8	169.5	0	0	0	111.8	Q37 L38 L44 L45	Q37-L41 VanDerWaalsContact O-CG 3.32Å; Q37-L41 WeakPolarHBondContact O-CG 3.47Å; Q37-L41 PolarHBondContact O-N 3.33Å; L38-L41 PolarHBondContact O-N 2.94Å; L41-L44 PolarHBondContact O-N 2.99Å; L41-L45 WeakPolarHBondContact O-CB 3.43Å; L41-L45 PolarHBondContact O-N 2.95Å
42	L	85.6	Confident	80.4	Confident	97 Å²	97	100.3 Å²	100.3	51%	0.508	54%	0.535	S	S	.	.	H	α-helix	trans	-65.1	-40.5	176.3	-72.2	171.7	0	0	0	112.1	L38 L39 L45 A46	L38-L42 HydrophobicContact CG-CD1 4.36Å; L38-L42 WeakPolarHBondContact O-CG 3.22Å; L38-L42 PolarHBondContact O-N 3.5Å; L39-L42 PolarHBondContact O-N 2.93Å; L42-L45 PolarHBondContact O-N 3.35Å; L42-A46 WeakPolarHBondContact O-CB 3.32Å; L42-A46 PolarHBondContact O-N 3.38Å
43	L	86.1	Confident	77.9	Confident	107 Å²	107	98.8 Å²	98.8	56%	0.56	55%	0.548	S	S	*	.	H	α-helix	trans	-65.3	-44.2	176.2	-175.6	68.3	0	0	0	111.1	L39 L40 L45 A46 M47	L39-L43 WeakPolarHBondContact O-CB 3.43Å; L39-L43 PolarHBondContact O-N 2.93Å; L40-L43 PolarHBondContact O-N 3.35Å; L43-L45 VanDerWaalsContact C-N 3.3Å; L43-L45 PolarHBondContact O-N 3.29Å; L43-A46 PolarHBondContact O-N 2.93Å; L43-M47 WeakPolarHBondContact O-CB 3.31Å; L43-M47 WeakPolarHBondContact O-CG 3.29Å; L43-M47 PolarHBondContact O-N 3.05Å
44	L	83	Confident	75.7	Confident	108 Å²	108	105.8 Å²	105.8	57%	0.565	57%	0.568	S	S	*	*	H	α-helix	trans	-59.5	-43.1	173.8	-76.7	167	0	0	0	110.9	L40 L41 M47 T48	L40-L44 WeakPolarHBondContact O-CB 3.36Å; L40-L44 VanDerWaalsContact O-CG 3.27Å; L40-L44 WeakPolarHBondContact O-CG 3.37Å; L40-L44 PolarHBondContact O-N 2.91Å; L41-L44 PolarHBondContact O-N 2.99Å; L44-M47 PolarHBondContact O-N 2.81Å; L44-T48 WeakPolarHBondContact O-CB 3.41Å; L44-T48 VanDerWaalsContact O-CG2 3.29Å; L44-T48 WeakPolarHBondContact O-CG2 3.35Å; L44-T48 PolarHBondContact O-N 3.32Å; L44-T48 PolarHBondContact O-OG1 2.88Å
45	L	78.1	Confident	73.3	Confident	119 Å²	119	106.1 Å²	106.1	62%	0.623	57%	0.57	S	S	*	*	H	α-helix	trans	-64	-39	176.2	-172.6	64.6	0	0	0	112.2	L41 L42 L43 T48 G49	L41-L45 WeakPolarHBondContact O-CB 3.43Å; L41-L45 PolarHBondContact O-N 2.95Å; L42-L45 PolarHBondContact O-N 3.35Å; L43-L45 VanDerWaalsContact C-N 3.3Å; L43-L45 PolarHBondContact O-N 3.29Å; L45-T48 VanDerWaalsContact CA-OG1 3.31Å; L45-T48 WeakPolarHBondContact CA-OG1 3.39Å; L45-T48 PolarHBondContact O-OG1 3.23Å; L45-T48 VanDerWaalsContact O-OG1 3.1Å; L45-G49 PolarHBondContact O-N 2.85Å
46	A	74.2	Confident	70.8	Confident	61 Å²	61	106.9 Å²	106.9	50%	0.504	58%	0.583	S	S	.	*	H	α-helix	trans	-67.8	-39.6	175.8	0	0	0	0	0	111.7	L42 L43 G49 R50	L42-A46 WeakPolarHBondContact O-CB 3.32Å; L42-A46 PolarHBondContact O-N 3.38Å; L43-A46 PolarHBondContact O-N 2.93Å; A46-G49 PolarHBondContact O-N 2.94Å; A46-R50 WeakPolarHBondContact O-CB 3.49Å; A46-R50 PolarHBondContact O-N 3.42Å
