A0A077Z2C2_TRITR Loading...

Probable kinetochore protein NDC80

AlphaFold DB , UniProt , Accession A0A077Z2C2, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 133 aa.

						>A0A077Z2C2_TRITR|A0A077Z2C2
MIPTLETLSMLKREQVRCYEDIISLEKSSKDINAYLQRSVDQQDGLEAQLRNVERRMKDELAQKFNDLKERLDQVESELTNLIVAAENLYASYMQMMGPEIAFKRQVSELWDNICDFMQSALLLVVLNICILV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.9	Low	84.2	Confident	238 Å²	238	118.2 Å²	118.2	100%	1.172	63%	0.629	S	S	*	*				0	113.5	0	-92.1	166.9	70.7	0	0	107.7
2	I	71.7	Confident	85.2	Confident	159 Å²	159	118.6 Å²	118.6	82%	0.815	62%	0.622	S	S	*	*	P	Polyproline II helix	trans	-73.9	127	170	-60	172	0	0	0	105.8	T4	I2-T4 PolarHBondContact O-N 3.11Å
3	P	73.6	Confident	86	Confident	79 Å²	79	121.8 Å²	121.8	51%	0.513	62%	0.621	S	S	.	*	P	Polyproline II helix	trans	-51	126.7	170.6	-22.7	31.9	0	0	0	109	T7 L8	P3-T7 WeakPolarHBondContact CA-OG1 3.46Å; P3-T7 VanDerWaalsContact CB-OG1 3.31Å; P3-T7 WeakPolarHBondContact CB-OG1 3.24Å; P3-L8 HydrophobicContact CB-CD2 4.24Å; P3-L8 HydrophobicContact CB-CG 4.17Å
4	T	86.6	Confident	86.7	Confident	76 Å²	76	119.6 Å²	119.6	47%	0.466	61%	0.606	S	S	.	*	P	Polyproline II helix	trans	-67	154.5	173	62.6	0	0	0	0	109	I2 E6 T7 L8	I2-T4 PolarHBondContact O-N 3.11Å; T4-E6 PolarHBondContact O-N 3.11Å; T4-E6 VanDerWaalsContact O-N 3.08Å; T4-T7 PolarHBondContact N-OG1 3.46Å; T4-T7 PolarHBondContact O-N 3.2Å; T4-T7 PolarHBondContact O-OG1 3.25Å; T4-T7 WeakPolarHBondContact OG1-CG2 3.46Å; T4-T7 PolarHBondContact OG1-N 3.37Å; T4-L8 PolarHBondContact O-N 3.01Å
5	L	86.4	Confident	87.3	Confident	150 Å²	150	116.7 Å²	116.7	79%	0.785	59%	0.59	S	S	*	*	H	α-helix	trans	-51	-34.6	174.9	-172.4	71.3	0	0	0	112.1	L8 S9	L5-L8 PolarHBondContact O-N 3.43Å; L5-S9 PolarHBondContact O-N 3.29Å
6	E	89.4	Confident	87.9	Confident	150 Å²	150	113.6 Å²	113.6	70%	0.701	58%	0.578	S	S	*	*	H	α-helix	trans	-62.6	-45.7	174.9	-64.3	176.7	164.6	0	0	112.6	T4 L8 S9 M10	T4-E6 PolarHBondContact O-N 3.11Å; T4-E6 VanDerWaalsContact O-N 3.08Å; E6-L8 VanDerWaalsContact C-N 3.33Å; E6-L8 PolarHBondContact O-N 2.98Å; E6-S9 PolarHBondContact O-N 3Å; E6-M10 WeakPolarHBondContact O-CG 3.36Å; E6-M10 PolarHBondContact O-N 3.29Å
7	T	91.4	Very high	88.5	Confident	57 Å²	57	114.7 Å²	114.7	35%	0.35	57%	0.573	S	S	.	*	H	α-helix	trans	-62.6	-39.3	176.7	57.8	0	0	0	0	112	P3 T4 M10 L11	P3-T7 WeakPolarHBondContact CA-OG1 3.46Å; P3-T7 VanDerWaalsContact CB-OG1 3.31Å; P3-T7 WeakPolarHBondContact CB-OG1 3.24Å; T4-T7 PolarHBondContact N-OG1 3.46Å; T4-T7 PolarHBondContact O-N 3.2Å; T4-T7 PolarHBondContact O-OG1 3.25Å; T4-T7 WeakPolarHBondContact OG1-CG2 3.46Å; T4-T7 PolarHBondContact OG1-N 3.37Å; T7-M10 PolarHBondContact O-N 3.29Å; T7-L11 WeakPolarHBondContact O-CB 3.49Å; T7-L11 VanDerWaalsContact O-CG 3.3Å; T7-L11 WeakPolarHBondContact O-CG 3.47Å; T7-L11 PolarHBondContact O-N 2.93Å
8	L	92	Very high	89	Confident	94 Å²	94	111.6 Å²	111.6	49%	0.492	56%	0.564	S	S	.	*	H	α-helix	trans	-65.4	-41.5	175.3	-69	174	0	0	0	111.9	P3 T4 L5 E6 L11 K12	P3-L8 HydrophobicContact CB-CD2 4.24Å; P3-L8 HydrophobicContact CB-CG 4.17Å; T4-L8 PolarHBondContact O-N 3.01Å; L5-L8 PolarHBondContact O-N 3.43Å; E6-L8 VanDerWaalsContact C-N 3.33Å; E6-L8 PolarHBondContact O-N 2.98Å; L8-L11 PolarHBondContact O-N 3.36Å; L8-K12 WeakPolarHBondContact O-CB 3.48Å; L8-K12 PolarHBondContact O-N 2.97Å
9	S	93	Very high	89.4	Confident	63 Å²	63	112.9 Å²	112.9	44%	0.441	56%	0.562	S	S	.	*	H	α-helix	trans	-63.8	-42.3	176	179.9	0	0	0	0	112.3	L5 E6 K12 R13	L5-S9 PolarHBondContact O-N 3.29Å; E6-S9 PolarHBondContact O-N 3Å; S9-K12 PolarHBondContact O-N 3.09Å; S9-R13 PolarHBondContact O-N 3.46Å
10	M	95.1	Very high	89.8	Confident	118 Å²	118	113.4 Å²	113.4	58%	0.581	56%	0.563	S	S	*	*	H	α-helix	trans	-62.1	-49.9	174.1	-76.4	-179	54.8	0	0	112	E6 T7 K12 R13 E14	E6-M10 WeakPolarHBondContact O-CG 3.36Å; E6-M10 PolarHBondContact O-N 3.29Å; T7-M10 PolarHBondContact O-N 3.29Å; M10-K12 PolarHBondContact O-N 2.89Å; M10-R13 PolarHBondContact O-N 3.33Å; M10-R13 VanDerWaalsContact O-N 3.15Å; M10-E14 PolarHBondContact O-N 3.43Å
11	L	94.7	Very high	90.2	Very high	116 Å²	116	112.2 Å²	112.2	61%	0.607	56%	0.558	S	S	*	*	H	α-helix	trans	-59.3	-37.3	177.7	-74.7	170.9	0	0	0	111.7	T7 L8 E14 Q15	T7-L11 WeakPolarHBondContact O-CB 3.49Å; T7-L11 VanDerWaalsContact O-CG 3.3Å; T7-L11 WeakPolarHBondContact O-CG 3.47Å; T7-L11 PolarHBondContact O-N 2.93Å; L8-L11 PolarHBondContact O-N 3.36Å; L11-E14 PolarHBondContact O-N 3.07Å; L11-Q15 VanDerWaalsContact O-CB 3.24Å; L11-Q15 WeakPolarHBondContact O-CB 3.35Å; L11-Q15 PolarHBondContact O-N 3.25Å
12	K	95.2	Very high	92.3	Very high	123 Å²	123	105 Å²	105	54%	0.535	52%	0.524	S	S	.	.	H	α-helix	trans	-66.6	-41.6	176.7	-168.1	69.4	-168.2	169.4	0	112.3	L8 S9 M10 Q15 V16	L8-K12 WeakPolarHBondContact O-CB 3.48Å; L8-K12 PolarHBondContact O-N 2.97Å; S9-K12 PolarHBondContact O-N 3.09Å; M10-K12 PolarHBondContact O-N 2.89Å; K12-Q15 PolarHBondContact O-N 2.86Å; K12-V16 WeakPolarHBondContact O-CG2 3.41Å; K12-V16 PolarHBondContact O-N 2.98Å
13	R	95.5	Very high	93.6	Very high	161 Å²	161	102.6 Å²	102.6	61%	0.608	51%	0.511	S	S	*	.	H	α-helix	trans	-64.3	-43	175.3	-75.5	-173.5	-71.6	174.8	-1.5	111.9	S9 M10 V16 R17	S9-R13 PolarHBondContact O-N 3.46Å; M10-R13 PolarHBondContact O-N 3.33Å; M10-R13 VanDerWaalsContact O-N 3.15Å; R13-V16 PolarHBondContact O-N 3.43Å; R13-R17 PolarHBondContact O-N 3.3Å
14	E	96	Very high	94.7	Very high	90 Å²	90	102.4 Å²	102.4	42%	0.421	51%	0.512	S	S	.	.	H	α-helix	trans	-66	-41	177.2	-161.9	61.7	-158.8	0	0	111.3	M10 L11 V16 R17 C18	M10-E14 PolarHBondContact O-N 3.43Å; L11-E14 PolarHBondContact O-N 3.07Å; E14-V16 VanDerWaalsContact C-N 3.33Å; E14-V16 PolarHBondContact O-N 3.41Å; E14-R17 PolarHBondContact O-N 2.99Å; E14-R17 IonicContact OE1-NH1 3.96Å; E14-R17 IonicContact OE2-CZ 3.75Å; E14-R17 IonicContact OE2-NH1 3.32Å; E14-R17 PolarHBondContact OE2-NH1 2.94Å; E14-C18 PolarHBondContact O-N 3.28Å; E14-C18 PolarHBondContact O-SG 3.49Å; E14-C18 VanDerWaalsContact O-SG 3.33Å
15	Q	96.6	Very high	95.2	Very high	77 Å²	77	104.5 Å²	104.5	36%	0.36	52%	0.52	S	S	.	.	H	α-helix	trans	-57.6	-45.6	173.8	-178	-176.7	41.7	0	0	111.6	L11 K12 C18 Y19	L11-Q15 VanDerWaalsContact O-CB 3.24Å; L11-Q15 WeakPolarHBondContact O-CB 3.35Å; L11-Q15 PolarHBondContact O-N 3.25Å; K12-Q15 PolarHBondContact O-N 2.86Å; Q15-C18 PolarHBondContact O-N 3.41Å; Q15-Y19 HydrophobicContact CG-CD2 3.86Å; Q15-Y19 HydrophobicContact CG-CE2 3.46Å; Q15-Y19 VanDerWaalsContact CG-CE2 3.46Å; Q15-Y19 WeakPolarHBondContact O-CD2 3.47Å; Q15-Y19 PolarHBondContact O-N 2.92Å; Q15-Y19 VanDerWaalsContact O-N 3.08Å
16	V	96.8	Very high	95.7	Very high	66 Å²	66	102.5 Å²	102.5	40%	0.4	51%	0.507	S	S	.	.	H	α-helix	trans	-62.3	-45.8	177	170.9	0	0	0	0	110.8	K12 R13 E14 C18 Y19 E20	K12-V16 WeakPolarHBondContact O-CG2 3.41Å; K12-V16 PolarHBondContact O-N 2.98Å; R13-V16 PolarHBondContact O-N 3.43Å; E14-V16 VanDerWaalsContact C-N 3.33Å; E14-V16 PolarHBondContact O-N 3.41Å; V16-C18 PolarHBondContact O-N 3.47Å; V16-Y19 PolarHBondContact O-N 3.38Å; V16-Y19 VanDerWaalsContact O-N 3.14Å; V16-E20 HydrophobicContact CG1-CG 4.49Å; V16-E20 WeakPolarHBondContact O-CG 3.36Å; V16-E20 PolarHBondContact O-N 2.91Å
