A0A077Z287_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077Z287, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 117 aa.

						>A0A077Z287_TRITR|A0A077Z287
MTKLHHTFFALLLVLPLYLCDAHSPSRSGESRPKPGPNQDPHGNHRPQGGPPPPSGLRVPDNRGPKPNDPPPRPPVPQNPNGQPKPPKGSHPDPHGRPPLSVRVGKGPVTAGVTLNL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60	Low	81.7	Confident	212 Å²	212	123 Å²	123	100%	1.044	62%	0.62	S	S	*	*				0	14.7	0	-65.7	-168.1	177.2	0	0	114.2	H5	M1-H5 PolarHBondContact O-CD2 2.96Å
2	T	68.9	Low	82.6	Confident	97 Å²	97	120.3 Å²	120.3	60%	0.595	61%	0.608	S	S	*	*	H	α-helix	trans	-76.8	-26	-172.5	46.4	0	0	0	0	115.2	L4 H5 H6	T2-L4 VanDerWaalsContact C-N 3.29Å; T2-L4 PolarHBondContact O-N 3.05Å; T2-H5 PolarHBondContact O-N 3.35Å; T2-H6 PolarHBondContact O-N 3.47Å; T2-H6 PolarHBondContact O-ND1 2.79Å
3	K	70.2	Confident	83.4	Confident	180 Å²	180	120.9 Å²	120.9	78%	0.783	61%	0.613	S	S	*	*	H	α-helix	trans	-61.3	-36.7	-176.9	-67.8	-179.3	178	177.5	0	112.9	H6 T7	K3-H6 PolarHBondContact O-N 3.48Å; K3-T7 PolarHBondContact O-N 3.44Å; K3-T7 PolarHBondContact O-OG1 3.43Å
4	L	81.7	Confident	84	Confident	131 Å²	131	118.8 Å²	118.8	69%	0.686	61%	0.609	S	S	*	*	H	α-helix	trans	-68.6	-35.4	179	-173.9	65.5	0	0	0	112.4	T2 T7 F8	T2-L4 VanDerWaalsContact C-N 3.29Å; T2-L4 PolarHBondContact O-N 3.05Å; L4-T7 PolarHBondContact O-OG1 2.74Å; L4-F8 VanDerWaalsContact O-CB 3.27Å; L4-F8 WeakPolarHBondContact O-CB 3.43Å; L4-F8 PolarHBondContact O-N 2.76Å
5	H	85.5	Confident	84.3	Confident	107 Å²	107	117.9 Å²	117.9	50%	0.495	61%	0.605	S	S	.	*	H	α-helix	trans	-65.9	-42.2	177.6	-69.3	-75.9	0	0	0	111.4	M1 T2 T7 F8 F9	M1-H5 PolarHBondContact O-CD2 2.96Å; T2-H5 PolarHBondContact O-N 3.35Å; H5-T7 PolarHBondContact O-N 3.2Å; H5-F8 PolarHBondContact O-N 3.04Å; H5-F9 HydrophobicContact CB-CD2 4.32Å; H5-F9 HydrophobicContact CB-CE2 4.14Å; H5-F9 WeakPolarHBondContact O-CD2 3.34Å; H5-F9 PolarHBondContact O-N 3.32Å
6	H	82.9	Confident	84.6	Confident	135 Å²	135	114.4 Å²	114.4	63%	0.625	59%	0.592	S	S	*	*	H	α-helix	trans	-63.8	-43	-179.8	-69	78.4	0	0	0	111.8	T2 K3 A10	T2-H6 PolarHBondContact O-N 3.47Å; T2-H6 PolarHBondContact O-ND1 2.79Å; K3-H6 PolarHBondContact O-N 3.48Å; H6-A10 WeakPolarHBondContact O-CB 2.8Å; H6-A10 PolarHBondContact O-N 3.46Å
7	T	86.4	Confident	84.7	Confident	81 Å²	81	115.2 Å²	115.2	50%	0.497	60%	0.597	S	S	.	*	H	α-helix	trans	-67.4	-38.5	176.4	54	0	0	0	0	111.8	K3 L4 H5 A10 L11	K3-T7 PolarHBondContact O-N 3.44Å; K3-T7 PolarHBondContact O-OG1 3.43Å; L4-T7 PolarHBondContact O-OG1 2.74Å; H5-T7 PolarHBondContact O-N 3.2Å; T7-A10 PolarHBondContact O-N 2.96Å; T7-L11 WeakPolarHBondContact O-CG 3.17Å; T7-L11 PolarHBondContact O-N 3.23Å
8	F	89.4	Confident	84.8	Confident	116 Å²	116	117.4 Å²	117.4	51%	0.509	60%	0.598	S	S	.	*	H	α-helix	trans	-62.8	-46.5	175.9	-174.8	-104.5	0	0	0	112.1	L4 H5 L11 L12	L4-F8 VanDerWaalsContact O-CB 3.27Å; L4-F8 WeakPolarHBondContact O-CB 3.43Å; L4-F8 PolarHBondContact O-N 2.76Å; H5-F8 PolarHBondContact O-N 3.04Å; F8-L11 PolarHBondContact O-N 3.09Å; F8-L12 HydrophobicContact CD1-CD1 3.85Å; F8-L12 HydrophobicContact CD1-CG 4.41Å; F8-L12 HydrophobicContact CE1-CD1 3.42Å; F8-L12 VanDerWaalsContact CE1-CD1 3.42Å; F8-L12 HydrophobicContact CE1-CG 4.12Å; F8-L12 HydrophobicContact CZ-CD1 3.99Å; F8-L12 HydrophobicContact CZ-CG 4.32Å; F8-L12 WeakPolarHBondContact O-CG 3.39Å; F8-L12 PolarHBondContact O-N 3.13Å