47	M	72.4	Confident	68.3	Low	110 Å²	110	107.7 Å²	107.7	54%	0.542	60%	0.596	S	S	.	*	H	α-helix	trans	-71	-39.6	177.4	-68.5	-67.8	-75.8	0	0	111.9	L43 L44 R50 N51	L43-M47 WeakPolarHBondContact O-CB 3.31Å; L43-M47 WeakPolarHBondContact O-CG 3.29Å; L43-M47 PolarHBondContact O-N 3.05Å; L44-M47 PolarHBondContact O-N 2.81Å; M47-R50 PolarHBondContact O-N 3.44Å; M47-N51 PolarHBondContact O-N 3.04Å
48	T	63.1	Low	65.7	Low	55 Å²	55	106.2 Å²	106.2	34%	0.337	60%	0.602	S	S	.	*	H	α-helix	trans	-72.2	-32.1	174.2	55.3	0	0	0	0	111.7	L44 L45 G52 L55	L44-T48 WeakPolarHBondContact O-CB 3.41Å; L44-T48 VanDerWaalsContact O-CG2 3.29Å; L44-T48 WeakPolarHBondContact O-CG2 3.35Å; L44-T48 PolarHBondContact O-N 3.32Å; L44-T48 PolarHBondContact O-OG1 2.88Å; L45-T48 VanDerWaalsContact CA-OG1 3.31Å; L45-T48 WeakPolarHBondContact CA-OG1 3.39Å; L45-T48 PolarHBondContact O-OG1 3.23Å; L45-T48 VanDerWaalsContact O-OG1 3.1Å; T48-G52 CarbonylContact O-C 3.31Å; T48-G52 VanDerWaalsContact O-C 3.31Å; T48-G52 WeakPolarHBondContact O-CA 3.5Å; T48-G52 PolarHBondContact O-N 3.46Å; T48-L55 HydrophobicContact CG2-CD1 4.12Å
49	G	58.2	Low	63.2	Low	55 Å²	55	107.4 Å²	107.4	57%	0.567	61%	0.613	S	S	*	*	H	α-helix	trans	-67.2	-36.4	171.5	0	0	0	0	0	113.1	L45 A46	L45-G49 PolarHBondContact O-N 2.85Å; A46-G49 PolarHBondContact O-N 2.94Å
50	R	55.1	Low	60.8	Low	222 Å²	222	108 Å²	108	84%	0.838	62%	0.621	S	S	*	*	H	α-helix	trans	-81.2	-26.9	-179.9	-161.3	170.8	175.5	170.1	-1.8	113.8	A46 M47	A46-R50 WeakPolarHBondContact O-CB 3.49Å; A46-R50 PolarHBondContact O-N 3.42Å; M47-R50 PolarHBondContact O-N 3.44Å
51	N	55	Low	58.4	Low	144 Å²	144	110.7 Å²	110.7	77%	0.77	63%	0.634	S	S	*	*	H	α-helix	trans	-107.9	4.7	176.6	-71.9	-18	0	0	0	114.1	M47	M47-N51 PolarHBondContact O-N 3.04Å
52	G	44.3	Very low	56	Low	21 Å²	21	111.1 Å²	111.1	22%	0.216	64%	0.641	C	S	.	*			trans	-158.8	67.2	-163.6	0	0	0	0	0	114.7	T48 R54 L55	T48-G52 CarbonylContact O-C 3.31Å; T48-G52 VanDerWaalsContact O-C 3.31Å; T48-G52 WeakPolarHBondContact O-CA 3.5Å; T48-G52 PolarHBondContact O-N 3.46Å; G52-R54 PolarHBondContact O-N 3.32Å; G52-L55 PolarHBondContact O-N 2.84Å
53	G	43.8	Very low	54	Low	83 Å²	83	112.3 Å²	112.3	86%	0.856	65%	0.653	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.3	24.1	152.5	0	0	0	0	0	114.4
54	R	50.3	Low	51.6	Low	236 Å²	236	118.6 Å²	118.6	89%	0.891	67%	0.669	S	S	*	*	T	Hydrogen-bonded Turn	trans	-128	9.3	-179.4	-72	-175.9	76	-171.1	6.1	113.7	G52	G52-R54 PolarHBondContact O-N 3.32Å
55	L	46.6	Very low	49.5	Very low	109 Å²	109	119 Å²	119	57%	0.571	68%	0.682	S	S	*	*			trans	-104.5	14.3	168.6	-68.4	172.4	0	0	0	113	T48 G52 S57 A58	T48-L55 HydrophobicContact CG2-CD1 4.12Å; G52-L55 PolarHBondContact O-N 2.84Å; L55-S57 PolarHBondContact O-N 3.3Å; L55-S57 VanDerWaalsContact O-N 3.14Å; L55-A58 HydrophobicContact CD2-CB 4.35Å