17	R	97.4	Very high	96.1	Very high	133 Å²	133	102.2 Å²	102.2	50%	0.502	50%	0.503	S	S	.	.	H	α-helix	trans	-58.4	-46.9	176.6	-175	-174.2	-65.3	171.9	-3	112	R13 E14 Y19 E20 D21	R13-R17 PolarHBondContact O-N 3.3Å; E14-R17 PolarHBondContact O-N 2.99Å; E14-R17 IonicContact OE1-NH1 3.96Å; E14-R17 IonicContact OE2-CZ 3.75Å; E14-R17 IonicContact OE2-NH1 3.32Å; E14-R17 PolarHBondContact OE2-NH1 2.94Å; R17-Y19 VanDerWaalsContact C-N 3.28Å; R17-Y19 PolarHBondContact O-N 3.5Å; R17-E20 PolarHBondContact O-N 3.3Å; R17-E20 VanDerWaalsContact O-N 3.15Å; R17-D21 PolarHBondContact O-N 2.87Å
18	C	97.7	Very high	96.4	Very high	59 Å²	59	102.3 Å²	102.3	40%	0.399	51%	0.506	S	S	.	.	H	α-helix	trans	-59.7	-39.3	176.6	-68.1	0	0	0	0	112.1	E14 Q15 V16 D21 I22	E14-C18 PolarHBondContact O-N 3.28Å; E14-C18 PolarHBondContact O-SG 3.49Å; E14-C18 VanDerWaalsContact O-SG 3.33Å; Q15-C18 PolarHBondContact O-N 3.41Å; V16-C18 PolarHBondContact O-N 3.47Å; C18-D21 PolarHBondContact O-N 3.48Å; C18-I22 WeakPolarHBondContact O-CD1 3.37Å; C18-I22 VanDerWaalsContact O-CG1 3.22Å; C18-I22 WeakPolarHBondContact O-CG1 3.47Å; C18-I22 PolarHBondContact O-N 2.92Å
19	Y	97.8	Very high	96.7	Very high	136 Å²	136	100.6 Å²	100.6	53%	0.533	50%	0.502	S	S	.	.	H	α-helix	trans	-66	-40.5	175.2	-76.7	-55.4	0	0	0	112.4	Q15 V16 R17 I22 I23	Q15-Y19 HydrophobicContact CG-CD2 3.86Å; Q15-Y19 HydrophobicContact CG-CE2 3.46Å; Q15-Y19 VanDerWaalsContact CG-CE2 3.46Å; Q15-Y19 WeakPolarHBondContact O-CD2 3.47Å; Q15-Y19 PolarHBondContact O-N 2.92Å; Q15-Y19 VanDerWaalsContact O-N 3.08Å; V16-Y19 PolarHBondContact O-N 3.38Å; V16-Y19 VanDerWaalsContact O-N 3.14Å; R17-Y19 VanDerWaalsContact C-N 3.28Å; R17-Y19 PolarHBondContact O-N 3.5Å; Y19-I22 PolarHBondContact O-N 2.96Å; Y19-I23 WeakPolarHBondContact O-CD1 3.44Å; Y19-I23 VanDerWaalsContact O-CG1 3.26Å; Y19-I23 WeakPolarHBondContact O-CG1 3.34Å; Y19-I23 PolarHBondContact O-N 2.87Å
20	E	97	Very high	96.9	Very high	123 Å²	123	104.4 Å²	104.4	58%	0.575	51%	0.51	S	S	*	.	H	α-helix	trans	-62.2	-42.6	175.1	-70.2	171.9	166.2	0	0	111.7	V16 R17 I23 S24	V16-E20 HydrophobicContact CG1-CG 4.49Å; V16-E20 WeakPolarHBondContact O-CG 3.36Å; V16-E20 PolarHBondContact O-N 2.91Å; R17-E20 PolarHBondContact O-N 3.3Å; R17-E20 VanDerWaalsContact O-N 3.15Å; E20-I23 PolarHBondContact O-N 3.01Å; E20-S24 WeakPolarHBondContact O-CB 3.41Å; E20-S24 PolarHBondContact O-N 3.18Å
21	D	98	Very high	97	Very high	88 Å²	88	103.5 Å²	103.5	47%	0.471	51%	0.508	S	S	.	.	H	α-helix	trans	-63.3	-43.3	176.1	-70.9	-22.9	0	0	0	111.7	R17 C18 S24 L25	R17-D21 PolarHBondContact O-N 2.87Å; C18-D21 PolarHBondContact O-N 3.48Å; D21-S24 WeakPolarHBondContact O-CB 3.41Å; D21-S24 PolarHBondContact O-N 3.35Å; D21-L25 WeakPolarHBondContact O-CB 3.36Å; D21-L25 WeakPolarHBondContact O-CG 3.45Å; D21-L25 PolarHBondContact O-N 2.95Å
22	I	97.6	Very high	97.1	Very high	86 Å²	86	102.2 Å²	102.2	44%	0.441	50%	0.501	S	S	.	.	H	α-helix	trans	-60.1	-47	175.4	-71.1	164.9	0	0	0	110.6	C18 Y19 S24 L25 E26	C18-I22 WeakPolarHBondContact O-CD1 3.37Å; C18-I22 VanDerWaalsContact O-CG1 3.22Å; C18-I22 WeakPolarHBondContact O-CG1 3.47Å; C18-I22 PolarHBondContact O-N 2.92Å; Y19-I22 PolarHBondContact O-N 2.96Å; I22-S24 VanDerWaalsContact C-N 3.29Å; I22-S24 PolarHBondContact O-N 3.37Å; I22-L25 PolarHBondContact O-N 3.13Å; I22-E26 HydrophobicContact CG2-CG 4.44Å; I22-E26 WeakPolarHBondContact O-CG 3.28Å; I22-E26 PolarHBondContact O-N 3.4Å
23	I	97.3	Very high	97.2	Very high	109 Å²	109	100.9 Å²	100.9	56%	0.559	50%	0.5	S	S	*	.	H	α-helix	trans	-61	-40.9	178.4	-69.4	165.1	0	0	0	110.9	Y19 E20 E26 K27	Y19-I23 WeakPolarHBondContact O-CD1 3.44Å; Y19-I23 VanDerWaalsContact O-CG1 3.26Å; Y19-I23 WeakPolarHBondContact O-CG1 3.34Å; Y19-I23 PolarHBondContact O-N 2.87Å; E20-I23 PolarHBondContact O-N 3.01Å; I23-E26 PolarHBondContact O-N 3.05Å; I23-K27 PolarHBondContact O-N 2.92Å; I23-K27 VanDerWaalsContact O-N 3.07Å
24	S	97.5	Very high	97.3	Very high	76 Å²	76	95.1 Å²	95.1	53%	0.531	49%	0.486	S	S	.	.	H	α-helix	trans	-62.6	-46.3	176.3	-174.5	0	0	0	0	111.8	E20 D21 I22 K27 S28	E20-S24 WeakPolarHBondContact O-CB 3.41Å; E20-S24 PolarHBondContact O-N 3.18Å; D21-S24 WeakPolarHBondContact O-CB 3.41Å; D21-S24 PolarHBondContact O-N 3.35Å; I22-S24 VanDerWaalsContact C-N 3.29Å; I22-S24 PolarHBondContact O-N 3.37Å; S24-K27 PolarHBondContact O-N 3.15Å; S24-S28 PolarHBondContact O-N 3.4Å
25	L	97.6	Very high	97.4	Very high	119 Å²	119	98.3 Å²	98.3	62%	0.623	50%	0.496	S	S	*	.	H	α-helix	trans	-63.5	-41.3	177.2	-73.9	171.2	0	0	0	112.1	D21 I22 K27 S28 S29	D21-L25 WeakPolarHBondContact O-CB 3.36Å; D21-L25 WeakPolarHBondContact O-CG 3.45Å; D21-L25 PolarHBondContact O-N 2.95Å; I22-L25 PolarHBondContact O-N 3.13Å; L25-K27 VanDerWaalsContact C-N 3.31Å; L25-K27 PolarHBondContact O-N 2.89Å; L25-S28 PolarHBondContact O-N 2.89Å; L25-S29 WeakPolarHBondContact O-CB 3.42Å; L25-S29 PolarHBondContact O-N 3.22Å
26	E	97.1	Very high	97.4	Very high	109 Å²	109	99 Å²	99	51%	0.509	50%	0.501	S	S	.	.	H	α-helix	trans	-61.8	-40.1	175.7	-76.5	-174.5	166.4	0	0	112	I22 I23 K30	I22-E26 HydrophobicContact CG2-CG 4.44Å; I22-E26 WeakPolarHBondContact O-CG 3.28Å; I22-E26 PolarHBondContact O-N 3.4Å; I23-E26 PolarHBondContact O-N 3.05Å; E26-K30 WeakPolarHBondContact O-CG 3.45Å; E26-K30 PolarHBondContact O-N 3.43Å
27	K	96.8	Very high	97.5	Very high	143 Å²	143	100.9 Å²	100.9	62%	0.622	51%	0.506	S	S	*	.	H	α-helix	trans	-65.1	-47.8	175.5	-172.6	179.5	177.9	-176.4	0	111.3	I23 S24 L25 S29 K30 D31	I23-K27 PolarHBondContact O-N 2.92Å; I23-K27 VanDerWaalsContact O-N 3.07Å; S24-K27 PolarHBondContact O-N 3.15Å; L25-K27 VanDerWaalsContact C-N 3.31Å; L25-K27 PolarHBondContact O-N 2.89Å; K27-S29 VanDerWaalsContact C-N 3.31Å; K27-S29 PolarHBondContact O-N 3.01Å; K27-K30 WeakPolarHBondContact O-CB 3.44Å; K27-K30 PolarHBondContact O-N 3.22Å; K27-D31 PolarHBondContact O-N 3.1Å
28	S	97.4	Very high	97.4	Very high	59 Å²	59	101.9 Å²	101.9	41%	0.413	51%	0.509	S	S	.	.	H	α-helix	trans	-59.7	-41.6	176.7	-178.7	0	0	0	0	112	S24 L25 K30 D31 I32	S24-S28 PolarHBondContact O-N 3.4Å; L25-S28 PolarHBondContact O-N 2.89Å; S28-K30 PolarHBondContact O-N 3.37Å; S28-D31 PolarHBondContact O-N 3.4Å; S28-I32 VanDerWaalsContact O-CG1 3.31Å; S28-I32 WeakPolarHBondContact O-CG1 3.5Å; S28-I32 PolarHBondContact O-N 2.95Å
29	S	97.8	Very high	97.4	Very high	58 Å²	58	101.4 Å²	101.4	41%	0.406	51%	0.507	S	S	.	.	H	α-helix	trans	-61.6	-41.9	175.4	175.7	0	0	0	0	112.2	L25 K27 I32 N33	L25-S29 WeakPolarHBondContact O-CB 3.42Å; L25-S29 PolarHBondContact O-N 3.22Å; K27-S29 VanDerWaalsContact C-N 3.31Å; K27-S29 PolarHBondContact O-N 3.01Å; S29-I32 PolarHBondContact O-N 3.31Å; S29-N33 WeakPolarHBondContact O-CB 3.44Å; S29-N33 VanDerWaalsContact O-CG 3.27Å; S29-N33 PolarHBondContact O-N 3.49Å; S29-N33 PolarHBondContact O-ND2 3.49Å
30	K	97.4	Very high	97.4	Very high	143 Å²	143	98 Å²	98	62%	0.622	50%	0.5	S	S	*	.	H	α-helix	trans	-62.2	-42.8	174.4	-75.4	172.3	-178.4	171.8	0	112.2	E26 K27 S28 N33 A34	E26-K30 WeakPolarHBondContact O-CG 3.45Å; E26-K30 PolarHBondContact O-N 3.43Å; K27-K30 WeakPolarHBondContact O-CB 3.44Å; K27-K30 PolarHBondContact O-N 3.22Å; S28-K30 PolarHBondContact O-N 3.37Å; K30-N33 PolarHBondContact O-N 2.9Å; K30-A34 WeakPolarHBondContact O-CB 3.39Å; K30-A34 PolarHBondContact O-N 2.99Å