9	F	89.9	Confident	84.8	Confident	122 Å²	122	115.5 Å²	115.5	54%	0.535	59%	0.588	S	S	.	*	H	α-helix	trans	-65.3	-38.4	175.2	-72.4	-61	0	0	0	112.4	H5 L11 L12 L13	H5-F9 HydrophobicContact CB-CD2 4.32Å; H5-F9 HydrophobicContact CB-CE2 4.14Å; H5-F9 WeakPolarHBondContact O-CD2 3.34Å; H5-F9 PolarHBondContact O-N 3.32Å; F9-L11 VanDerWaalsContact C-N 3.33Å; F9-L11 PolarHBondContact O-N 2.88Å; F9-L12 HydrophobicContact CD1-CD1 4.4Å; F9-L12 PolarHBondContact O-N 3.05Å; F9-L13 WeakPolarHBondContact O-CG 3.47Å; F9-L13 PolarHBondContact O-N 2.84Å
10	A	91.8	Very high	84.6	Confident	51 Å²	51	114.1 Å²	114.1	42%	0.421	59%	0.588	S	S	.	*	H	α-helix	trans	-60.3	-43.7	174.7	0	0	0	0	0	111.6	H6 T7 L13 V14	H6-A10 WeakPolarHBondContact O-CB 2.8Å; H6-A10 PolarHBondContact O-N 3.46Å; T7-A10 PolarHBondContact O-N 2.96Å; A10-L13 PolarHBondContact O-N 3.27Å; A10-V14 WeakPolarHBondContact O-CB 3.42Å; A10-V14 VanDerWaalsContact O-CG2 3.26Å; A10-V14 WeakPolarHBondContact O-CG2 3.5Å; A10-V14 PolarHBondContact O-N 3.35Å
11	L	92.2	Very high	83.9	Confident	121 Å²	121	114.7 Å²	114.7	63%	0.634	59%	0.593	S	S	*	*	H	α-helix	trans	-64.9	-41.5	175.4	-71	171.6	0	0	0	112	T7 F8 F9 L13 V14 L15	T7-L11 WeakPolarHBondContact O-CG 3.17Å; T7-L11 PolarHBondContact O-N 3.23Å; F8-L11 PolarHBondContact O-N 3.09Å; F9-L11 VanDerWaalsContact C-N 3.33Å; F9-L11 PolarHBondContact O-N 2.88Å; L11-L13 PolarHBondContact O-N 3.18Å; L11-V14 PolarHBondContact O-N 3.27Å; L11-L15 WeakPolarHBondContact O-CB 2.9Å; L11-L15 PolarHBondContact O-N 3.29Å
12	L	92.7	Very high	84.2	Confident	91 Å²	91	107.7 Å²	107.7	48%	0.476	57%	0.569	S	S	.	*	H	α-helix	trans	-63.6	-26	175.5	-76.1	-179.3	0	0	0	113.6	F8 F9 P16	F8-L12 HydrophobicContact CD1-CD1 3.85Å; F8-L12 HydrophobicContact CD1-CG 4.41Å; F8-L12 HydrophobicContact CE1-CD1 3.42Å; F8-L12 VanDerWaalsContact CE1-CD1 3.42Å; F8-L12 HydrophobicContact CE1-CG 4.12Å; F8-L12 HydrophobicContact CZ-CD1 3.99Å; F8-L12 HydrophobicContact CZ-CG 4.32Å; F8-L12 WeakPolarHBondContact O-CG 3.39Å; F8-L12 PolarHBondContact O-N 3.13Å; F9-L12 HydrophobicContact CD1-CD1 4.4Å; F9-L12 PolarHBondContact O-N 3.05Å; L12-P16 WeakPolarHBondContact O-CD 3.39Å; L12-P16 WeakPolarHBondContact O-CG 3.5Å
13	L	92	Very high	83.9	Confident	128 Å²	128	109.6 Å²	109.6	67%	0.67	57%	0.57	S	S	*	*	H	α-helix	trans	-86	-41.9	175.8	-70.4	173.1	0	0	0	112.2	F9 A10 L11 P16 L17	F9-L13 WeakPolarHBondContact O-CG 3.47Å; F9-L13 PolarHBondContact O-N 2.84Å; A10-L13 PolarHBondContact O-N 3.27Å; L11-L13 PolarHBondContact O-N 3.18Å; L13-P16 WeakPolarHBondContact O-CD 3.28Å; L13-P16 WeakPolarHBondContact O-CG 3.39Å; L13-L17 WeakPolarHBondContact O-CB 3.28Å
14	V	91.7	Very high	82.9	Confident	91 Å²	91	104.6 Å²	104.6	55%	0.552	56%	0.558	S	S	*	*	H	α-helix	trans	-71.7	-40.7	-177.2	172.5	0	0	0	0	111.6	A10 L11 L17 Y18	A10-V14 WeakPolarHBondContact O-CB 3.42Å; A10-V14 VanDerWaalsContact O-CG2 3.26Å; A10-V14 WeakPolarHBondContact O-CG2 3.5Å; A10-V14 PolarHBondContact O-N 3.35Å; L11-V14 PolarHBondContact O-N 3.27Å; V14-L17 PolarHBondContact O-N 2.98Å; V14-Y18 VanDerWaalsContact O-CB 3.28Å; V14-Y18 WeakPolarHBondContact O-CB 3.2Å; V14-Y18 PolarHBondContact O-N 3.45Å
15	L	89.5	Confident	81.5	Confident	106 Å²	106	103.5 Å²	103.5	56%	0.555	56%	0.559	S	S	*	*	H	α-helix	trans	-60.7	-50.2	-176.5	-171.3	64.9	0	0	0	114	L11 Y18 L19	L11-L15 WeakPolarHBondContact O-CB 2.9Å; L11-L15 PolarHBondContact O-N 3.29Å; L15-Y18 PolarHBondContact O-N 3.29Å; L15-L19 HydrophobicContact CD1-CD1 4.44Å; L15-L19 HydrophobicContact CG-CD1 4.06Å; L15-L19 WeakPolarHBondContact O-CB 3.46Å; L15-L19 WeakPolarHBondContact O-CD1 3.06Å; L15-L19 WeakPolarHBondContact O-CG 3.47Å; L15-L19 PolarHBondContact O-N 3.42Å