56	S	41.6	Very low	47.7	Very low	109 Å²	109	121 Å²	121	76%	0.762	69%	0.687	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58.6	115.3	159.7	-171.1	0	0	0	0	107.3
57	S	40.9	Very low	46.1	Very low	112 Å²	112	126.1 Å²	126.1	78%	0.783	71%	0.706	S	S	*	*	T	Hydrogen-bonded Turn	trans	89.6	14.8	176.7	79.4	0	0	0	0	120.5	L55 V59	L55-S57 PolarHBondContact O-N 3.3Å; L55-S57 VanDerWaalsContact O-N 3.14Å; S57-V59 PolarHBondContact O-N 3.1Å
58	A	39.8	Very low	44.6	Very low	75 Å²	75	126.5 Å²	126.5	62%	0.62	71%	0.708	S	S	*	*			trans	-80.9	66.7	164.2	0	0	0	0	0	111	L55 V60	L55-A58 HydrophobicContact CD2-CB 4.35Å; A58-V60 PolarHBondContact O-N 2.9Å
59	V	40.8	Very low	43.8	Very low	119 Å²	119	128.6 Å²	128.6	72%	0.721	73%	0.731	S	S	*	*			trans	-63.1	124.4	164.4	171.2	0	0	0	0	107.6	S57 I61	S57-V59 PolarHBondContact O-N 3.1Å; V59-I61 PolarHBondContact O-N 2.88Å
60	V	39.4	Very low	43.2	Very low	125 Å²	125	130 Å²	130	76%	0.758	73%	0.729	S	S	*	*			trans	-57.6	97.1	175.2	178.1	0	0	0	0	109.5	A58 V62	A58-V60 PolarHBondContact O-N 2.9Å; V60-V62 HydrophobicContact CG1-CB 4.4Å; V60-V62 HydrophobicContact CG1-CG2 4.04Å
61	I	40.3	Very low	42.8	Very low	143 Å²	143	121.6 Å²	121.6	73%	0.733	70%	0.7	S	S	*	*			trans	-100.9	84.3	163.9	-57.3	173.6	0	0	0	106.5	V59	V59-I61 PolarHBondContact O-N 2.88Å
62	V	37.8	Very low	42.4	Very low	123 Å²	123	121.9 Å²	121.9	75%	0.745	71%	0.708	S	S	*	*			trans	-114.1	80.3	165.8	-178.1	0	0	0	0	106.8	V60	V60-V62 HydrophobicContact CG1-CB 4.4Å; V60-V62 HydrophobicContact CG1-CG2 4.04Å
63	T	43.3	Very low	42.6	Very low	123 Å²	123	124.6 Å²	124.6	76%	0.755	73%	0.728	S	S	*	*			trans	-131.9	112.7	158.8	39.7	0	0	0	0	107.8	S65	T63-S65 PolarHBondContact O-N 2.95Å
64	R	35.2	Very low	42.7	Very low	239 Å²	239	123.6 Å²	123.6	90%	0.902	71%	0.705	S	S	*	*			trans	-52.2	129.5	170.4	-64.6	173.1	174.5	-176.8	-3	108.2
65	S	39.5	Very low	42.3	Very low	117 Å²	117	118.5 Å²	118.5	82%	0.818	71%	0.706	S	S	*	*	S	Bend	trans	149.5	-19	135.2	-59	0	0	0	0	114.7	T63	T63-S65 PolarHBondContact O-N 2.95Å
66	E	40.5	Very low	42.2	Very low	160 Å²	160	117.5 Å²	117.5	75%	0.748	70%	0.704	S	S	*	*			trans	-140.1	104.7	-176.7	-67.7	-175.6	164.6	0	0	110.9	I68	E66-I68 VanDerWaalsContact C-N 3.26Å; E66-I68 HydrophobicContact CB-CD1 4.42Å; E66-I68 HydrophobicContact CB-CG1 4.07Å; E66-I68 PolarHBondContact O-N 3.14Å
67	L	40	Very low	42.3	Very low	169 Å²	169	113.9 Å²	113.9	89%	0.885	68%	0.684	S	S	*	*			trans	-69.5	85.6	169	-113.6	95.7	0	0	0	108.2
68	I	42.1	Very low	42.7	Very low	117 Å²	117	117.5 Å²	117.5	60%	0.6	68%	0.681	S	S	*	*			trans	-94	104.3	170.1	-46.9	-178.2	0	0	0	107.2	E66 V70	E66-I68 VanDerWaalsContact C-N 3.26Å; E66-I68 HydrophobicContact CB-CD1 4.42Å; E66-I68 HydrophobicContact CB-CG1 4.07Å; E66-I68 PolarHBondContact O-N 3.14Å; I68-V70 HydrophobicContact CB-CG2 4.02Å; I68-V70 HydrophobicContact CG2-CG2 3.35Å; I68-V70 PolarHBondContact O-N 3.02Å