31	D	97.6	Very high	97.4	Very high	99 Å²	99	96.3 Å²	96.3	53%	0.529	50%	0.495	S	S	.	.	H	α-helix	trans	-64.5	-42	178.1	-69.3	-22.5	0	0	0	111.5	K27 S28 A34 Y35	K27-D31 PolarHBondContact O-N 3.1Å; S28-D31 PolarHBondContact O-N 3.4Å; D31-A34 PolarHBondContact O-N 3.43Å; D31-Y35 PolarHBondContact O-N 3.34Å
32	I	97.6	Very high	97.3	Very high	90 Å²	90	98.5 Å²	98.5	46%	0.462	50%	0.502	S	S	.	.	H	α-helix	trans	-62.3	-46.6	174.5	-69.3	166.1	0	0	0	110.8	S28 S29 A34 Y35 L36	S28-I32 VanDerWaalsContact O-CG1 3.31Å; S28-I32 WeakPolarHBondContact O-CG1 3.5Å; S28-I32 PolarHBondContact O-N 2.95Å; S29-I32 PolarHBondContact O-N 3.31Å; I32-A34 VanDerWaalsContact C-N 3.32Å; I32-A34 PolarHBondContact O-N 3.11Å; I32-Y35 WeakPolarHBondContact O-CB 3.41Å; I32-Y35 PolarHBondContact O-N 3.26Å; I32-Y35 VanDerWaalsContact O-N 3.15Å; I32-L36 HydrophobicContact CG2-CD1 3.98Å; I32-L36 HydrophobicContact CG2-CG 4.32Å; I32-L36 WeakPolarHBondContact O-CG 3.46Å; I32-L36 PolarHBondContact O-N 2.89Å
33	N	97.6	Very high	97.3	Very high	95 Å²	95	99.4 Å²	99.4	51%	0.508	51%	0.505	S	S	.	.	H	α-helix	trans	-61.9	-40.3	178.1	-73.9	-19.3	0	0	0	111.9	S29 K30 Y35 L36 Q37	S29-N33 WeakPolarHBondContact O-CB 3.44Å; S29-N33 VanDerWaalsContact O-CG 3.27Å; S29-N33 PolarHBondContact O-N 3.49Å; S29-N33 PolarHBondContact O-ND2 3.49Å; K30-N33 PolarHBondContact O-N 2.9Å; N33-Y35 VanDerWaalsContact C-N 3.32Å; N33-Y35 PolarHBondContact O-N 2.9Å; N33-L36 PolarHBondContact O-N 2.85Å; N33-Q37 WeakPolarHBondContact O-CB 3.42Å; N33-Q37 PolarHBondContact O-N 3.09Å
34	A	97.3	Very high	97.3	Very high	40 Å²	40	98.5 Å²	98.5	33%	0.331	50%	0.501	S	S	.	.	H	α-helix	trans	-66.1	-33.9	175.6	0	0	0	0	0	112.6	K30 D31 I32 R38	K30-A34 WeakPolarHBondContact O-CB 3.39Å; K30-A34 PolarHBondContact O-N 2.99Å; D31-A34 PolarHBondContact O-N 3.43Å; I32-A34 VanDerWaalsContact C-N 3.32Å; I32-A34 PolarHBondContact O-N 3.11Å; A34-R38 WeakPolarHBondContact O-CG 3.44Å; A34-R38 PolarHBondContact O-N 3.41Å; A34-R38 PolarHBondContact O-NE 2.87Å
35	Y	97.2	Very high	97.3	Very high	156 Å²	156	96.4 Å²	96.4	61%	0.612	49%	0.491	S	S	*	.	H	α-helix	trans	-68.5	-46.8	172.7	175.2	-96.2	0	0	0	111.7	D31 I32 N33 Q37 R38 S39	D31-Y35 PolarHBondContact O-N 3.34Å; I32-Y35 WeakPolarHBondContact O-CB 3.41Å; I32-Y35 PolarHBondContact O-N 3.26Å; I32-Y35 VanDerWaalsContact O-N 3.15Å; N33-Y35 VanDerWaalsContact C-N 3.32Å; N33-Y35 PolarHBondContact O-N 2.9Å; Y35-Q37 VanDerWaalsContact C-N 3.33Å; Y35-Q37 PolarHBondContact O-N 3.48Å; Y35-R38 PolarHBondContact O-N 2.66Å; Y35-S39 PolarHBondContact O-N 3.32Å
36	L	97.7	Very high	97.3	Very high	91 Å²	91	96 Å²	96	48%	0.476	49%	0.49	S	S	.	.	H	α-helix	trans	-59.7	-44	177.6	-72.3	173.7	0	0	0	111.5	I32 N33 R38 S39 V40	I32-L36 HydrophobicContact CG2-CD1 3.98Å; I32-L36 HydrophobicContact CG2-CG 4.32Å; I32-L36 WeakPolarHBondContact O-CG 3.46Å; I32-L36 PolarHBondContact O-N 2.89Å; N33-L36 PolarHBondContact O-N 2.85Å; L36-R38 PolarHBondContact O-N 3.4Å; L36-S39 WeakPolarHBondContact O-CB 3.35Å; L36-S39 PolarHBondContact O-N 2.9Å; L36-S39 VanDerWaalsContact O-N 3.13Å; L36-V40 WeakPolarHBondContact O-CG2 3.12Å; L36-V40 PolarHBondContact O-N 3.22Å
37	Q	97.4	Very high	97.3	Very high	107 Å²	107	94.7 Å²	94.7	50%	0.5	48%	0.483	S	S	.	.	H	α-helix	trans	-60.1	-46	177.6	-171.6	60.4	43.6	0	0	111.7	N33 Y35 S39 V40 D41	N33-Q37 WeakPolarHBondContact O-CB 3.42Å; N33-Q37 PolarHBondContact O-N 3.09Å; Y35-Q37 VanDerWaalsContact C-N 3.33Å; Y35-Q37 PolarHBondContact O-N 3.48Å; Q37-S39 VanDerWaalsContact C-N 3.27Å; Q37-S39 PolarHBondContact O-N 2.83Å; Q37-V40 PolarHBondContact O-N 3.48Å; Q37-D41 PolarHBondContact NE2-OD1 2.85Å; Q37-D41 PolarHBondContact O-N 3.29Å
38	R	97	Very high	97.4	Very high	153 Å²	153	90.2 Å²	90.2	58%	0.577	47%	0.473	S	S	*	.	H	α-helix	trans	-60.6	-38.2	175.3	-74.5	-179.2	-115.9	163.6	-4.8	112.3	A34 Y35 L36 Q42	A34-R38 WeakPolarHBondContact O-CG 3.44Å; A34-R38 PolarHBondContact O-N 3.41Å; A34-R38 PolarHBondContact O-NE 2.87Å; Y35-R38 PolarHBondContact O-N 2.66Å; L36-R38 PolarHBondContact O-N 3.4Å; R38-Q42 WeakPolarHBondContact O-CB 3.45Å; R38-Q42 VanDerWaalsContact O-CG 3.23Å; R38-Q42 WeakPolarHBondContact O-CG 3.33Å; R38-Q42 PolarHBondContact O-N 2.84Å
39	S	96.7	Very high	97.4	Very high	49 Å²	49	93.3 Å²	93.3	34%	0.343	48%	0.481	S	S	.	.	H	α-helix	trans	-65.8	-40	177	-170.8	0	0	0	0	111.8	Y35 L36 Q37 Q42 Q43	Y35-S39 PolarHBondContact O-N 3.32Å; L36-S39 WeakPolarHBondContact O-CB 3.35Å; L36-S39 PolarHBondContact O-N 2.9Å; L36-S39 VanDerWaalsContact O-N 3.13Å; Q37-S39 VanDerWaalsContact C-N 3.27Å; Q37-S39 PolarHBondContact O-N 2.83Å; S39-Q42 PolarHBondContact O-N 3.42Å; S39-Q43 WeakPolarHBondContact O-CB 3.29Å; S39-Q43 PolarHBondContact O-N 2.97Å
40	V	97.6	Very high	97.4	Very high	65 Å²	65	96.2 Å²	96.2	39%	0.394	49%	0.491	S	S	.	.	H	α-helix	trans	-63.9	-49.2	174.8	171	0	0	0	0	110.2	L36 Q37 Q42 Q43 D44	L36-V40 WeakPolarHBondContact O-CG2 3.12Å; L36-V40 PolarHBondContact O-N 3.22Å; Q37-V40 PolarHBondContact O-N 3.48Å; V40-Q42 VanDerWaalsContact C-N 3.26Å; V40-Q42 PolarHBondContact O-N 3.07Å; V40-Q43 PolarHBondContact O-N 3.35Å; V40-D44 PolarHBondContact O-N 2.96Å
41	D	96.5	Very high	97.5	Very high	87 Å²	87	96.9 Å²	96.9	47%	0.465	49%	0.49	S	S	.	.	H	α-helix	trans	-60.1	-37.5	178.8	-59.1	-20.2	0	0	0	111.7	Q37 G45	Q37-D41 PolarHBondContact NE2-OD1 2.85Å; Q37-D41 PolarHBondContact O-N 3.29Å; D41-G45 PolarHBondContact O-N 3.47Å
42	Q	97	Very high	97.5	Very high	134 Å²	134	96.4 Å²	96.4	63%	0.626	49%	0.487	S	S	*	.	H	α-helix	trans	-66	-43.9	174	-78.4	176.7	-5.4	0	0	112.3	R38 S39 V40 G45 L46	R38-Q42 WeakPolarHBondContact O-CB 3.45Å; R38-Q42 VanDerWaalsContact O-CG 3.23Å; R38-Q42 WeakPolarHBondContact O-CG 3.33Å; R38-Q42 PolarHBondContact O-N 2.84Å; S39-Q42 PolarHBondContact O-N 3.42Å; V40-Q42 VanDerWaalsContact C-N 3.26Å; V40-Q42 PolarHBondContact O-N 3.07Å; Q42-G45 PolarHBondContact O-N 3.28Å; Q42-L46 WeakPolarHBondContact O-CG 3.42Å; Q42-L46 PolarHBondContact O-N 2.86Å
43	Q	97.7	Very high	97.5	Very high	106 Å²	106	94.7 Å²	94.7	50%	0.495	48%	0.481	S	S	.	.	H	α-helix	trans	-62.4	-47.3	177.5	-177.1	-179.6	-27.5	0	0	110.8	S39 V40 G45 L46 E47	S39-Q43 WeakPolarHBondContact O-CB 3.29Å; S39-Q43 PolarHBondContact O-N 2.97Å; V40-Q43 PolarHBondContact O-N 3.35Å; Q43-G45 VanDerWaalsContact C-N 3.26Å; Q43-G45 PolarHBondContact O-N 3.49Å; Q43-L46 PolarHBondContact O-N 2.87Å; Q43-L46 VanDerWaalsContact O-N 3.08Å; Q43-E47 HydrophobicContact CG-CG 4.48Å; Q43-E47 PolarHBondContact NE2-OE1 3Å; Q43-E47 WeakPolarHBondContact O-CG 3.14Å; Q43-E47 PolarHBondContact O-N 2.92Å
44	D	96.8	Very high	97.5	Very high	89 Å²	89	94.8 Å²	94.8	48%	0.476	48%	0.478	S	S	.	.	H	α-helix	trans	-59.2	-40.4	177.1	-72.8	-12.8	0	0	0	111.3	V40 E47 A48	V40-D44 PolarHBondContact O-N 2.96Å; D44-E47 PolarHBondContact O-N 2.79Å; D44-A48 WeakPolarHBondContact O-CB 3.19Å; D44-A48 PolarHBondContact O-N 2.89Å
45	G	97.5	Very high	97.5	Very high	32 Å²	32	99.4 Å²	99.4	33%	0.33	49%	0.487	S	S	.	.	H	α-helix	trans	-61.3	-43.1	173.7	0	0	0	0	0	113.2	D41 Q42 Q43 Q49	D41-G45 PolarHBondContact O-N 3.47Å; Q42-G45 PolarHBondContact O-N 3.28Å; Q43-G45 VanDerWaalsContact C-N 3.26Å; Q43-G45 PolarHBondContact O-N 3.49Å; G45-Q49 WeakPolarHBondContact O-CG 3.39Å; G45-Q49 PolarHBondContact O-N 3.37Å