16	P	89.2	Confident	79.7	Confident	61 Å²	61	103.9 Å²	103.9	40%	0.396	57%	0.573	S	S	.	*	H	α-helix	trans	-67.8	-34.8	176.7	26.3	-34.1	0	0	0	112.1	L12 L13 L19 C20	L12-P16 WeakPolarHBondContact O-CD 3.39Å; L12-P16 WeakPolarHBondContact O-CG 3.5Å; L13-P16 WeakPolarHBondContact O-CD 3.28Å; L13-P16 WeakPolarHBondContact O-CG 3.39Å; P16-L19 PolarHBondContact O-N 3.27Å; P16-C20 WeakPolarHBondContact O-CB 3.26Å; P16-C20 PolarHBondContact O-N 3.14Å; P16-C20 PolarHBondContact O-SG 2.79Å
17	L	86.4	Confident	78	Confident	129 Å²	129	108.9 Å²	108.9	68%	0.675	59%	0.587	S	S	*	*	H	α-helix	trans	-63.4	-43.7	175.5	-173.7	64.8	0	0	0	111.2	L13 V14 C20 D21	L13-L17 WeakPolarHBondContact O-CB 3.28Å; V14-L17 PolarHBondContact O-N 2.98Å; L17-C20 PolarHBondContact O-N 2.96Å; L17-D21 PolarHBondContact O-N 3.21Å
18	Y	86	Confident	76.1	Confident	155 Å²	155	109.6 Å²	109.6	61%	0.608	60%	0.595	S	S	*	*	H	α-helix	trans	-63.8	-42	175.3	179.8	-100.8	0	0	0	112.1	V14 L15 D21 A22	V14-Y18 VanDerWaalsContact O-CB 3.28Å; V14-Y18 WeakPolarHBondContact O-CB 3.2Å; V14-Y18 PolarHBondContact O-N 3.45Å; L15-Y18 PolarHBondContact O-N 3.29Å; Y18-D21 PolarHBondContact O-N 2.82Å; Y18-A22 VanDerWaalsContact O-CB 3.28Å; Y18-A22 WeakPolarHBondContact O-CB 3.36Å; Y18-A22 PolarHBondContact O-N 3.35Å
19	L	83.9	Confident	74.4	Confident	80 Å²	80	107.9 Å²	107.9	42%	0.419	61%	0.611	S	S	.	*	H	α-helix	trans	-62.6	-44.4	173.6	-78.6	155.3	0	0	0	111.1	L15 P16 D21 A22 H23	L15-L19 HydrophobicContact CD1-CD1 4.44Å; L15-L19 HydrophobicContact CG-CD1 4.06Å; L15-L19 WeakPolarHBondContact O-CB 3.46Å; L15-L19 WeakPolarHBondContact O-CD1 3.06Å; L15-L19 WeakPolarHBondContact O-CG 3.47Å; L15-L19 PolarHBondContact O-N 3.42Å; P16-L19 PolarHBondContact O-N 3.27Å; L19-D21 VanDerWaalsContact C-N 3.31Å; L19-D21 PolarHBondContact O-N 3.32Å; L19-A22 PolarHBondContact O-N 2.83Å; L19-H23 WeakPolarHBondContact O-CB 3.44Å; L19-H23 PolarHBondContact O-CD2 3.05Å; L19-H23 PolarHBondContact O-N 3.45Å
20	C	81.2	Confident	72.5	Confident	88 Å²	88	111.2 Å²	111.2	60%	0.595	63%	0.628	S	S	*	*	H	α-helix	trans	-61.3	-38.9	177.1	-73.2	0	0	0	0	112.5	P16 L17 H23 S24	P16-C20 WeakPolarHBondContact O-CB 3.26Å; P16-C20 PolarHBondContact O-N 3.14Å; P16-C20 PolarHBondContact O-SG 2.79Å; L17-C20 PolarHBondContact O-N 2.96Å; C20-H23 CarbonylContact O-C 3.46Å; C20-S24 PolarHBondContact O-N 3.4Å
21	D	70.4	Confident	70.7	Confident	127 Å²	127	113.1 Å²	113.1	68%	0.679	64%	0.638	S	S	*	*	H	α-helix	trans	-72.1	-46.3	178.2	-167	48.8	0	0	0	111.6	L17 Y18 L19 H23 S24	L17-D21 PolarHBondContact O-N 3.21Å; Y18-D21 PolarHBondContact O-N 2.82Å; L19-D21 VanDerWaalsContact C-N 3.31Å; L19-D21 PolarHBondContact O-N 3.32Å; D21-H23 VanDerWaalsContact C-N 3.27Å; D21-H23 PolarHBondContact O-N 2.89Å; D21-S24 PolarHBondContact O-N 3.38Å; D21-S24 VanDerWaalsContact O-N 3.13Å
22	A	65.9	Low	68.7	Low	65 Å²	65	118.5 Å²	118.5	54%	0.537	65%	0.65	S	S	.	*	H	α-helix	trans	-65.3	-30.3	176.5	0	0	0	0	0	113	Y18 L19	Y18-A22 VanDerWaalsContact O-CB 3.28Å; Y18-A22 WeakPolarHBondContact O-CB 3.36Å; Y18-A22 PolarHBondContact O-N 3.35Å; L19-A22 PolarHBondContact O-N 2.83Å
23	H	63.3	Low	67.1	Low	136 Å²	136	119.9 Å²	119.9	63%	0.63	66%	0.664	S	S	*	*	T	Hydrogen-bonded Turn	trans	-99.2	20	175.2	-65.8	-76.7	0	0	0	113.1	L19 C20 D21 P25	L19-H23 WeakPolarHBondContact O-CB 3.44Å; L19-H23 PolarHBondContact O-CD2 3.05Å; L19-H23 PolarHBondContact O-N 3.45Å; C20-H23 CarbonylContact O-C 3.46Å; D21-H23 VanDerWaalsContact C-N 3.27Å; D21-H23 PolarHBondContact O-N 2.89Å; H23-P25 WeakPolarHBondContact O-CD 2.99Å
24	S	47.9	Very low	65.6	Low	75 Å²	75	122.8 Å²	122.8	52%	0.524	67%	0.671	S	S	.	*			trans	-89.5	84.6	158.5	-171.6	0	0	0	0	107.5	C20 D21 S26	C20-S24 PolarHBondContact O-N 3.4Å; D21-S24 PolarHBondContact O-N 3.38Å; D21-S24 VanDerWaalsContact O-N 3.13Å; S24-S26 PolarHBondContact O-N 2.99Å