69	A	45.9	Very low	43.5	Very low	99 Å²	99	119.9 Å²	119.9	82%	0.818	69%	0.69	S	S	*	*			trans	-67.3	96.8	165.1	0	0	0	0	0	108.1
70	V	45.3	Very low	44.3	Very low	86 Å²	86	117.9 Å²	117.9	52%	0.521	68%	0.675	S	S	.	*			trans	-103	113.2	177.7	-175.9	0	0	0	0	108.7	I68 T72	I68-V70 HydrophobicContact CB-CG2 4.02Å; I68-V70 HydrophobicContact CG2-CG2 3.35Å; I68-V70 PolarHBondContact O-N 3.02Å; V70-T72 PolarHBondContact O-N 2.91Å
71	D	45.8	Very low	45.4	Very low	44 Å²	44	115 Å²	115	24%	0.235	66%	0.66	C	S	.	*			trans	-53.7	112.3	175.1	-169.3	9.1	0	0	0	111.2	A73 T74	D71-A73 VanDerWaalsContact C-N 3.31Å; D71-A73 PolarHBondContact OD1-N 3.19Å; D71-T74 PolarHBondContact OD2-OG1 2.95Å
72	T	47.5	Very low	46.3	Very low	151 Å²	151	116.2 Å²	116.2	93%	0.926	67%	0.665	S	S	*	*	S	Bend	trans	-86.6	-1	176.7	45.8	0	0	0	0	113	V70	V70-T72 PolarHBondContact O-N 2.91Å
73	A	49.2	Very low	47.5	Very low	78 Å²	78	112.9 Å²	112.9	65%	0.645	66%	0.655	S	S	*	*	S	Bend	trans	-87.9	-14.8	174.6	0	0	0	0	0	112.9	D71	D71-A73 VanDerWaalsContact C-N 3.31Å; D71-A73 PolarHBondContact OD1-N 3.19Å
74	T	44.4	Very low	48.3	Very low	61 Å²	61	111.8 Å²	111.8	37%	0.374	64%	0.642	S	S	.	*	S	Bend	trans	-146	119.3	178.7	5.9	0	0	0	0	107	D71 T76	D71-T74 PolarHBondContact OD2-OG1 2.95Å; T74-T76 PolarHBondContact O-N 3.42Å
75	S	41.7	Very low	49.5	Very low	130 Å²	130	106.4 Å²	106.4	91%	0.909	62%	0.621	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.7	34.2	-175.5	68.9	0	0	0	0	114.9
76	T	45.6	Very low	50.5	Low	87 Å²	87	110 Å²	110	53%	0.534	62%	0.617	S	S	.	*	T	Hydrogen-bonded Turn	trans	-133.4	-2.6	-167.4	58.2	0	0	0	0	113.8	T74 R78	T74-T76 PolarHBondContact O-N 3.42Å; T76-R78 PolarHBondContact O-N 3.23Å
77	G	43.2	Very low	51.6	Low	33 Å²	33	104.4 Å²	104.4	34%	0.34	60%	0.602	S	S	.	*			trans	56.6	29.2	168.8	0	0	0	0	0	114.9
78	R	50.4	Low	52.5	Low	189 Å²	189	97.8 Å²	97.8	71%	0.713	57%	0.567	S	S	*	*	P	Polyproline II helix	trans	-95.7	136.1	-178	-79.2	-177.1	169.9	171.5	-2.3	111.3	T76 L80	T76-R78 PolarHBondContact O-N 3.23Å; R78-L80 PolarHBondContact O-N 3.28Å
79	P	54.8	Low	53.5	Low	124 Å²	124	96.7 Å²	96.7	81%	0.805	56%	0.562	S	S	*	*	P	Polyproline II helix	trans	-64.6	134.7	173.3	26.4	-32.8	0	0	0	110.9
80	L	58.9	Low	54.4	Low	78 Å²	78	98.5 Å²	98.5	41%	0.408	56%	0.558	S	S	.	*	P	Polyproline II helix	trans	-62.7	135.4	176	-69.1	169.5	0	0	0	111.4	R78 Q84 L88	R78-L80 PolarHBondContact O-N 3.28Å; L80-Q84 HydrophobicContact CB-CB 4.48Å; L80-Q84 HydrophobicContact CD2-CB 4.21Å; L80-L88 HydrophobicContact CD1-CD1 4.4Å
81	S	61.9	Low	55.3	Low	65 Å²	65	97.1 Å²	97.1	46%	0.455	55%	0.552	S	S	.	*	P	Polyproline II helix	trans	-67.3	155.4	173.8	66.6	0	0	0	0	111.8	G83 Q84 R85	S81-G83 PolarHBondContact O-N 3.42Å; S81-G83 VanDerWaalsContact O-N 3.12Å; S81-Q84 PolarHBondContact O-N 3.31Å; S81-Q84 VanDerWaalsContact O-N 3.09Å; S81-Q84 PolarHBondContact OG-OE1 3.47Å; S81-R85 PolarHBondContact O-N 3.49Å