46	L	98	Very high	97.5	Very high	112 Å²	112	98.5 Å²	98.5	59%	0.586	48%	0.483	S	S	*	.	H	α-helix	trans	-68.4	-40.3	176.7	-72.2	172.3	0	0	0	112	Q42 Q43 A48 Q49 L50	Q42-L46 WeakPolarHBondContact O-CG 3.42Å; Q42-L46 PolarHBondContact O-N 2.86Å; Q43-L46 PolarHBondContact O-N 2.87Å; Q43-L46 VanDerWaalsContact O-N 3.08Å; L46-A48 VanDerWaalsContact C-N 3.34Å; L46-A48 PolarHBondContact O-N 3.15Å; L46-Q49 PolarHBondContact O-N 3.34Å; L46-L50 WeakPolarHBondContact O-CB 3.4Å; L46-L50 PolarHBondContact O-N 3.31Å
47	E	97.9	Very high	97.5	Very high	81 Å²	81	100.1 Å²	100.1	38%	0.379	49%	0.489	S	S	.	.	H	α-helix	trans	-62.6	-41.6	175.6	-74.3	-173.3	-163.9	0	0	111.5	Q43 D44 L50 R51	Q43-E47 HydrophobicContact CG-CG 4.48Å; Q43-E47 PolarHBondContact NE2-OE1 3Å; Q43-E47 WeakPolarHBondContact O-CG 3.14Å; Q43-E47 PolarHBondContact O-N 2.92Å; D44-E47 PolarHBondContact O-N 2.79Å; E47-L50 PolarHBondContact O-N 3.46Å; E47-R51 WeakPolarHBondContact O-CG 3.43Å; E47-R51 PolarHBondContact O-N 3.07Å
48	A	97.6	Very high	97.5	Very high	49 Å²	49	100.8 Å²	100.8	41%	0.405	49%	0.491	S	S	.	.	H	α-helix	trans	-63	-42.6	174.5	0	0	0	0	0	112	D44 L46 R51 N52	D44-A48 WeakPolarHBondContact O-CB 3.19Å; D44-A48 PolarHBondContact O-N 2.89Å; L46-A48 VanDerWaalsContact C-N 3.34Å; L46-A48 PolarHBondContact O-N 3.15Å; A48-R51 PolarHBondContact O-N 3.31Å; A48-N52 PolarHBondContact O-N 3.15Å; A48-N52 PolarHBondContact O-ND2 2.87Å
49	Q	97.9	Very high	97.6	Very high	123 Å²	123	98.3 Å²	98.3	58%	0.575	49%	0.489	S	S	*	.	H	α-helix	trans	-62.6	-44.4	174.7	-73.3	177	34.3	0	0	111.8	G45 L46 R51 N52 V53	G45-Q49 WeakPolarHBondContact O-CG 3.39Å; G45-Q49 PolarHBondContact O-N 3.37Å; L46-Q49 PolarHBondContact O-N 3.34Å; Q49-R51 PolarHBondContact O-N 2.94Å; Q49-N52 PolarHBondContact O-N 2.78Å; Q49-V53 WeakPolarHBondContact O-CG2 3.38Å; Q49-V53 PolarHBondContact O-N 3.32Å
50	L	98.3	Very high	97.6	Very high	119 Å²	119	100.3 Å²	100.3	62%	0.623	49%	0.493	S	S	*	.	H	α-helix	trans	-61.2	-45.7	178.7	-177.2	62.6	0	0	0	111.4	L46 E47 N52 V53 E54	L46-L50 WeakPolarHBondContact O-CB 3.4Å; L46-L50 PolarHBondContact O-N 3.31Å; E47-L50 PolarHBondContact O-N 3.46Å; L50-N52 VanDerWaalsContact C-N 3.28Å; L50-N52 PolarHBondContact O-N 2.94Å; L50-V53 PolarHBondContact O-N 3.45Å; L50-E54 WeakPolarHBondContact O-CB 3.37Å; L50-E54 PolarHBondContact O-N 3Å
51	R	97.9	Very high	97.7	Very high	158 Å²	158	103.1 Å²	103.1	60%	0.596	51%	0.505	S	S	*	.	H	α-helix	trans	-60.1	-37.9	175.2	-72.4	175.2	-173.5	-97.7	4	112.4	E47 A48 Q49 R55	E47-R51 WeakPolarHBondContact O-CG 3.43Å; E47-R51 PolarHBondContact O-N 3.07Å; A48-R51 PolarHBondContact O-N 3.31Å; Q49-R51 PolarHBondContact O-N 2.94Å; R51-R55 WeakPolarHBondContact O-CB 3.49Å; R51-R55 PolarHBondContact O-N 3.48Å
52	N	97.9	Very high	97.7	Very high	88 Å²	88	101.3 Å²	101.3	47%	0.471	50%	0.502	S	S	.	.	H	α-helix	trans	-69.7	-40.1	176.4	-74.8	-23.8	0	0	0	112.3	A48 Q49 L50 R55 R56	A48-N52 PolarHBondContact O-N 3.15Å; A48-N52 PolarHBondContact O-ND2 2.87Å; Q49-N52 PolarHBondContact O-N 2.78Å; L50-N52 VanDerWaalsContact C-N 3.28Å; L50-N52 PolarHBondContact O-N 2.94Å; N52-R55 PolarHBondContact OD1-NH1 3.43Å; N52-R56 WeakPolarHBondContact O-CB 3.39Å; N52-R56 PolarHBondContact O-N 2.92Å
53	V	98	Very high	97.8	Very high	54 Å²	54	100.8 Å²	100.8	33%	0.327	50%	0.499	S	S	.	.	H	α-helix	trans	-62.1	-49.1	173.5	172	0	0	0	0	110.4	Q49 L50 R55 R56 M57	Q49-V53 WeakPolarHBondContact O-CG2 3.38Å; Q49-V53 PolarHBondContact O-N 3.32Å; L50-V53 PolarHBondContact O-N 3.45Å; V53-R55 VanDerWaalsContact C-N 3.35Å; V53-R55 PolarHBondContact O-N 2.87Å; V53-R56 PolarHBondContact O-N 3.32Å; V53-M57 HydrophobicContact CG1-CG 4.26Å; V53-M57 HydrophobicContact CG1-SD 3.93Å; V53-M57 WeakPolarHBondContact O-CG 3.42Å; V53-M57 PolarHBondContact O-N 3Å
54	E	97.9	Very high	97.8	Very high	97 Å²	97	102 Å²	102	45%	0.453	50%	0.503	S	S	.	.	H	α-helix	trans	-58.3	-46.4	179.6	-170.2	-165.9	159.5	0	0	111.7	L50 M57 K58	L50-E54 WeakPolarHBondContact O-CB 3.37Å; L50-E54 PolarHBondContact O-N 3Å; E54-M57 PolarHBondContact O-N 3.3Å; E54-K58 HydrophobicContact CG-CD 4.42Å; E54-K58 WeakPolarHBondContact O-CG 3.37Å; E54-K58 PolarHBondContact O-N 2.94Å; E54-K58 WeakPolarHBondContact OE1-CE 3.41Å; E54-K58 IonicContact OE1-NZ 2.66Å; E54-K58 PolarHBondContact OE1-NZ 3.23Å
55	R	97.9	Very high	97.8	Very high	138 Å²	138	104.3 Å²	104.3	52%	0.521	51%	0.509	S	S	.	.	H	α-helix	trans	-59.9	-51.4	177.4	-170	-174.3	-56.8	112.7	2.9	111.4	R51 N52 V53 M57 K58 D59	R51-R55 WeakPolarHBondContact O-CB 3.49Å; R51-R55 PolarHBondContact O-N 3.48Å; N52-R55 PolarHBondContact OD1-NH1 3.43Å; V53-R55 VanDerWaalsContact C-N 3.35Å; V53-R55 PolarHBondContact O-N 2.87Å; R55-M57 VanDerWaalsContact C-N 3.35Å; R55-M57 PolarHBondContact O-N 3.47Å; R55-K58 WeakPolarHBondContact O-CB 3.41Å; R55-K58 PolarHBondContact O-N 3.47Å; R55-K58 VanDerWaalsContact O-N 3.16Å; R55-D59 VanDerWaalsContact O-CG 3.27Å; R55-D59 PolarHBondContact O-N 3.09Å
56	R	97.6	Very high	97.9	Very high	137 Å²	137	107.5 Å²	107.5	52%	0.517	52%	0.519	S	S	.	.	H	α-helix	trans	-59.7	-43	178.9	173	176.9	45.1	159.8	-2.4	112.3	N52 V53 K58 D59 E60	N52-R56 WeakPolarHBondContact O-CB 3.39Å; N52-R56 PolarHBondContact O-N 2.92Å; V53-R56 PolarHBondContact O-N 3.32Å; R56-K58 VanDerWaalsContact C-N 3.32Å; R56-K58 PolarHBondContact O-N 3.25Å; R56-D59 PolarHBondContact O-N 3.45Å; R56-E60 HydrophobicContact CG-CG 4.32Å; R56-E60 VanDerWaalsContact CG-OE1 3.23Å; R56-E60 WeakPolarHBondContact CG-OE1 3.39Å; R56-E60 WeakPolarHBondContact O-CB 3.43Å; R56-E60 WeakPolarHBondContact O-CG 3.32Å; R56-E60 PolarHBondContact O-N 3.11Å
57	M	97.3	Very high	97.9	Very high	124 Å²	124	105.9 Å²	105.9	61%	0.611	51%	0.511	S	S	*	.	H	α-helix	trans	-63.5	-39.1	177.2	-71.8	-175.2	91.1	0	0	111.8	V53 E54 R55 L61	V53-M57 HydrophobicContact CG1-CG 4.26Å; V53-M57 HydrophobicContact CG1-SD 3.93Å; V53-M57 WeakPolarHBondContact O-CG 3.42Å; V53-M57 PolarHBondContact O-N 3Å; E54-M57 PolarHBondContact O-N 3.3Å; R55-M57 VanDerWaalsContact C-N 3.35Å; R55-M57 PolarHBondContact O-N 3.47Å; M57-L61 WeakPolarHBondContact O-CB 3.41Å; M57-L61 PolarHBondContact O-N 3.34Å
58	K	97.7	Very high	97.9	Very high	122 Å²	122	107 Å²	107	53%	0.53	52%	0.519	S	S	.	.	H	α-helix	trans	-62.5	-45.1	174.1	-77.9	173.4	170.4	170.5	0	111.6	E54 R55 R56 L61 A62	E54-K58 HydrophobicContact CG-CD 4.42Å; E54-K58 WeakPolarHBondContact O-CG 3.37Å; E54-K58 PolarHBondContact O-N 2.94Å; E54-K58 WeakPolarHBondContact OE1-CE 3.41Å; E54-K58 IonicContact OE1-NZ 2.66Å; E54-K58 PolarHBondContact OE1-NZ 3.23Å; R55-K58 WeakPolarHBondContact O-CB 3.41Å; R55-K58 PolarHBondContact O-N 3.47Å; R55-K58 VanDerWaalsContact O-N 3.16Å; R56-K58 VanDerWaalsContact C-N 3.32Å; R56-K58 PolarHBondContact O-N 3.25Å; K58-L61 PolarHBondContact O-N 3.03Å; K58-A62 WeakPolarHBondContact O-CB 3.31Å; K58-A62 PolarHBondContact O-N 3.38Å