25	P	52.3	Low	64.1	Low	108 Å²	108	124.1 Å²	124.1	70%	0.701	68%	0.682	S	S	*	*			trans	-59.5	107.6	170.8	24.8	-32	0	0	0	106.8	H23 R27	H23-P25 WeakPolarHBondContact O-CD 2.99Å; P25-R27 PolarHBondContact O-N 3.47Å
26	S	47.6	Very low	62.8	Low	115 Å²	115	122 Å²	122	80%	0.804	69%	0.686	S	S	*	*			trans	-1.7	90.5	159.5	-159.4	0	0	0	0	111	S24 S28	S24-S26 PolarHBondContact O-N 2.99Å; S26-S28 VanDerWaalsContact C-N 3.31Å; S26-S28 PolarHBondContact O-N 3.08Å
27	R	48.3	Very low	61.1	Low	240 Å²	240	124.7 Å²	124.7	91%	0.906	70%	0.703	S	S	*	*			trans	-61.6	100.4	177.8	-92.2	-171.8	173.9	-150.5	0.9	107	P25	P25-R27 PolarHBondContact O-N 3.47Å
28	S	46.8	Very low	59.4	Low	97 Å²	97	126.1 Å²	126.1	68%	0.678	71%	0.711	S	S	*	*	S	Bend	trans	61.6	59.3	143.2	176.4	0	0	0	0	115.3	S26	S26-S28 VanDerWaalsContact C-N 3.31Å; S26-S28 PolarHBondContact O-N 3.08Å
29	G	52.7	Low	57.5	Low	80 Å²	80	128 Å²	128	83%	0.825	73%	0.726	S	S	*	*	S	Bend	trans	-91.3	-6.4	159.8	0	0	0	0	0	114.2
30	E	51.2	Low	55.8	Low	192 Å²	192	131.9 Å²	131.9	90%	0.897	75%	0.747	S	S	*	*	S	Bend	trans	-124.6	65.6	-162.5	-160.6	165.8	110.4	0	0	110.7
31	S	52.6	Low	54.2	Low	90 Å²	90	132.2 Å²	132.2	63%	0.629	75%	0.748	S	S	*	*	S	Bend	trans	-163.3	13.9	170.5	57.9	0	0	0	0	116.5
32	R	51.1	Low	53.3	Low	235 Å²	235	134.6 Å²	134.6	89%	0.887	75%	0.754	S	S	*	*			trans	-126.6	112.2	167.1	-77.9	-169	177	-172.7	-0.5	111.4	K34	R32-K34 PolarHBondContact O-N 3.49Å
33	P	58.7	Low	52.3	Low	119 Å²	119	135.2 Å²	135.2	77%	0.773	77%	0.768	S	S	*	*	P	Polyproline II helix	trans	-52.8	125.5	156.7	-11.4	23.6	0	0	0	106.9	P35	P33-P35 WeakPolarHBondContact O-CD 3.33Å
34	K	59.9	Low	51.7	Low	189 Å²	189	135.3 Å²	135.3	82%	0.822	77%	0.773	S	S	*	*	P	Polyproline II helix	trans	-56.1	121	167.4	-170.6	169	-177.2	176.6	0	106.7	R32 G36	R32-K34 PolarHBondContact O-N 3.49Å; K34-G36 PolarHBondContact O-N 3.46Å
35	P	60.8	Low	51.9	Low	120 Å²	120	140.2 Å²	140.2	78%	0.779	79%	0.787	S	S	*	*	P	Polyproline II helix	trans	-55.4	119.5	169.1	-18.9	30.2	0	0	0	106.8	P33	P33-P35 WeakPolarHBondContact O-CD 3.33Å
36	G	61.7	Low	51.8	Low	62 Å²	62	145.8 Å²	145.8	64%	0.639	79%	0.794	S	S	*	*	P	Polyproline II helix	trans	-58.7	140.4	179.3	0	0	0	0	0	109.9	K34	K34-G36 PolarHBondContact O-N 3.46Å
37	P	55.1	Low	52.3	Low	116 Å²	116	146 Å²	146	75%	0.753	79%	0.793	S	S	*	*	S	Bend	trans	-71.6	138	168	31.9	-29.5	0	0	0	107.9
38	N	50.3	Low	52.5	Low	159 Å²	159	143.1 Å²	143.1	85%	0.85	79%	0.789	S	S	*	*			trans	87.2	64	175.7	-64.9	-20.5	0	0	0	119.1
39	Q	46.6	Very low	52.4	Low	196 Å²	196	142.2 Å²	142.2	92%	0.916	80%	0.796	S	S	*	*			trans	-139.8	80.8	145	-70.1	-164.1	-1.2	0	0	110.9
40	D	47.4	Very low	52.9	Low	160 Å²	160	141.7 Å²	141.7	86%	0.856	79%	0.79	S	S	*	*			trans	-95.4	154.6	144	-86.3	-72.1	0	0	0	106.5
41	P	47.6	Very low	54.1	Low	95 Å²	95	138.3 Å²	138.3	62%	0.617	79%	0.785	S	S	*	*	S	Bend	cis	-130.1	174.2	10.4	25.9	-1.5	0	0	0	112.6
42	H	51.3	Low	55	Low	177 Å²	177	139.6 Å²	139.6	82%	0.819	79%	0.791	S	S	*	*			trans	84.6	60.7	170.5	-45.8	-70.7	0	0	0	117.6
43	G	46	Very low	55.9	Low	79 Å²	79	133.7 Å²	133.7	81%	0.814	78%	0.783	S	S	*	*			trans	-120.3	83.9	162.7	0	0	0	0	0	111.1
44	N	49.3	Very low	56.5	Low	137 Å²	137	133.9 Å²	133.9	73%	0.733	79%	0.785	S	S	*	*			trans	-58.9	160.5	171	-71.2	-27.6	0	0	0	110.8
45	H	53.4	Low	56.6	Low	179 Å²	179	131.3 Å²	131.3	83%	0.829	79%	0.79	S	S	*	*			trans	96.6	65.5	174.4	-43.7	-61.2	0	0	0	116.3	P47	H45-P47 WeakPolarHBondContact O-CD 3.27Å
46	R	48.7	Very low	56.3	Low	225 Å²	225	128.7 Å²	128.7	85%	0.849	79%	0.785	S	S	*	*	P	Polyproline II helix	trans	-80	118.7	147.1	175.5	179.8	-178	161.9	0.4	108.8