82	M	59.6	Low	55.9	Low	168 Å²	168	98.3 Å²	98.3	83%	0.828	58%	0.575	S	S	*	*	H	α-helix	trans	-54.4	-32.3	176	-83	-161.6	-165.7	0	0	113	R85 R86	M82-R85 PolarHBondContact O-N 3.27Å; M82-R86 PolarHBondContact O-N 2.73Å
83	G	63.7	Low	56.4	Low	52 Å²	52	91.9 Å²	91.9	54%	0.536	54%	0.537	S	S	.	.	H	α-helix	trans	-65.1	-42.5	177.9	0	0	0	0	0	112.7	S81 R85 R86 G87	S81-G83 PolarHBondContact O-N 3.42Å; S81-G83 VanDerWaalsContact O-N 3.12Å; G83-R85 PolarHBondContact O-N 3.09Å; G83-R86 PolarHBondContact O-N 3.01Å; G83-G87 PolarHBondContact O-N 3.38Å; G83-G87 VanDerWaalsContact O-N 3.16Å
84	Q	59.6	Low	56.6	Low	101 Å²	101	91.3 Å²	91.3	47%	0.472	53%	0.526	S	S	.	.	H	α-helix	trans	-66.8	-37.7	178.2	-72.3	167.4	-54.9	0	0	111.8	L80 S81 R86 G87 L88	L80-Q84 HydrophobicContact CB-CB 4.48Å; L80-Q84 HydrophobicContact CD2-CB 4.21Å; S81-Q84 PolarHBondContact O-N 3.31Å; S81-Q84 VanDerWaalsContact O-N 3.09Å; S81-Q84 PolarHBondContact OG-OE1 3.47Å; Q84-R86 VanDerWaalsContact C-N 3.34Å; Q84-R86 PolarHBondContact O-N 3.06Å; Q84-G87 PolarHBondContact O-N 2.82Å; Q84-L88 WeakPolarHBondContact O-CD1 3.32Å; Q84-L88 PolarHBondContact O-N 2.82Å; Q84-L88 VanDerWaalsContact O-N 3.15Å
85	R	60.4	Low	57	Low	125 Å²	125	90.3 Å²	90.3	47%	0.472	52%	0.521	S	S	.	.	H	α-helix	trans	-58	-44.2	173.8	-74.4	-177.2	176.2	-117.6	5.7	112.3	S81 M82 G83 L88 I89	S81-R85 PolarHBondContact O-N 3.49Å; M82-R85 PolarHBondContact O-N 3.27Å; G83-R85 PolarHBondContact O-N 3.09Å; R85-L88 PolarHBondContact O-N 3.12Å; R85-I89 WeakPolarHBondContact O-CD1 2.99Å; R85-I89 WeakPolarHBondContact O-CG1 3.35Å; R85-I89 PolarHBondContact O-N 3.5Å
86	R	60.8	Low	57.5	Low	192 Å²	192	89.8 Å²	89.8	73%	0.725	50%	0.503	S	S	*	.	H	α-helix	trans	-66.2	-37.1	177.6	-77.6	-176	172.4	-174.4	-1.6	112.5	M82 G83 Q84 L88 I89 N90	M82-R86 PolarHBondContact O-N 2.73Å; G83-R86 PolarHBondContact O-N 3.01Å; Q84-R86 VanDerWaalsContact C-N 3.34Å; Q84-R86 PolarHBondContact O-N 3.06Å; R86-L88 VanDerWaalsContact C-N 3.34Å; R86-L88 PolarHBondContact O-N 2.97Å; R86-I89 PolarHBondContact O-N 3.5Å; R86-N90 WeakPolarHBondContact O-CB 3.46Å; R86-N90 PolarHBondContact O-N 2.97Å
87	G	61.9	Low	57.6	Low	43 Å²	43	94.3 Å²	94.3	44%	0.443	51%	0.511	S	S	.	.	H	α-helix	trans	-61.3	-40.7	176.1	0	0	0	0	0	113.2	G83 Q84 N90 S91	G83-G87 PolarHBondContact O-N 3.38Å; G83-G87 VanDerWaalsContact O-N 3.16Å; Q84-G87 PolarHBondContact O-N 2.82Å; G87-N90 PolarHBondContact O-N 3.12Å; G87-S91 PolarHBondContact O-N 3.09Å; G87-S91 VanDerWaalsContact O-N 3.09Å