59	D	97.9	Very high	97.9	Very high	101 Å²	101	110.2 Å²	110.2	54%	0.54	52%	0.524	S	S	.	.	H	α-helix	trans	-65.9	-45.7	180	-63.7	-22.5	0	0	0	111.5	R55 R56 L61 A62 Q63	R55-D59 VanDerWaalsContact O-CG 3.27Å; R55-D59 PolarHBondContact O-N 3.09Å; R56-D59 PolarHBondContact O-N 3.45Å; D59-L61 VanDerWaalsContact C-N 3.33Å; D59-L61 PolarHBondContact O-N 3.13Å; D59-A62 PolarHBondContact O-N 2.95Å; D59-Q63 WeakPolarHBondContact O-CB 3.37Å; D59-Q63 PolarHBondContact O-N 2.89Å
60	E	97.9	Very high	97.9	Very high	91 Å²	91	109.8 Å²	109.8	43%	0.425	52%	0.522	S	S	.	.	H	α-helix	trans	-62.2	-39.7	176.2	-75	177.5	-160.4	0	0	112.2	R56 K64	R56-E60 HydrophobicContact CG-CG 4.32Å; R56-E60 VanDerWaalsContact CG-OE1 3.23Å; R56-E60 WeakPolarHBondContact CG-OE1 3.39Å; R56-E60 WeakPolarHBondContact O-CB 3.43Å; R56-E60 WeakPolarHBondContact O-CG 3.32Å; R56-E60 PolarHBondContact O-N 3.11Å; E60-K64 WeakPolarHBondContact O-CB 3.46Å; E60-K64 WeakPolarHBondContact O-CG 3.44Å; E60-K64 PolarHBondContact O-N 3.3Å
61	L	97.9	Very high	97.9	Very high	123 Å²	123	111.8 Å²	111.8	64%	0.644	52%	0.521	S	S	*	.	H	α-helix	trans	-68.4	-42.5	177.3	-175.4	63.9	0	0	0	111.3	M57 K58 D59 Q63 K64 F65	M57-L61 WeakPolarHBondContact O-CB 3.41Å; M57-L61 PolarHBondContact O-N 3.34Å; K58-L61 PolarHBondContact O-N 3.03Å; D59-L61 VanDerWaalsContact C-N 3.33Å; D59-L61 PolarHBondContact O-N 3.13Å; L61-Q63 VanDerWaalsContact C-N 3.34Å; L61-K64 PolarHBondContact O-N 3.46Å; L61-F65 WeakPolarHBondContact O-CB 3.49Å; L61-F65 PolarHBondContact O-N 2.96Å
62	A	97.5	Very high	97.9	Very high	50 Å²	50	108.9 Å²	108.9	41%	0.413	52%	0.516	S	S	.	.	H	α-helix	trans	-62.4	-42.7	176.5	0	0	0	0	0	111.4	K58 D59 F65 N66	K58-A62 WeakPolarHBondContact O-CB 3.31Å; K58-A62 PolarHBondContact O-N 3.38Å; D59-A62 PolarHBondContact O-N 2.95Å; A62-F65 PolarHBondContact O-N 3.49Å; A62-N66 VanDerWaalsContact O-CG 3.29Å; A62-N66 PolarHBondContact O-N 3.45Å; A62-N66 PolarHBondContact O-ND2 3.38Å
63	Q	98	Very high	97.8	Very high	122 Å²	122	108.7 Å²	108.7	57%	0.57	52%	0.515	S	S	*	.	H	α-helix	trans	-60.7	-51.8	175	-175.2	176.7	1.8	0	0	111.4	D59 L61 F65 N66 D67	D59-Q63 WeakPolarHBondContact O-CB 3.37Å; D59-Q63 PolarHBondContact O-N 2.89Å; L61-Q63 VanDerWaalsContact C-N 3.34Å; Q63-F65 VanDerWaalsContact C-N 3.26Å; Q63-F65 PolarHBondContact O-N 3.12Å; Q63-N66 PolarHBondContact O-N 3.04Å; Q63-N66 VanDerWaalsContact O-N 3.1Å; Q63-D67 PolarHBondContact O-N 2.94Å
64	K	98	Very high	97.8	Very high	132 Å²	132	110.9 Å²	110.9	57%	0.574	52%	0.522	S	S	*	.	H	α-helix	trans	-58.7	-37.7	178	-76.8	177.6	178.7	175.8	0	112.8	E60 L61 L68	E60-K64 WeakPolarHBondContact O-CB 3.46Å; E60-K64 WeakPolarHBondContact O-CG 3.44Å; E60-K64 PolarHBondContact O-N 3.3Å; L61-K64 PolarHBondContact O-N 3.46Å; K64-L68 WeakPolarHBondContact O-CB 3.47Å; K64-L68 VanDerWaalsContact O-CG 3.32Å; K64-L68 WeakPolarHBondContact O-CG 3.45Å; K64-L68 PolarHBondContact O-N 3.2Å
65	F	98.2	Very high	97.8	Very high	137 Å²	137	110.3 Å²	110.3	60%	0.601	53%	0.525	S	S	*	.	H	α-helix	trans	-65.8	-42.3	177	-174.3	-95.7	0	0	0	111.7	L61 A62 Q63 L68 K69	L61-F65 WeakPolarHBondContact O-CB 3.49Å; L61-F65 PolarHBondContact O-N 2.96Å; A62-F65 PolarHBondContact O-N 3.49Å; Q63-F65 VanDerWaalsContact C-N 3.26Å; Q63-F65 PolarHBondContact O-N 3.12Å; F65-L68 PolarHBondContact O-N 3.42Å; F65-K69 WeakPolarHBondContact O-CB 3.44Å; F65-K69 PolarHBondContact O-N 2.91Å
66	N	98.2	Very high	97.8	Very high	100 Å²	100	108.8 Å²	108.8	54%	0.535	52%	0.524	S	S	.	.	H	α-helix	trans	-64.4	-44.3	176	-70.1	-23.7	0	0	0	111.8	A62 Q63 L68 K69 E70	A62-N66 VanDerWaalsContact O-CG 3.29Å; A62-N66 PolarHBondContact O-N 3.45Å; A62-N66 PolarHBondContact O-ND2 3.38Å; Q63-N66 PolarHBondContact O-N 3.04Å; Q63-N66 VanDerWaalsContact O-N 3.1Å; N66-L68 VanDerWaalsContact C-N 3.32Å; N66-L68 PolarHBondContact O-N 3.01Å; N66-K69 WeakPolarHBondContact O-CB 3.37Å; N66-K69 PolarHBondContact O-N 3.33Å; N66-E70 PolarHBondContact O-N 2.9Å
67	D	98.2	Very high	97.7	Very high	77 Å²	77	105.4 Å²	105.4	41%	0.412	52%	0.521	S	S	.	.	H	α-helix	trans	-61.5	-41.3	177.4	-64.6	-12.4	0	0	0	111.6	Q63 R71	Q63-D67 PolarHBondContact O-N 2.94Å; D67-R71 VanDerWaalsContact O-CG 3.31Å; D67-R71 WeakPolarHBondContact O-CG 3.48Å; D67-R71 PolarHBondContact O-N 2.93Å; D67-R71 VanDerWaalsContact O-N 3.1Å
68	L	98.1	Very high	97.7	Very high	106 Å²	106	106 Å²	106	56%	0.555	52%	0.522	S	S	*	.	H	α-helix	trans	-66.1	-39.6	176.1	-78.5	172.2	0	0	0	112.1	K64 F65 N66 R71 L72	K64-L68 WeakPolarHBondContact O-CB 3.47Å; K64-L68 VanDerWaalsContact O-CG 3.32Å; K64-L68 WeakPolarHBondContact O-CG 3.45Å; K64-L68 PolarHBondContact O-N 3.2Å; F65-L68 PolarHBondContact O-N 3.42Å; N66-L68 VanDerWaalsContact C-N 3.32Å; N66-L68 PolarHBondContact O-N 3.01Å; L68-R71 PolarHBondContact O-N 3.42Å; L68-L72 WeakPolarHBondContact O-CB 3.47Å; L68-L72 PolarHBondContact O-N 3.1Å
69	K	97.9	Very high	97.7	Very high	116 Å²	116	104.8 Å²	104.8	50%	0.504	52%	0.522	S	S	.	.	H	α-helix	trans	-63.6	-47	176.7	-176.2	-179.7	176.2	-175.2	0	111.2	F65 N66 R71 L72 D73	F65-K69 WeakPolarHBondContact O-CB 3.44Å; F65-K69 PolarHBondContact O-N 2.91Å; N66-K69 WeakPolarHBondContact O-CB 3.37Å; N66-K69 PolarHBondContact O-N 3.33Å; K69-R71 VanDerWaalsContact C-N 3.31Å; K69-R71 PolarHBondContact O-N 3.32Å; K69-L72 WeakPolarHBondContact O-CB 3.41Å; K69-L72 PolarHBondContact O-N 3.1Å; K69-L72 VanDerWaalsContact O-N 3.12Å; K69-D73 PolarHBondContact O-N 3.37Å
70	E	97.9	Very high	97.6	Very high	114 Å²	114	103.9 Å²	103.9	53%	0.533	52%	0.52	S	S	.	.	H	α-helix	trans	-60.1	-42.1	177.9	-174.5	178.8	179.9	0	0	111.8	N66 L72 D73 Q74	N66-E70 PolarHBondContact O-N 2.9Å; E70-L72 VanDerWaalsContact C-N 3.34Å; E70-L72 PolarHBondContact O-N 3.01Å; E70-D73 PolarHBondContact O-N 3Å; E70-Q74 WeakPolarHBondContact O-CG 3.33Å; E70-Q74 PolarHBondContact O-N 3.4Å
71	R	97.4	Very high	97.5	Very high	161 Å²	161	104.4 Å²	104.4	61%	0.608	53%	0.525	S	S	*	.	H	α-helix	trans	-64.5	-37.7	174.9	-72.8	175	63.8	-163	-2.1	112.8	D67 L68 K69 Q74 V75	D67-R71 VanDerWaalsContact O-CG 3.31Å; D67-R71 WeakPolarHBondContact O-CG 3.48Å; D67-R71 PolarHBondContact O-N 2.93Å; D67-R71 VanDerWaalsContact O-N 3.1Å; L68-R71 PolarHBondContact O-N 3.42Å; K69-R71 VanDerWaalsContact C-N 3.31Å; K69-R71 PolarHBondContact O-N 3.32Å; R71-Q74 PolarHBondContact O-N 2.93Å; R71-V75 WeakPolarHBondContact O-CG2 3.37Å; R71-V75 PolarHBondContact O-N 3Å
72	L	97.7	Very high	97.5	Very high	96 Å²	96	103.9 Å²	103.9	50%	0.503	52%	0.523	S	S	.	.	H	α-helix	trans	-63.7	-47.8	175.9	-179.6	62.5	0	0	0	110.6	L68 K69 E70 Q74 V75 E76	L68-L72 WeakPolarHBondContact O-CB 3.47Å; L68-L72 PolarHBondContact O-N 3.1Å; K69-L72 WeakPolarHBondContact O-CB 3.41Å; K69-L72 PolarHBondContact O-N 3.1Å; K69-L72 VanDerWaalsContact O-N 3.12Å; E70-L72 VanDerWaalsContact C-N 3.34Å; E70-L72 PolarHBondContact O-N 3.01Å; L72-Q74 PolarHBondContact O-N 3.27Å; L72-V75 PolarHBondContact O-N 3.16Å; L72-V75 VanDerWaalsContact O-N 3.11Å; L72-E76 HydrophobicContact CD1-CG 4.42Å; L72-E76 WeakPolarHBondContact O-CG 3.31Å; L72-E76 PolarHBondContact O-N 3.46Å
73	D	97.7	Very high	97.4	Very high	84 Å²	84	105.3 Å²	105.3	45%	0.449	52%	0.523	S	S	.	.	H	α-helix	trans	-59	-38.1	178.3	-64.8	-18	0	0	0	111.2	K69 E70 S77	K69-D73 PolarHBondContact O-N 3.37Å; E70-D73 PolarHBondContact O-N 3Å; D73-S77 WeakPolarHBondContact O-CB 3.37Å; D73-S77 PolarHBondContact O-N 3.43Å; D73-S77 VanDerWaalsContact O-N 3.09Å