47	P	58.3	Low	55.9	Low	119 Å²	119	133.6 Å²	133.6	77%	0.773	80%	0.796	S	S	*	*	P	Polyproline II helix	trans	-76.4	125.6	152.3	-5.3	22.9	0	0	0	108.3	H45	H45-P47 WeakPolarHBondContact O-CD 3.27Å
48	Q	52.8	Low	55.7	Low	179 Å²	179	139.9 Å²	139.9	84%	0.836	80%	0.804	S	S	*	*	P	Polyproline II helix	trans	-61.3	153.2	167.1	-67.7	175.4	-34	0	0	110.7
49	G	45.5	Very low	56.1	Low	79 Å²	79	138.3 Å²	138.3	81%	0.814	80%	0.8	S	S	*	*			trans	124.1	22.9	144.3	0	0	0	0	0	120.3
50	G	63.2	Low	56.9	Low	69 Å²	69	133.9 Å²	133.9	71%	0.711	79%	0.788	S	S	*	*	P	Polyproline II helix	trans	-95.5	136.3	168.7	0	0	0	0	0	112.5
51	P	74.9	Confident	57.5	Low	120 Å²	120	131.8 Å²	131.8	78%	0.779	78%	0.777	S	S	*	*	P	Polyproline II helix	trans	-61.5	148.2	170	26.5	-32.7	0	0	0	110.5
52	P	72.6	Confident	57.6	Low	118 Å²	118	134.6 Å²	134.6	77%	0.766	79%	0.787	S	S	*	*	P	Polyproline II helix	trans	-62.1	142.4	175.8	27	-33.4	0	0	0	109.9
53	P	69.2	Low	57.7	Low	111 Å²	111	136.2 Å²	136.2	72%	0.721	79%	0.786	S	S	*	*	P	Polyproline II helix	trans	-61.1	147.2	170.5	26.9	-33.2	0	0	0	109.8	S55	P53-S55 PolarHBondContact O-N 3.36Å
54	P	72	Confident	57.9	Low	123 Å²	123	135.2 Å²	135.2	80%	0.799	78%	0.776	S	S	*	*	P	Polyproline II helix	trans	-57.9	133.9	177.1	23.3	-31.9	0	0	0	110	G56	P54-G56 PolarHBondContact O-N 3.17Å
55	S	62.6	Low	58.4	Low	135 Å²	135	134.8 Å²	134.8	94%	0.944	78%	0.78	S	S	*	*			trans	-65	74.1	173.7	-63.7	0	0	0	0	110.5	P53 L57	P53-S55 PolarHBondContact O-N 3.36Å; S55-L57 PolarHBondContact O-N 3.31Å
56	G	54.2	Low	58.6	Low	64 Å²	64	136.1 Å²	136.1	66%	0.66	78%	0.783	S	S	*	*			trans	-78	116.2	175.7	0	0	0	0	0	110.6	P54 R58	P54-G56 PolarHBondContact O-N 3.17Å; G56-R58 PolarHBondContact O-N 2.9Å
57	L	52.9	Low	59	Low	166 Å²	166	130.3 Å²	130.3	87%	0.869	78%	0.775	S	S	*	*			trans	16.2	98.6	159.6	-57.9	173.7	0	0	0	115.6	S55 V59	S55-L57 PolarHBondContact O-N 3.31Å; L57-V59 PolarHBondContact O-N 3.41Å
58	R	50.8	Low	58.8	Low	248 Å²	248	131.9 Å²	131.9	94%	0.936	78%	0.777	S	S	*	*			trans	-60.4	104.3	165.6	-75.5	-171.4	175.2	-171.6	-0.4	108.8	G56	G56-R58 PolarHBondContact O-N 2.9Å
59	V	58.4	Low	59.4	Low	125 Å²	125	131 Å²	131	76%	0.758	78%	0.778	S	S	*	*			trans	-64	130.6	163.2	-177.9	0	0	0	0	107.2	L57 D61	L57-V59 PolarHBondContact O-N 3.41Å; V59-D61 PolarHBondContact O-N 3.35Å; V59-D61 VanDerWaalsContact O-N 3.14Å
60	P	64.4	Low	60.6	Low	103 Å²	103	132.4 Å²	132.4	67%	0.669	77%	0.773	S	S	*	*			trans	-63.2	117.1	176.4	22.6	-29.7	0	0	0	109.9	N62	P60-N62 VanDerWaalsContact C-N 3.33Å; P60-N62 PolarHBondContact O-N 3.4Å
61	D	59.4	Low	60.9	Low	116 Å²	116	134.6 Å²	134.6	62%	0.62	77%	0.774	S	S	*	*			trans	-69.3	89.1	173.7	-164.5	10.5	0	0	0	107.6	V59 R63	V59-D61 PolarHBondContact O-N 3.35Å; V59-D61 VanDerWaalsContact O-N 3.14Å; D61-R63 PolarHBondContact O-N 3.34Å; D61-R63 IonicContact OD2-CZ 3.6Å; D61-R63 IonicContact OD2-NE 3.09Å; D61-R63 PolarHBondContact OD2-NE 2.93Å; D61-R63 VanDerWaalsContact OD2-NE 3.09Å; D61-R63 IonicContact OD2-NH2 3.23Å; D61-R63 PolarHBondContact OD2-NH2 2.98Å
62	N	50.1	Low	61	Low	155 Å²	155	134.8 Å²	134.8	83%	0.829	78%	0.776	S	S	*	*			trans	-65	77.1	173.8	-93.4	-8.1	0	0	0	109.7	P60 G64	P60-N62 VanDerWaalsContact C-N 3.33Å; P60-N62 PolarHBondContact O-N 3.4Å; N62-G64 PolarHBondContact O-N 2.85Å
63	R	52	Low	61.1	Low	211 Å²	211	140.7 Å²	140.7	80%	0.796	78%	0.783	S	S	*	*			trans	-73.6	73.9	168.2	-66	-175.8	-171.9	174.1	2.5	109.6	D61	D61-R63 PolarHBondContact O-N 3.34Å; D61-R63 IonicContact OD2-CZ 3.6Å; D61-R63 IonicContact OD2-NE 3.09Å; D61-R63 PolarHBondContact OD2-NE 2.93Å; D61-R63 VanDerWaalsContact OD2-NE 3.09Å; D61-R63 IonicContact OD2-NH2 3.23Å; D61-R63 PolarHBondContact OD2-NH2 2.98Å