88	L	60.6	Low	58.1	Low	30 Å²	30	96 Å²	96	16%	0.157	51%	0.514	C	S	.	.	H	α-helix	trans	-70.1	-36.3	178	-76	151.2	0	0	0	112.9	L80 Q84 R85 R86 S91 V104	L80-L88 HydrophobicContact CD1-CD1 4.4Å; Q84-L88 WeakPolarHBondContact O-CD1 3.32Å; Q84-L88 PolarHBondContact O-N 2.82Å; Q84-L88 VanDerWaalsContact O-N 3.15Å; R85-L88 PolarHBondContact O-N 3.12Å; R86-L88 VanDerWaalsContact C-N 3.34Å; R86-L88 PolarHBondContact O-N 2.97Å; L88-S91 PolarHBondContact O-OG 2.81Å; L88-S91 VanDerWaalsContact O-OG 3.06Å; L88-V104 HydrophobicContact CB-CG1 4.18Å; L88-V104 HydrophobicContact CB-CG2 4.08Å; L88-V104 HydrophobicContact CD1-CG2 4.29Å; L88-V104 HydrophobicContact CD2-CB 3.88Å; L88-V104 HydrophobicContact CD2-CG1 3.42Å; L88-V104 VanDerWaalsContact CD2-CG1 3.42Å; L88-V104 HydrophobicContact CD2-CG2 4.32Å; L88-V104 HydrophobicContact CG-CG1 4.3Å; L88-V104 HydrophobicContact CG-CG2 4.45Å
89	I	62.3	Low	58	Low	94 Å²	94	95.2 Å²	95.2	48%	0.482	53%	0.525	S	S	.	.	H	α-helix	trans	-67.1	-40.3	175	-65.7	164.7	0	0	0	110.5	R85 R86	R85-I89 WeakPolarHBondContact O-CD1 2.99Å; R85-I89 WeakPolarHBondContact O-CG1 3.35Å; R85-I89 PolarHBondContact O-N 3.5Å; R86-I89 PolarHBondContact O-N 3.5Å
90	N	64.2	Low	57.6	Low	138 Å²	138	100 Å²	100	74%	0.738	53%	0.527	S	S	*	.	H	α-helix	trans	-77.8	-16.5	-178.9	-71.8	-9.7	0	0	0	114	R86 G87 G92	R86-N90 WeakPolarHBondContact O-CB 3.46Å; R86-N90 PolarHBondContact O-N 2.97Å; G87-N90 PolarHBondContact O-N 3.12Å; N90-G92 PolarHBondContact O-N 3.03Å
91	S	64.3	Low	57.1	Low	56 Å²	56	98 Å²	98	39%	0.392	53%	0.525	S	S	.	.	T	Hydrogen-bonded Turn	trans	-78	0.2	179.7	65.8	0	0	0	0	114	G87 L88 A93	G87-S91 PolarHBondContact O-N 3.09Å; G87-S91 VanDerWaalsContact O-N 3.09Å; L88-S91 PolarHBondContact O-OG 2.81Å; L88-S91 VanDerWaalsContact O-OG 3.06Å; S91-A93 PolarHBondContact O-N 3.45Å; S91-A93 VanDerWaalsContact O-N 3.12Å
92	G	59.9	Low	56.4	Low	69 Å²	69	97 Å²	97	71%	0.711	51%	0.513	S	S	*	.	T	Hydrogen-bonded Turn	trans	64.6	13.2	-177	0	0	0	0	0	113.8	N90	N90-G92 PolarHBondContact O-N 3.03Å
93	A	56.9	Low	56	Low	17 Å²	17	91.9 Å²	91.9	14%	0.14	49%	0.492	C	S	.	.			trans	-69.3	140.3	178.3	0	0	0	0	0	109.1	S91 V95 V104	S91-A93 PolarHBondContact O-N 3.45Å; S91-A93 VanDerWaalsContact O-N 3.12Å; A93-V95 WeakPolarHBondContact O-CG2 3.5Å; A93-V95 PolarHBondContact O-N 3.38Å; A93-V104 HydrophobicContact CB-CG1 4.09Å
94	P	53.6	Low	55.4	Low	65 Å²	65	91.4 Å²	91.4	42%	0.422	48%	0.478	S	S	.	.			trans	-60	111.5	178.1	23.7	-31.5	0	0	0	109.7
95	V	53.3	Low	55	Low	41 Å²	41	90.5 Å²	90.5	25%	0.248	48%	0.476	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.5	108.7	175.1	179.7	0	0	0	0	107.7	A93 W97 Q102 V104	A93-V95 WeakPolarHBondContact O-CG2 3.5Å; A93-V95 PolarHBondContact O-N 3.38Å; V95-W97 HydrophobicContact CG1-CZ2 4.28Å; V95-Q102 HydrophobicContact CG1-CG 3.39Å; V95-V104 HydrophobicContact CG2-CG2 4.28Å