74	Q	97.6	Very high	97.2	Very high	100 Å²	100	102.8 Å²	102.8	47%	0.467	52%	0.515	S	S	.	.	H	α-helix	trans	-64.2	-47.5	173.7	-72.4	171.8	5.8	0	0	112.4	E70 R71 L72 E76 S77 E78	E70-Q74 WeakPolarHBondContact O-CG 3.33Å; E70-Q74 PolarHBondContact O-N 3.4Å; R71-Q74 PolarHBondContact O-N 2.93Å; L72-Q74 PolarHBondContact O-N 3.27Å; Q74-E76 VanDerWaalsContact C-N 3.33Å; Q74-E76 PolarHBondContact O-N 2.96Å; Q74-S77 WeakPolarHBondContact O-CB 3.2Å; Q74-S77 PolarHBondContact O-N 3.41Å; Q74-E78 WeakPolarHBondContact O-CG 3.32Å; Q74-E78 PolarHBondContact O-N 2.91Å
75	V	97.3	Very high	97.1	Very high	85 Å²	85	99.3 Å²	99.3	52%	0.515	51%	0.511	S	S	.	.	H	α-helix	trans	-62.9	-40	178.1	171.3	0	0	0	0	111.4	R71 L72 S77 E78 L79	R71-V75 WeakPolarHBondContact O-CG2 3.37Å; R71-V75 PolarHBondContact O-N 3Å; L72-V75 PolarHBondContact O-N 3.16Å; L72-V75 VanDerWaalsContact O-N 3.11Å; V75-S77 VanDerWaalsContact C-N 3.33Å; V75-S77 PolarHBondContact O-N 2.87Å; V75-E78 PolarHBondContact O-N 2.94Å; V75-L79 VanDerWaalsContact O-CB 3.31Å; V75-L79 WeakPolarHBondContact O-CB 3.48Å; V75-L79 PolarHBondContact O-N 3.28Å
76	E	97	Very high	96.8	Very high	107 Å²	107	95.2 Å²	95.2	50%	0.5	50%	0.503	S	S	.	.	H	α-helix	trans	-62.4	-40.6	176.3	-73.4	-175	167.5	0	0	112	L72 Q74 T80	L72-E76 HydrophobicContact CD1-CG 4.42Å; L72-E76 WeakPolarHBondContact O-CG 3.31Å; L72-E76 PolarHBondContact O-N 3.46Å; Q74-E76 VanDerWaalsContact C-N 3.33Å; Q74-E76 PolarHBondContact O-N 2.96Å; E76-T80 WeakPolarHBondContact O-CB 3.42Å; E76-T80 PolarHBondContact O-N 3.02Å; E76-T80 PolarHBondContact O-OG1 3.42Å
77	S	97	Very high	96.6	Very high	66 Å²	66	96.4 Å²	96.4	46%	0.462	51%	0.505	S	S	.	.	H	α-helix	trans	-63.6	-47.6	173.9	-176.5	0	0	0	0	112.1	D73 Q74 V75 L79 T80 N81	D73-S77 WeakPolarHBondContact O-CB 3.37Å; D73-S77 PolarHBondContact O-N 3.43Å; D73-S77 VanDerWaalsContact O-N 3.09Å; Q74-S77 WeakPolarHBondContact O-CB 3.2Å; Q74-S77 PolarHBondContact O-N 3.41Å; V75-S77 VanDerWaalsContact C-N 3.33Å; V75-S77 PolarHBondContact O-N 2.87Å; S77-L79 PolarHBondContact O-N 2.66Å; S77-T80 PolarHBondContact O-N 3.42Å; S77-N81 PolarHBondContact O-N 2.84Å; S77-N81 PolarHBondContact O-ND2 2.88Å; S77-N81 VanDerWaalsContact O-ND2 3.13Å
78	E	96.5	Very high	96.5	Very high	135 Å²	135	97.4 Å²	97.4	63%	0.631	51%	0.51	S	S	*	.	H	α-helix	trans	-61.2	-43.1	177.3	-73.6	-178.9	-179.6	0	0	112.4	Q74 V75 N81 L82	Q74-E78 WeakPolarHBondContact O-CG 3.32Å; Q74-E78 PolarHBondContact O-N 2.91Å; V75-E78 PolarHBondContact O-N 2.94Å; E78-N81 PolarHBondContact O-N 3.4Å; E78-L82 WeakPolarHBondContact O-CB 3.36Å; E78-L82 PolarHBondContact O-N 2.96Å
79	L	97.1	Very high	96.2	Very high	98 Å²	98	98.3 Å²	98.3	51%	0.513	52%	0.515	S	S	.	.	H	α-helix	trans	-63.3	-42.6	177.4	-178.5	62.1	0	0	0	111.3	V75 S77 N81 L82 I83	V75-L79 VanDerWaalsContact O-CB 3.31Å; V75-L79 WeakPolarHBondContact O-CB 3.48Å; V75-L79 PolarHBondContact O-N 3.28Å; S77-L79 PolarHBondContact O-N 2.66Å; L79-N81 VanDerWaalsContact C-N 3.34Å; L79-N81 PolarHBondContact O-N 3.05Å; L79-L82 PolarHBondContact O-N 3.3Å; L79-I83 HydrophobicContact CD1-CD1 4.46Å; L79-I83 HydrophobicContact CG-CD1 4.13Å; L79-I83 WeakPolarHBondContact O-CG1 3.4Å; L79-I83 PolarHBondContact O-N 3.49Å
80	T	96.7	Very high	95.8	Very high	82 Å²	82	99.9 Å²	99.9	50%	0.503	52%	0.519	S	S	.	.	H	α-helix	trans	-60.2	-45.9	176.2	-59.4	0	0	0	0	110.9	E76 S77 L82 I83 V84	E76-T80 WeakPolarHBondContact O-CB 3.42Å; E76-T80 PolarHBondContact O-N 3.02Å; E76-T80 PolarHBondContact O-OG1 3.42Å; S77-T80 PolarHBondContact O-N 3.42Å; T80-L82 VanDerWaalsContact C-N 3.32Å; T80-L82 PolarHBondContact O-N 3.49Å; T80-I83 PolarHBondContact O-N 3.2Å; T80-V84 WeakPolarHBondContact O-CG2 3.42Å; T80-V84 PolarHBondContact O-N 3.36Å; T80-V84 VanDerWaalsContact O-N 3.07Å
81	N	96.4	Very high	95.5	Very high	101 Å²	101	96.7 Å²	96.7	54%	0.54	51%	0.512	S	S	.	.	H	α-helix	trans	-62.3	-39.1	176.6	-69.8	-35.6	0	0	0	112.2	S77 E78 L79 V84 A85	S77-N81 PolarHBondContact O-N 2.84Å; S77-N81 PolarHBondContact O-ND2 2.88Å; S77-N81 VanDerWaalsContact O-ND2 3.13Å; E78-N81 PolarHBondContact O-N 3.4Å; L79-N81 VanDerWaalsContact C-N 3.34Å; L79-N81 PolarHBondContact O-N 3.05Å; N81-V84 PolarHBondContact O-N 3.35Å; N81-A85 WeakPolarHBondContact O-CB 3.32Å; N81-A85 PolarHBondContact O-N 2.83Å
82	L	96.1	Very high	95.2	Very high	112 Å²	112	92.1 Å²	92.1	59%	0.586	50%	0.504	S	S	*	.	H	α-helix	trans	-65.5	-42	177.2	-170.3	152.4	0	0	0	111.7	E78 L79 T80 A85 A86	E78-L82 WeakPolarHBondContact O-CB 3.36Å; E78-L82 PolarHBondContact O-N 2.96Å; L79-L82 PolarHBondContact O-N 3.3Å; T80-L82 VanDerWaalsContact C-N 3.32Å; T80-L82 PolarHBondContact O-N 3.49Å; L82-A85 PolarHBondContact O-N 3.06Å; L82-A86 WeakPolarHBondContact O-CB 3.35Å; L82-A86 PolarHBondContact O-N 3.26Å
83	I	95.6	Very high	94.6	Very high	81 Å²	81	93.5 Å²	93.5	42%	0.415	50%	0.504	S	S	.	.	H	α-helix	trans	-59.6	-49.7	175.6	-69.9	165.2	0	0	0	110	L79 T80 A85 A86 E87	L79-I83 HydrophobicContact CD1-CD1 4.46Å; L79-I83 HydrophobicContact CG-CD1 4.13Å; L79-I83 WeakPolarHBondContact O-CG1 3.4Å; L79-I83 PolarHBondContact O-N 3.49Å; T80-I83 PolarHBondContact O-N 3.2Å; I83-A85 VanDerWaalsContact C-N 3.32Å; I83-A85 PolarHBondContact O-N 3.18Å; I83-A86 PolarHBondContact O-N 2.84Å; I83-A86 VanDerWaalsContact O-N 3.15Å; I83-E87 HydrophobicContact CG2-CG 4.47Å; I83-E87 WeakPolarHBondContact O-CG 3.36Å; I83-E87 PolarHBondContact O-N 3.42Å
84	V	95.2	Very high	94	Very high	69 Å²	69	93.3 Å²	93.3	42%	0.418	50%	0.502	S	S	.	.	H	α-helix	trans	-60.4	-41.7	178.3	172.8	0	0	0	0	111.4	T80 N81 E87 N88	T80-V84 WeakPolarHBondContact O-CG2 3.42Å; T80-V84 PolarHBondContact O-N 3.36Å; T80-V84 VanDerWaalsContact O-N 3.07Å; N81-V84 PolarHBondContact O-N 3.35Å; V84-E87 PolarHBondContact O-N 2.84Å; V84-N88 WeakPolarHBondContact O-CB 3.42Å; V84-N88 VanDerWaalsContact O-CG 3.25Å; V84-N88 PolarHBondContact O-N 2.96Å; V84-N88 PolarHBondContact O-ND2 3.33Å; V84-N88 VanDerWaalsContact O-ND2 3.15Å
85	A	94.5	Very high	93.5	Very high	58 Å²	58	96 Å²	96	48%	0.479	51%	0.514	S	S	.	.	H	α-helix	trans	-63.9	-41.2	176.3	0	0	0	0	0	112.3	N81 L82 I83 N88 L89	N81-A85 WeakPolarHBondContact O-CB 3.32Å; N81-A85 PolarHBondContact O-N 2.83Å; L82-A85 PolarHBondContact O-N 3.06Å; I83-A85 VanDerWaalsContact C-N 3.32Å; I83-A85 PolarHBondContact O-N 3.18Å; A85-N88 PolarHBondContact O-N 3.34Å; A85-L89 WeakPolarHBondContact O-CB 3.44Å; A85-L89 PolarHBondContact O-N 3.49Å
86	A	93.6	Very high	93	Very high	52 Å²	52	99 Å²	99	43%	0.43	52%	0.524	S	S	.	.	H	α-helix	trans	-66.2	-42.2	177.3	0	0	0	0	0	112.1	L82 I83 L89 Y90	L82-A86 WeakPolarHBondContact O-CB 3.35Å; L82-A86 PolarHBondContact O-N 3.26Å; I83-A86 PolarHBondContact O-N 2.84Å; I83-A86 VanDerWaalsContact O-N 3.15Å; A86-L89 PolarHBondContact O-N 2.88Å; A86-Y90 WeakPolarHBondContact O-CB 3.39Å; A86-Y90 PolarHBondContact O-N 3Å
87	E	94	Very high	92.5	Very high	124 Å²	124	96 Å²	96	58%	0.579	51%	0.511	S	S	*	.	H	α-helix	trans	-62	-44.4	175.2	-73.3	179	166.4	0	0	111.5	I83 V84 Y90 A91	I83-E87 HydrophobicContact CG2-CG 4.47Å; I83-E87 WeakPolarHBondContact O-CG 3.36Å; I83-E87 PolarHBondContact O-N 3.42Å; V84-E87 PolarHBondContact O-N 2.84Å; E87-Y90 PolarHBondContact O-N 2.95Å; E87-A91 WeakPolarHBondContact O-CB 3.23Å; E87-A91 PolarHBondContact O-N 3.33Å