64	G	51.4	Low	61.3	Low	58 Å²	58	140.4 Å²	140.4	60%	0.598	78%	0.781	S	S	*	*	P	Polyproline II helix	trans	-67	148.3	161.2	0	0	0	0	0	110.4	N62 K66	N62-G64 PolarHBondContact O-N 2.85Å; G64-K66 PolarHBondContact O-N 3.32Å
65	P	60.5	Low	61.5	Low	127 Å²	127	140.5 Å²	140.5	83%	0.825	78%	0.782	S	S	*	*	P	Polyproline II helix	trans	-65.3	129.6	177.6	26.9	-31.8	0	0	0	110	P67	P65-P67 WeakPolarHBondContact O-CD 3.37Å
66	K	56.8	Low	62.1	Low	207 Å²	207	140.1 Å²	140.1	90%	0.9	77%	0.773	S	S	*	*	P	Polyproline II helix	trans	-69.5	122.3	177.4	-127.4	173.8	-177.4	179.4	0	109.1	G64	G64-K66 PolarHBondContact O-N 3.32Å
67	P	56.7	Low	62.9	Low	104 Å²	104	142.9 Å²	142.9	68%	0.675	78%	0.779	S	S	*	*	P	Polyproline II helix	trans	-77.3	129.7	177.5	-7.9	24.4	0	0	0	111.1	P65	P65-P67 WeakPolarHBondContact O-CD 3.37Å
68	N	55.1	Low	63.2	Low	151 Å²	151	143.8 Å²	143.8	81%	0.807	78%	0.779	S	S	*	*			trans	62.2	92.7	146.7	-52.9	-30.9	0	0	0	117.8
69	D	64.7	Low	63.4	Low	161 Å²	161	136.1 Å²	136.1	86%	0.861	76%	0.757	S	S	*	*	P	Polyproline II helix	trans	-59.8	138.3	156.4	-76.4	-56.4	0	0	0	110.4
70	P	70.6	Confident	63.7	Low	109 Å²	109	136 Å²	136	71%	0.708	76%	0.759	S	S	*	*	P	Polyproline II helix	trans	-66.7	146.4	173.3	28.2	-32.9	0	0	0	110.3
71	P	70.2	Confident	63.5	Low	114 Å²	114	137.4 Å²	137.4	74%	0.74	76%	0.761	S	S	*	*	P	Polyproline II helix	trans	-61.5	150.1	178.6	25.7	-33.4	0	0	0	111.2	R73	P71-R73 PolarHBondContact O-N 3.27Å
72	P	75.5	Confident	63.4	Low	124 Å²	124	135.4 Å²	135.4	81%	0.805	77%	0.767	S	S	*	*	P	Polyproline II helix	trans	-58.5	138.6	178.8	23	-32	0	0	0	110.8
73	R	75.2	Confident	63.6	Low	242 Å²	242	135.3 Å²	135.3	91%	0.913	76%	0.762	S	S	*	*	P	Polyproline II helix	trans	-65.1	143	177	-85.5	-176.3	-170.5	-125.9	-0	110.7	P71	P71-R73 PolarHBondContact O-N 3.27Å
74	P	74.3	Confident	63.9	Low	105 Å²	105	130.9 Å²	130.9	68%	0.682	76%	0.76	S	S	*	*	P	Polyproline II helix	trans	-66.9	153.4	172.4	29	-33.1	0	0	0	110.8	V76	P74-V76 PolarHBondContact O-N 3.26Å
75	P	75.8	Confident	64.4	Low	126 Å²	126	137 Å²	137	82%	0.818	77%	0.77	S	S	*	*	P	Polyproline II helix	trans	-63.5	135.4	177.9	25.2	-32.4	0	0	0	110.9
76	V	74.8	Confident	64.6	Low	126 Å²	126	136.1 Å²	136.1	76%	0.764	77%	0.765	S	S	*	*	P	Polyproline II helix	trans	-78	132.4	176.1	-178.4	0	0	0	0	108.6	P74 Q78	P74-V76 PolarHBondContact O-N 3.26Å; V76-Q78 PolarHBondContact O-N 2.95Å
77	P	70.9	Confident	64.9	Low	122 Å²	122	132 Å²	132	79%	0.792	76%	0.759	S	S	*	*	P	Polyproline II helix	trans	-60.2	119.9	174.5	-19.9	31	0	0	0	110.3	N79	P77-N79 PolarHBondContact O-N 2.96Å
78	Q	59.3	Low	64.6	Low	186 Å²	186	137.7 Å²	137.7	87%	0.869	77%	0.773	S	S	*	*	P	Polyproline II helix	trans	-74.6	123.2	172	-76.6	-178.4	-25.4	0	0	109.3	V76	V76-Q78 PolarHBondContact O-N 2.95Å
79	N	55.4	Low	64.2	Low	87 Å²	87	133.6 Å²	133.6	47%	0.465	77%	0.767	S	S	.	*	P	Polyproline II helix	trans	-68.3	123.3	168	-178.5	1.3	0	0	0	108.5	P77 N81 G82	P77-N79 PolarHBondContact O-N 2.96Å; N79-N81 PolarHBondContact O-N 2.93Å; N79-N81 PolarHBondContact OD1-N 3.43Å; N79-G82 PolarHBondContact O-N 2.89Å
80	P	64.8	Low	63.6	Low	122 Å²	122	131.2 Å²	131.2	79%	0.792	76%	0.763	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.9	-10.7	-176.7	21.5	-32.2	0	0	0	114.8
81	N	60.4	Low	62.8	Low	133 Å²	133	134.1 Å²	134.1	71%	0.711	77%	0.767	S	S	*	*	T	Hydrogen-bonded Turn	trans	-102.2	6.2	-177.7	-81.6	13.3	0	0	0	115.8	N79 Q83	N79-N81 PolarHBondContact O-N 2.93Å; N79-N81 PolarHBondContact OD1-N 3.43Å; N81-Q83 PolarHBondContact O-N 3.46Å
82	G	56.6	Low	62.1	Low	74 Å²	74	133.8 Å²	133.8	76%	0.763	77%	0.765	S	S	*	*			trans	60.9	-0.9	170.9	0	0	0	0	0	117.3	N79	N79-G82 PolarHBondContact O-N 2.89Å