96	H	52.1	Low	54.4	Low	119 Å²	119	90 Å²	90	55%	0.551	47%	0.474	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-90.9	115.6	171.8	-82.2	-80	0	0	0	109.7	V103	H96-V103 PolarHBondContact N-O 3.47Å; H96-V103 PolarHBondContact O-N 3.3Å; H96-V103 VanDerWaalsContact O-O 3.1Å
97	W	48.2	Very low	53.9	Low	181 Å²	181	87.3 Å²	87.3	69%	0.686	47%	0.474	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-84	121.8	170.2	-62.3	88.7	0	0	0	108.6	V95 Q102	V95-W97 HydrophobicContact CG1-CZ2 4.28Å; W97-Q102 HydrophobicContact CD2-CG 4.4Å; W97-Q102 HydrophobicContact CE3-CB 3.97Å; W97-Q102 HydrophobicContact CE3-CG 4.28Å; W97-Q102 HydrophobicContact CH2-CB 4.17Å; W97-Q102 HydrophobicContact CH2-CG 4.07Å; W97-Q102 HydrophobicContact CZ2-CG 4.18Å; W97-Q102 HydrophobicContact CZ3-CB 3.78Å; W97-Q102 HydrophobicContact CZ3-CG 4.13Å
98	T	52.9	Low	53.3	Low	68 Å²	68	91.1 Å²	91.1	42%	0.417	48%	0.484	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.5	160.4	168.5	67.1	0	0	0	0	108.8	W100 G101 V103	T98-W100 PolarHBondContact O-N 3.15Å; T98-W100 PolarHBondContact OG1-N 3.22Å; T98-G101 PolarHBondContact N-O 3.06Å; T98-G101 PolarHBondContact O-N 3.3Å; T98-G101 PolarHBondContact OG1-N 3.16Å; T98-G101 PolarHBondContact OG1-O 2.66Å; T98-V103 HydrophobicContact CG2-CG2 4.12Å
99	N	47.2	Very low	52.6	Low	174 Å²	174	93.7 Å²	93.7	93%	0.93	52%	0.518	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56	-3.9	170.8	-92.7	-22.4	0	0	0	113.9
100	W	46.8	Very low	51.6	Low	224 Å²	224	91.6 Å²	91.6	85%	0.848	52%	0.52	S	S	*	.	T	Hydrogen-bonded Turn	trans	-117.9	-1	-173.3	-56.2	65.1	0	0	0	112.4	T98	T98-W100 PolarHBondContact O-N 3.15Å; T98-W100 PolarHBondContact OG1-N 3.22Å
101	G	49.7	Very low	50.4	Low	37 Å²	37	89.6 Å²	89.6	38%	0.381	52%	0.522	S	S	.	.	E	Extended strand (participates in β ladder)	trans	132.5	179.1	-179.1	0	0	0	0	0	114.4	T98	T98-G101 PolarHBondContact N-O 3.06Å; T98-G101 PolarHBondContact O-N 3.3Å; T98-G101 PolarHBondContact OG1-N 3.16Å; T98-G101 PolarHBondContact OG1-O 2.66Å
102	Q	45.9	Very low	49.4	Very low	42 Å²	42	93.9 Å²	93.9	20%	0.196	53%	0.534	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.4	121.5	-179.7	-169.3	-175.9	-3.5	0	0	110	V95 W97 V104	V95-Q102 HydrophobicContact CG1-CG 3.39Å; W97-Q102 HydrophobicContact CD2-CG 4.4Å; W97-Q102 HydrophobicContact CE3-CB 3.97Å; W97-Q102 HydrophobicContact CE3-CG 4.28Å; W97-Q102 HydrophobicContact CH2-CB 4.17Å; W97-Q102 HydrophobicContact CH2-CG 4.07Å; W97-Q102 HydrophobicContact CZ2-CG 4.18Å; W97-Q102 HydrophobicContact CZ3-CB 3.78Å; W97-Q102 HydrophobicContact CZ3-CG 4.13Å; Q102-V104 HydrophobicContact CG-CG2 4.23Å
103	V	51.5	Low	48.4	Very low	62 Å²	62	102.1 Å²	102.1	38%	0.376	54%	0.544	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.4	118.9	170.2	-175.5	0	0	0	0	107.2	H96 T98 I105	H96-V103 PolarHBondContact N-O 3.47Å; H96-V103 PolarHBondContact O-N 3.3Å; H96-V103 VanDerWaalsContact O-O 3.1Å; T98-V103 HydrophobicContact CG2-CG2 4.12Å; V103-I105 HydrophobicContact CG1-CD1 4.31Å; V103-I105 HydrophobicContact CG1-CG1 3.85Å