88	N	94.6	Very high	92	Very high	98 Å²	98	94 Å²	94	52%	0.524	50%	0.5	S	S	.	.	H	α-helix	trans	-63.9	-41.1	176	-74.4	-30.3	0	0	0	112.4	V84 A85 A91 S92	V84-N88 WeakPolarHBondContact O-CB 3.42Å; V84-N88 VanDerWaalsContact O-CG 3.25Å; V84-N88 PolarHBondContact O-N 2.96Å; V84-N88 PolarHBondContact O-ND2 3.33Å; V84-N88 VanDerWaalsContact O-ND2 3.15Å; A85-N88 PolarHBondContact O-N 3.34Å; N88-A91 PolarHBondContact O-N 3.05Å; N88-S92 WeakPolarHBondContact O-CB 3.38Å; N88-S92 PolarHBondContact O-N 3.07Å; N88-S92 PolarHBondContact O-OG 3.08Å
89	L	92.8	Very high	91.6	Very high	126 Å²	126	91.7 Å²	91.7	66%	0.66	50%	0.497	S	S	*	.	H	α-helix	trans	-64.1	-43.3	175.5	-177.3	64.5	0	0	0	111	A85 A86 S92 Y93	A85-L89 WeakPolarHBondContact O-CB 3.44Å; A85-L89 PolarHBondContact O-N 3.49Å; A86-L89 PolarHBondContact O-N 2.88Å; L89-S92 PolarHBondContact O-N 3.27Å; L89-Y93 WeakPolarHBondContact O-CB 3.43Å; L89-Y93 PolarHBondContact O-N 2.95Å
90	Y	89.3	Confident	91.1	Very high	149 Å²	149	90.9 Å²	90.9	58%	0.584	49%	0.49	S	S	*	.	H	α-helix	trans	-63.4	-44.4	177.2	-177.8	-98.5	0	0	0	112	A86 E87 S92 Y93 M94	A86-Y90 WeakPolarHBondContact O-CB 3.39Å; A86-Y90 PolarHBondContact O-N 3Å; E87-Y90 PolarHBondContact O-N 2.95Å; Y90-S92 VanDerWaalsContact C-N 3.31Å; Y90-S92 PolarHBondContact O-N 2.89Å; Y90-Y93 WeakPolarHBondContact O-CB 3.34Å; Y90-Y93 PolarHBondContact O-N 3.47Å; Y90-M94 HydrophobicContact CD1-CG 4.19Å; Y90-M94 HydrophobicContact CE1-CG 3.73Å; Y90-M94 HydrophobicContact CE2-CG 4.3Å; Y90-M94 WeakPolarHBondContact O-CG 3.32Å; Y90-M94 PolarHBondContact O-N 2.9Å
91	A	90.9	Very high	90.6	Very high	46 Å²	46	91.2 Å²	91.2	38%	0.38	49%	0.488	S	S	.	.	H	α-helix	trans	-59	-43.8	174.3	0	0	0	0	0	111.6	E87 N88 M94 Q95	E87-A91 WeakPolarHBondContact O-CB 3.23Å; E87-A91 PolarHBondContact O-N 3.33Å; N88-A91 PolarHBondContact O-N 3.05Å; A91-M94 PolarHBondContact O-N 3.35Å; A91-Q95 WeakPolarHBondContact O-CG 3.46Å; A91-Q95 PolarHBondContact O-N 3.13Å
92	S	90.8	Very high	90.1	Very high	65 Å²	65	88.8 Å²	88.8	46%	0.455	48%	0.482	S	S	.	.	H	α-helix	trans	-64.8	-42.1	177.8	-56.3	0	0	0	0	111.8	N88 L89 Y90 Q95 M96	N88-S92 WeakPolarHBondContact O-CB 3.38Å; N88-S92 PolarHBondContact O-N 3.07Å; N88-S92 PolarHBondContact O-OG 3.08Å; L89-S92 PolarHBondContact O-N 3.27Å; Y90-S92 VanDerWaalsContact C-N 3.31Å; Y90-S92 PolarHBondContact O-N 2.89Å; S92-Q95 PolarHBondContact O-N 2.96Å; S92-M96 PolarHBondContact O-N 3.03Å
93	Y	85.6	Confident	89.7	Confident	125 Å²	125	89.5 Å²	89.5	49%	0.49	48%	0.481	S	S	.	.	H	α-helix	trans	-60	-45.5	174	174.9	-96	0	0	0	111.6	L89 Y90 Q95 M96 M97	L89-Y93 WeakPolarHBondContact O-CB 3.43Å; L89-Y93 PolarHBondContact O-N 2.95Å; Y90-Y93 WeakPolarHBondContact O-CB 3.34Å; Y90-Y93 PolarHBondContact O-N 3.47Å; Y93-Q95 PolarHBondContact O-N 2.97Å; Y93-M96 PolarHBondContact O-N 2.92Å; Y93-M97 HydrophobicContact CD2-CG 3.86Å; Y93-M97 HydrophobicContact CE1-CB 4.3Å; Y93-M97 HydrophobicContact CE1-CG 4.25Å; Y93-M97 HydrophobicContact CE2-CB 4.36Å; Y93-M97 HydrophobicContact CE2-CG 3.46Å; Y93-M97 VanDerWaalsContact CE2-CG 3.46Å; Y93-M97 HydrophobicContact CG-CG 4.42Å; Y93-M97 WeakPolarHBondContact O-CB 3.4Å; Y93-M97 PolarHBondContact O-N 3.19Å
94	M	84.9	Confident	89.4	Confident	81 Å²	81	91.7 Å²	91.7	40%	0.399	49%	0.487	S	S	.	.	H	α-helix	trans	-66.5	-34.6	178.2	-72.4	-60.9	-69.7	0	0	112.9	Y90 A91 M96 G98	Y90-M94 HydrophobicContact CD1-CG 4.19Å; Y90-M94 HydrophobicContact CE1-CG 3.73Å; Y90-M94 HydrophobicContact CE2-CG 4.3Å; Y90-M94 WeakPolarHBondContact O-CG 3.32Å; Y90-M94 PolarHBondContact O-N 2.9Å; A91-M94 PolarHBondContact O-N 3.35Å; M94-M96 VanDerWaalsContact C-N 3.34Å; M94-G98 WeakPolarHBondContact O-CA 3.42Å; M94-G98 PolarHBondContact O-N 3.41Å
95	Q	88	Confident	89	Confident	156 Å²	156	96.6 Å²	96.6	73%	0.729	50%	0.498	S	S	*	.	H	α-helix	trans	-65.2	-38.8	172.9	-74.6	179.3	2.4	0	0	112.1	A91 S92 Y93 P99	A91-Q95 WeakPolarHBondContact O-CG 3.46Å; A91-Q95 PolarHBondContact O-N 3.13Å; S92-Q95 PolarHBondContact O-N 2.96Å; Y93-Q95 PolarHBondContact O-N 2.97Å; Q95-P99 WeakPolarHBondContact O-CD 3.39Å
96	M	85.7	Confident	88.8	Confident	147 Å²	147	99.8 Å²	99.8	72%	0.724	50%	0.503	S	S	*	.	H	α-helix	trans	-76	-48.6	-179.5	-172.7	-175.4	-60.3	0	0	112.5	S92 Y93 M94	S92-M96 PolarHBondContact O-N 3.03Å; Y93-M96 PolarHBondContact O-N 2.92Å; M94-M96 VanDerWaalsContact C-N 3.34Å
97	M	88	Confident	88.5	Confident	45 Å²	45	100.6 Å²	100.6	22%	0.222	50%	0.503	C	S	.	.	H	α-helix	trans	-91.1	-18.3	-173.1	-63.3	-60.9	-64.2	0	0	113.2	Y93 E100 I101	Y93-M97 HydrophobicContact CD2-CG 3.86Å; Y93-M97 HydrophobicContact CE1-CB 4.3Å; Y93-M97 HydrophobicContact CE1-CG 4.25Å; Y93-M97 HydrophobicContact CE2-CB 4.36Å; Y93-M97 HydrophobicContact CE2-CG 3.46Å; Y93-M97 VanDerWaalsContact CE2-CG 3.46Å; Y93-M97 HydrophobicContact CG-CG 4.42Å; Y93-M97 WeakPolarHBondContact O-CB 3.4Å; Y93-M97 PolarHBondContact O-N 3.19Å; M97-E100 WeakPolarHBondContact CE-OE2 3.46Å; M97-E100 PolarHBondContact O-N 2.94Å; M97-E100 VanDerWaalsContact O-N 3.09Å; M97-I101 HydrophobicContact CB-CD1 4.15Å; M97-I101 VanDerWaalsContact O-CG1 3.29Å; M97-I101 WeakPolarHBondContact O-CG1 3.33Å; M97-I101 PolarHBondContact O-N 3.15Å
98	G	85.4	Confident	88.4	Confident	23 Å²	23	97.7 Å²	97.7	24%	0.237	50%	0.496	C	S	.	.	H	α-helix	trans	-52.1	-48.8	179.4	0	0	0	0	0	113.3	M94 E100 I101 A102	M94-G98 WeakPolarHBondContact O-CA 3.42Å; M94-G98 PolarHBondContact O-N 3.41Å; G98-E100 PolarHBondContact O-N 2.86Å; G98-I101 PolarHBondContact O-N 3.44Å; G98-A102 WeakPolarHBondContact O-CB 3.4Å; G98-A102 PolarHBondContact O-N 2.93Å
99	P	87.6	Confident	88.3	Confident	87 Å²	87	97.5 Å²	97.5	57%	0.565	49%	0.492	S	S	*	.	H	α-helix	trans	-61.4	-40.5	175.1	-25	35	0	0	0	113.6	Q95 A102 F103	Q95-P99 WeakPolarHBondContact O-CD 3.39Å; P99-A102 PolarHBondContact O-N 3.44Å; P99-F103 WeakPolarHBondContact O-CB 3.4Å; P99-F103 PolarHBondContact O-N 3.26Å
100	E	88.3	Confident	88.2	Confident	81 Å²	81	96.5 Å²	96.5	38%	0.379	49%	0.487	S	S	.	.	H	α-helix	trans	-66.2	-43.9	177.5	-171.2	-171.5	151.3	0	0	111.4	M97 G98 A102 F103 K104	M97-E100 WeakPolarHBondContact CE-OE2 3.46Å; M97-E100 PolarHBondContact O-N 2.94Å; M97-E100 VanDerWaalsContact O-N 3.09Å; G98-E100 PolarHBondContact O-N 2.86Å; E100-A102 VanDerWaalsContact C-N 3.33Å; E100-A102 PolarHBondContact O-N 3.37Å; E100-F103 PolarHBondContact O-N 3.47Å; E100-K104 WeakPolarHBondContact O-CG 3.23Å; E100-K104 PolarHBondContact O-N 2.97Å; E100-K104 WeakPolarHBondContact OE1-CE 3.39Å; E100-K104 IonicContact OE1-NZ 2.66Å; E100-K104 PolarHBondContact OE1-NZ 3.31Å
101	I	86.1	Confident	88.3	Confident	90 Å²	90	97 Å²	97	46%	0.462	49%	0.488	S	S	.	.	H	α-helix	trans	-60.6	-44.9	175.7	-66.9	166.2	0	0	0	110	M97 G98 R105	M97-I101 HydrophobicContact CB-CD1 4.15Å; M97-I101 VanDerWaalsContact O-CG1 3.29Å; M97-I101 WeakPolarHBondContact O-CG1 3.33Å; M97-I101 PolarHBondContact O-N 3.15Å; G98-I101 PolarHBondContact O-N 3.44Å; I101-R105 PolarHBondContact O-N 3.3Å; I101-R105 VanDerWaalsContact O-N 3.11Å