83	Q	55.2	Low	61.1	Low	152 Å²	152	133.4 Å²	133.4	71%	0.71	76%	0.756	S	S	*	*	P	Polyproline II helix	trans	-103.7	130.9	179.5	-75.2	-150.8	-22.6	0	0	111.9	N81 K85	N81-Q83 PolarHBondContact O-N 3.46Å; Q83-K85 PolarHBondContact O-N 3.32Å
84	P	58.5	Low	60.4	Low	118 Å²	118	127.2 Å²	127.2	77%	0.766	75%	0.747	S	S	*	*	P	Polyproline II helix	trans	-65.4	121.2	164.7	26.6	-28.4	0	0	0	108.1
85	K	60.5	Low	59.7	Low	186 Å²	186	130.7 Å²	130.7	81%	0.809	75%	0.754	S	S	*	*	P	Polyproline II helix	trans	-62.4	126.1	169.5	-89.6	177.8	175	173.3	0	108	Q83	Q83-K85 PolarHBondContact O-N 3.32Å
86	P	64.4	Low	58.5	Low	109 Å²	109	127 Å²	127	71%	0.708	74%	0.739	S	S	*	*	P	Polyproline II helix	trans	-63.5	142.6	166.8	26.7	-30.6	0	0	0	108.5	K88	P86-K88 PolarHBondContact O-N 2.97Å
87	P	65.2	Low	57.6	Low	121 Å²	121	131.7 Å²	131.7	79%	0.786	74%	0.743	S	S	*	*	P	Polyproline II helix	trans	-60.4	130.2	173.9	25.5	-31.3	0	0	0	108.9	G89	P87-G89 PolarHBondContact O-N 2.92Å
88	K	49.7	Very low	56.9	Low	223 Å²	223	131.4 Å²	131.4	97%	0.97	74%	0.741	S	S	*	*			trans	-77.7	113.8	174.6	-128.2	177.8	-179.3	-177.5	0	107.3	P86	P86-K88 PolarHBondContact O-N 2.97Å
89	G	47	Very low	57	Low	66 Å²	66	126 Å²	126	68%	0.68	72%	0.722	S	S	*	*			trans	114.6	136.6	179.2	0	0	0	0	0	110.8	P87	P87-G89 PolarHBondContact O-N 2.92Å
90	S	52	Low	57.2	Low	110 Å²	110	127.5 Å²	127.5	77%	0.769	73%	0.729	S	S	*	*			cis	-154.8	147.3	26.1	34.5	0	0	0	0	109.5
91	H	53.8	Low	56.8	Low	170 Å²	170	125.7 Å²	125.7	79%	0.787	72%	0.719	S	S	*	*	P	Polyproline II helix	trans	-53.2	135.8	173.6	-159.5	-73.8	0	0	0	110.3	D93	H91-D93 PolarHBondContact O-N 3.37Å
92	P	54.8	Low	57	Low	108 Å²	108	123.3 Å²	123.3	70%	0.701	71%	0.71	S	S	*	*	P	Polyproline II helix	trans	-68.1	125.3	172.7	28.1	-30.7	0	0	0	108.2
93	D	54.1	Low	57.2	Low	116 Å²	116	129.1 Å²	129.1	62%	0.62	71%	0.708	S	S	*	*	P	Polyproline II helix	trans	-69.3	123.1	171.8	-159.5	-45.4	0	0	0	108.1	H91 H95 G96	H91-D93 PolarHBondContact O-N 3.37Å; D93-H95 PolarHBondContact O-N 2.99Å; D93-H95 PolarHBondContact OD1-N 3.36Å; D93-G96 PolarHBondContact O-N 2.78Å
94	P	61.1	Low	57.4	Low	112 Å²	112	127 Å²	127	73%	0.727	71%	0.706	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.1	-5	-176.6	25.1	-31.9	0	0	0	113.9
95	H	60.1	Low	57	Low	177 Å²	177	123.7 Å²	123.7	82%	0.819	69%	0.693	S	S	*	*	T	Hydrogen-bonded Turn	trans	-121.4	6.6	179.6	-60.4	-63.3	0	0	0	114	D93	D93-H95 PolarHBondContact O-N 2.99Å; D93-H95 PolarHBondContact OD1-N 3.36Å
96	G	49.6	Very low	56.6	Low	49 Å²	49	125.5 Å²	125.5	51%	0.505	70%	0.701	S	S	.	*	P	Polyproline II helix	trans	-85.8	132.4	-174.9	0	0	0	0	0	113.3	D93	D93-G96 PolarHBondContact O-N 2.78Å
97	R	55.8	Low	56.3	Low	225 Å²	225	122.3 Å²	122.3	85%	0.849	69%	0.688	S	S	*	*	P	Polyproline II helix	trans	-47.2	144	175.5	-74.5	175.7	167.2	-166.7	-4.4	111.9
98	P	57.4	Low	56.2	Low	116 Å²	116	123.3 Å²	123.3	75%	0.753	69%	0.694	S	S	*	*	P	Polyproline II helix	trans	-60.4	132.6	179.9	24.9	-32.7	0	0	0	109.8
99	P	60.1	Low	56.3	Low	72 Å²	72	119 Å²	119	47%	0.468	69%	0.687	S	S	.	*	P	Polyproline II helix	trans	-64.7	140.1	179.1	27	-34	0	0	0	110.1	S101 T114	P99-S101 PolarHBondContact O-N 3.47Å; P99-T114 HydrophobicContact CB-CG2 3.73Å; P99-T114 HydrophobicContact CG-CG2 4.35Å
100	L	60.1	Low	56.7	Low	118 Å²	118	118 Å²	118	62%	0.618	67%	0.668	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-81.5	109.4	173.1	-90.3	155.9	0	0	0	108.2	L115	L100-L115 PolarHBondContact O-N 3.46Å
101	S	56.8	Low	57.1	Low	84 Å²	84	116.1 Å²	116.1	59%	0.587	66%	0.658	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-94.9	118.7	171.1	-65.6	0	0	0	0	109.5	P99 T114	P99-S101 PolarHBondContact O-N 3.47Å; S101-T114 PolarHBondContact OG-OG1 3.28Å