104	V	50.8	Low	47.9	Very low	42 Å²	42	112.5 Å²	112.5	26%	0.255	60%	0.597	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-102.3	114.2	172.4	-169.1	0	0	0	0	107.8	L88 A93 V95 Q102	L88-V104 HydrophobicContact CB-CG1 4.18Å; L88-V104 HydrophobicContact CB-CG2 4.08Å; L88-V104 HydrophobicContact CD1-CG2 4.29Å; L88-V104 HydrophobicContact CD2-CB 3.88Å; L88-V104 HydrophobicContact CD2-CG1 3.42Å; L88-V104 VanDerWaalsContact CD2-CG1 3.42Å; L88-V104 HydrophobicContact CD2-CG2 4.32Å; L88-V104 HydrophobicContact CG-CG1 4.3Å; L88-V104 HydrophobicContact CG-CG2 4.45Å; A93-V104 HydrophobicContact CB-CG1 4.09Å; V95-V104 HydrophobicContact CG2-CG2 4.28Å; Q102-V104 HydrophobicContact CG-CG2 4.23Å
105	I	52.2	Low	47.6	Very low	82 Å²	82	114.9 Å²	114.9	42%	0.421	61%	0.605	S	S	.	*			trans	-103.4	117.8	176.3	-54.9	177.6	0	0	0	106	V103	V103-I105 HydrophobicContact CG1-CD1 4.31Å; V103-I105 HydrophobicContact CG1-CG1 3.85Å
106	R	46.9	Very low	47.3	Very low	113 Å²	113	118.7 Å²	118.7	43%	0.426	62%	0.624	S	S	.	*			trans	-87.3	122	161.1	-90.5	-172	-174.3	170.4	-0.2	107.2	D108	R106-D108 PolarHBondContact O-N 3.24Å
107	D	50.1	Low	47.1	Very low	137 Å²	137	118.7 Å²	118.7	73%	0.733	63%	0.628	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.5	3	175.5	-80.9	-31.7	0	0	0	112.5
108	D	49.7	Very low	47	Very low	122 Å²	122	115.1 Å²	115.1	65%	0.652	63%	0.625	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95.5	0.8	-161.3	-33.6	-22.5	0	0	0	114	R106 G110	R106-D108 PolarHBondContact O-N 3.24Å; D108-G110 PolarHBondContact O-N 2.91Å
109	G	46	Very low	46.6	Very low	84 Å²	84	118 Å²	118	87%	0.866	64%	0.638	S	S	*	*			trans	58.7	13.1	179.2	0	0	0	0	0	115.4
110	G	42	Very low	46.6	Very low	51 Å²	51	114.3 Å²	114.3	53%	0.526	62%	0.618	S	S	.	*			trans	-88.6	112	-172.7	0	0	0	0	0	113	D108 F112	D108-G110 PolarHBondContact O-N 2.91Å; G110-F112 PolarHBondContact O-N 3.47Å
111	A	37.8	Very low	46.6	Very low	95 Å²	95	106.4 Å²	106.4	79%	0.785	60%	0.602	S	S	*	*			trans	-59	128.6	174.1	0	0	0	0	0	112.1	R113	A111-R113 PolarHBondContact O-N 3.23Å
112	F	43.4	Very low	46.4	Very low	147 Å²	147	111.8 Å²	111.8	65%	0.645	62%	0.619	S	S	*	*			trans	-67.8	113.4	162	-77.4	-89.1	0	0	0	108.2	G110	G110-F112 PolarHBondContact O-N 3.47Å
113	R	39.9	Very low	46.4	Very low	241 Å²	241	117.6 Å²	117.6	91%	0.909	65%	0.654	S	S	*	*			trans	-74.4	135.8	160.1	-82.7	-178.7	160	-163.9	-4.7	108	A111	A111-R113 PolarHBondContact O-N 3.23Å
114	N	46.4	Very low	45.9	Very low	235 Å²	235	122.6 Å²	122.6	100%	1.257	68%	0.679	S	S	*	*			trans	-42	0	-178.9	-79.2	-19.2	0	0	0	114.8

Retrieved 114 of 114 residues in 105.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).