102	V	65	Low	57.4	Low	84 Å²	84	110.8 Å²	110.8	51%	0.509	65%	0.649	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-105.4	120.3	172.2	-170.8	0	0	0	0	107.9	V104 V113	V102-V104 HydrophobicContact CG1-CG2 4Å; V102-V113 PolarHBondContact N-O 3.32Å; V102-V113 PolarHBondContact O-N 3.35Å
103	R	60.4	Low	58	Low	195 Å²	195	110 Å²	110	74%	0.736	64%	0.642	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-97.6	109.9	177.5	-170.4	171.1	-176.4	-176	-1.8	108.2	T110	R103-T110 HydrophobicContact CG-CG2 3.4Å; R103-T110 VanDerWaalsContact CG-CG2 3.4Å; R103-T110 VanDerWaalsContact NE-CG2 3.32Å; R103-T110 PolarHBondContact NE-OG1 3.42Å; R103-T110 PolarHBondContact NH2-OG1 3.33Å
104	V	59.2	Low	58.2	Low	108 Å²	108	108.2 Å²	108.2	66%	0.655	64%	0.636	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-108	111.4	176.7	-178.9	0	0	0	0	108.2	V102 A111	V102-V104 HydrophobicContact CG1-CG2 4Å; V104-A111 PolarHBondContact N-O 3.21Å
105	G	50.8	Low	58.1	Low	49 Å²	49	107.9 Å²	107.9	51%	0.505	63%	0.627	S	S	.	*			trans	159.3	137.5	168.6	0	0	0	0	0	113.8
106	K	52.1	Low	58.1	Low	224 Å²	224	105.7 Å²	105.7	97%	0.974	62%	0.622	S	S	*	*	S	Bend	trans	-115.3	87.5	170	-132.1	172.4	-177.4	177.1	0	106.1
107	G	58.6	Low	58.6	Low	42 Å²	42	113.2 Å²	113.2	43%	0.433	65%	0.649	S	S	.	*	S	Bend	trans	156.7	173.1	-175.4	0	0	0	0	0	114.2	V109	G107-V109 PolarHBondContact O-N 2.97Å
108	P	61.8	Low	58.8	Low	141 Å²	141	107.7 Å²	107.7	92%	0.916	64%	0.639	S	S	*	*	S	Bend	trans	-66	-10.4	-169.7	24.4	-32.8	0	0	0	114.7
109	V	52.7	Low	58.8	Low	134 Å²	134	107.2 Å²	107.2	81%	0.812	63%	0.633	S	S	*	*			trans	-120.5	98.5	174.2	-109.8	0	0	0	0	108	G107	G107-V109 PolarHBondContact O-N 2.97Å
110	T	55.3	Low	58.8	Low	45 Å²	45	109.2 Å²	109.2	28%	0.276	64%	0.642	S	S	.	*			trans	-95.4	118.2	171.6	-14.6	0	0	0	0	108.9	R103	R103-T110 HydrophobicContact CG-CG2 3.4Å; R103-T110 VanDerWaalsContact CG-CG2 3.4Å; R103-T110 VanDerWaalsContact NE-CG2 3.32Å; R103-T110 PolarHBondContact NE-OG1 3.42Å; R103-T110 PolarHBondContact NH2-OG1 3.33Å
111	A	59	Low	58.7	Low	69 Å²	69	108.6 Å²	108.6	57%	0.57	64%	0.644	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-86.2	114.4	169.3	0	0	0	0	0	108	V104	V104-A111 PolarHBondContact N-O 3.21Å
112	G	61.7	Low	58.8	Low	58 Å²	58	110.2 Å²	110.2	60%	0.598	65%	0.647	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-90.9	132.4	169.6	0	0	0	0	0	109.4
113	V	65.6	Low	58.4	Low	91 Å²	91	111.9 Å²	111.9	55%	0.552	66%	0.657	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-113.1	128.6	167.5	-177.5	0	0	0	0	107.4	V102 L115	V102-V113 PolarHBondContact N-O 3.32Å; V102-V113 PolarHBondContact O-N 3.35Å; V113-L115 HydrophobicContact CG1-CG 4.43Å
114	T	60.2	Low	58.3	Low	79 Å²	79	106 Å²	106	49%	0.485	65%	0.651	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-106.2	122.8	175.1	-59.5	0	0	0	0	107.8	P99 S101	P99-T114 HydrophobicContact CB-CG2 3.73Å; P99-T114 HydrophobicContact CG-CG2 4.35Å; S101-T114 PolarHBondContact OG-OG1 3.28Å
115	L	58.7	Low	58.2	Low	106 Å²	106	105.8 Å²	105.8	56%	0.555	65%	0.651	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-108	128.8	174.7	-71.1	167	0	0	0	109.2	L100 V113	L100-L115 PolarHBondContact O-N 3.46Å; V113-L115 HydrophobicContact CG1-CG 4.43Å
116	N	60.4	Low	58.8	Low	131 Å²	131	110.6 Å²	110.6	70%	0.701	66%	0.663	S	S	*	*			trans	-98.4	119.4	169.3	-60.8	-35.4	0	0	0	107
117	L	59.5	Low	59.4	Low	207 Å²	207	100.3 Å²	100.3	100%	1.084	64%	0.635	S	S	*	*			trans	-113.5	0	179.4	-80.3	137.4	0	0	0	110

Retrieved 117 of 117 residues in 96.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).