102	A	86	Confident	88.4	Confident	49 Å²	49	98.8 Å²	98.8	41%	0.405	49%	0.491	S	S	.	.	H	α-helix	trans	-64.3	-42.7	177.7	0	0	0	0	0	112.1	G98 P99 E100 R105 Q106	G98-A102 WeakPolarHBondContact O-CB 3.4Å; G98-A102 PolarHBondContact O-N 2.93Å; P99-A102 PolarHBondContact O-N 3.44Å; E100-A102 VanDerWaalsContact C-N 3.33Å; E100-A102 PolarHBondContact O-N 3.37Å; A102-R105 WeakPolarHBondContact O-CB 3.31Å; A102-R105 PolarHBondContact O-N 3.41Å; A102-Q106 WeakPolarHBondContact O-CG 3.43Å; A102-Q106 PolarHBondContact O-N 2.94Å
103	F	86.2	Confident	88.5	Confident	127 Å²	127	100.6 Å²	100.6	56%	0.557	50%	0.495	S	S	*	.	H	α-helix	trans	-64.6	-46.6	177.2	177.5	-103.3	0	0	0	112.1	P99 E100 R105 Q106 V107	P99-F103 WeakPolarHBondContact O-CB 3.4Å; P99-F103 PolarHBondContact O-N 3.26Å; E100-F103 PolarHBondContact O-N 3.47Å; F103-R105 PolarHBondContact O-N 2.84Å; F103-Q106 PolarHBondContact O-N 3.26Å; F103-Q106 VanDerWaalsContact O-N 3.1Å; F103-V107 HydrophobicContact CD1-CG2 4.13Å; F103-V107 HydrophobicContact CD2-CG2 4.33Å; F103-V107 HydrophobicContact CE1-CG2 3.63Å; F103-V107 HydrophobicContact CE2-CG2 3.86Å; F103-V107 HydrophobicContact CG-CG2 4.46Å; F103-V107 HydrophobicContact CZ-CG2 3.48Å; F103-V107 VanDerWaalsContact CZ-CG2 3.48Å; F103-V107 WeakPolarHBondContact O-CG2 3.39Å; F103-V107 PolarHBondContact O-N 3.36Å
104	K	89.2	Confident	88.8	Confident	127 Å²	127	98 Å²	98	55%	0.552	49%	0.49	S	S	*	.	H	α-helix	trans	-56	-39.6	175.1	-78.1	-179.8	-176.1	167.8	0	111.6	E100 V107 S108	E100-K104 WeakPolarHBondContact O-CG 3.23Å; E100-K104 PolarHBondContact O-N 2.97Å; E100-K104 WeakPolarHBondContact OE1-CE 3.39Å; E100-K104 IonicContact OE1-NZ 2.66Å; E100-K104 PolarHBondContact OE1-NZ 3.31Å; K104-V107 PolarHBondContact O-N 2.91Å; K104-S108 PolarHBondContact O-N 3.4Å
105	R	87.7	Confident	89.1	Confident	173 Å²	173	95.8 Å²	95.8	65%	0.653	48%	0.481	S	S	*	.	H	α-helix	trans	-63.8	-47.1	175	-173.4	178.3	177.5	153.2	4.4	112.1	I101 A102 F103 V107 S108 E109	I101-R105 PolarHBondContact O-N 3.3Å; I101-R105 VanDerWaalsContact O-N 3.11Å; A102-R105 WeakPolarHBondContact O-CB 3.31Å; A102-R105 PolarHBondContact O-N 3.41Å; F103-R105 PolarHBondContact O-N 2.84Å; R105-V107 VanDerWaalsContact C-N 3.34Å; R105-V107 PolarHBondContact O-N 3.4Å; R105-S108 WeakPolarHBondContact O-CB 3.49Å; R105-S108 PolarHBondContact O-N 3.37Å; R105-E109 WeakPolarHBondContact CG-OE1 3.44Å; R105-E109 IonicContact NE-OE1 3.22Å; R105-E109 PolarHBondContact NE-OE1 3.47Å; R105-E109 WeakPolarHBondContact O-CG 3.44Å; R105-E109 PolarHBondContact O-N 3.01Å
106	Q	89.3	Confident	89.3	Confident	124 Å²	124	92.6 Å²	92.6	58%	0.579	47%	0.469	S	S	*	.	H	α-helix	trans	-61.3	-40.2	176.6	-72.7	177.6	-2.1	0	0	112.7	A102 F103 E109 L110	A102-Q106 WeakPolarHBondContact O-CG 3.43Å; A102-Q106 PolarHBondContact O-N 2.94Å; F103-Q106 PolarHBondContact O-N 3.26Å; F103-Q106 VanDerWaalsContact O-N 3.1Å; Q106-E109 PolarHBondContact O-N 2.93Å; Q106-L110 WeakPolarHBondContact O-CB 3.44Å; Q106-L110 PolarHBondContact O-N 2.9Å
107	V	89.2	Confident	89.6	Confident	69 Å²	69	92.7 Å²	92.7	42%	0.418	47%	0.466	S	S	.	.	H	α-helix	trans	-64.9	-41	176.2	172.4	0	0	0	0	111	F103 K104 R105 L110 W111	F103-V107 HydrophobicContact CD1-CG2 4.13Å; F103-V107 HydrophobicContact CD2-CG2 4.33Å; F103-V107 HydrophobicContact CE1-CG2 3.63Å; F103-V107 HydrophobicContact CE2-CG2 3.86Å; F103-V107 HydrophobicContact CG-CG2 4.46Å; F103-V107 HydrophobicContact CZ-CG2 3.48Å; F103-V107 VanDerWaalsContact CZ-CG2 3.48Å; F103-V107 WeakPolarHBondContact O-CG2 3.39Å; F103-V107 PolarHBondContact O-N 3.36Å; K104-V107 PolarHBondContact O-N 2.91Å; R105-V107 VanDerWaalsContact C-N 3.34Å; R105-V107 PolarHBondContact O-N 3.4Å; V107-L110 PolarHBondContact O-N 3.24Å; V107-W111 WeakPolarHBondContact O-CB 3.49Å; V107-W111 PolarHBondContact O-N 3.33Å
108	S	91.2	Very high	89.6	Confident	64 Å²	64	95 Å²	95	45%	0.448	48%	0.477	S	S	.	.	H	α-helix	trans	-61.2	-47.6	174.3	-166	0	0	0	0	111.6	K104 R105 L110 W111 D112	K104-S108 PolarHBondContact O-N 3.4Å; R105-S108 WeakPolarHBondContact O-CB 3.49Å; R105-S108 PolarHBondContact O-N 3.37Å; S108-L110 VanDerWaalsContact C-N 3.31Å; S108-L110 PolarHBondContact O-N 3.28Å; S108-W111 WeakPolarHBondContact O-CB 3.36Å; S108-W111 PolarHBondContact O-N 2.96Å; S108-W111 VanDerWaalsContact O-N 3.15Å; S108-D112 PolarHBondContact O-N 3.44Å
109	E	91.5	Very high	89.9	Confident	94 Å²	94	99.6 Å²	99.6	44%	0.439	49%	0.492	S	S	.	.	H	α-helix	trans	-61.5	-39.6	177.5	-71.7	170	-171.4	0	0	111.5	R105 Q106 N113	R105-E109 WeakPolarHBondContact CG-OE1 3.44Å; R105-E109 IonicContact NE-OE1 3.22Å; R105-E109 PolarHBondContact NE-OE1 3.47Å; R105-E109 WeakPolarHBondContact O-CG 3.44Å; R105-E109 PolarHBondContact O-N 3.01Å; Q106-E109 PolarHBondContact O-N 2.93Å; E109-N113 WeakPolarHBondContact O-CB 3.38Å; E109-N113 PolarHBondContact O-N 3.04Å; E109-N113 PolarHBondContact O-ND2 3.18Å
110	L	91.4	Very high	90.1	Very high	104 Å²	104	98.5 Å²	98.5	55%	0.545	49%	0.487	S	S	.	.	H	α-helix	trans	-64.6	-41.8	174.3	-176.1	67.5	0	0	0	111.8	Q106 V107 S108 N113 I114	Q106-L110 WeakPolarHBondContact O-CB 3.44Å; Q106-L110 PolarHBondContact O-N 2.9Å; V107-L110 PolarHBondContact O-N 3.24Å; S108-L110 VanDerWaalsContact C-N 3.31Å; S108-L110 PolarHBondContact O-N 3.28Å; L110-N113 PolarHBondContact O-N 3.47Å; L110-I114 HydrophobicContact CG-CD1 4.04Å; L110-I114 VanDerWaalsContact O-CG1 3.28Å; L110-I114 WeakPolarHBondContact O-CG1 3.35Å; L110-I114 PolarHBondContact O-N 3.33Å
111	W	91.8	Very high	90	Very high	160 Å²	160	96.5 Å²	96.5	61%	0.606	49%	0.485	S	S	*	.	H	α-helix	trans	-62.6	-46.3	177.7	-179.5	-97.5	0	0	0	111.7	V107 S108 N113 I114 C115	V107-W111 WeakPolarHBondContact O-CB 3.49Å; V107-W111 PolarHBondContact O-N 3.33Å; S108-W111 WeakPolarHBondContact O-CB 3.36Å; S108-W111 PolarHBondContact O-N 2.96Å; S108-W111 VanDerWaalsContact O-N 3.15Å; W111-N113 VanDerWaalsContact C-N 3.32Å; W111-N113 PolarHBondContact O-N 2.88Å; W111-I114 PolarHBondContact O-N 3.32Å; W111-I114 VanDerWaalsContact O-N 3.13Å; W111-C115 PolarHBondContact O-N 3.47Å
112	D	93.4	Very high	90	Very high	84 Å²	84	97.8 Å²	97.8	45%	0.449	49%	0.492	S	S	.	.	H	α-helix	trans	-59.7	-44.6	176.7	-66.8	-23.2	0	0	0	110.8	S108 I114 C115 D116	S108-D112 PolarHBondContact O-N 3.44Å; D112-I114 VanDerWaalsContact C-N 3.33Å; D112-I114 PolarHBondContact O-N 3.27Å; D112-C115 WeakPolarHBondContact O-CB 3.45Å; D112-C115 PolarHBondContact O-N 3.07Å; D112-D116 PolarHBondContact O-N 3.15Å
113	N	92.4	Very high	90.1	Very high	102 Å²	102	100.8 Å²	100.8	55%	0.545	50%	0.5	S	S	.	.	H	α-helix	trans	-60.8	-39.1	174.9	-72.2	-34	0	0	0	112.9	E109 L110 W111 F117	E109-N113 WeakPolarHBondContact O-CB 3.38Å; E109-N113 PolarHBondContact O-N 3.04Å; E109-N113 PolarHBondContact O-ND2 3.18Å; L110-N113 PolarHBondContact O-N 3.47Å; W111-N113 VanDerWaalsContact C-N 3.32Å; W111-N113 PolarHBondContact O-N 2.88Å; N113-F117 WeakPolarHBondContact O-CB 3.22Å; N113-F117 PolarHBondContact O-N 2.96Å
114	I	90.5	Very high	89.9	Confident	72 Å²	72	99.8 Å²	99.8	37%	0.369	50%	0.5	S	S	.	.	H	α-helix	trans	-67.1	-43.1	175.9	-71.1	165.9	0	0	0	110.3	L110 W111 D112 F117 M118	L110-I114 HydrophobicContact CG-CD1 4.04Å; L110-I114 VanDerWaalsContact O-CG1 3.28Å; L110-I114 WeakPolarHBondContact O-CG1 3.35Å; L110-I114 PolarHBondContact O-N 3.33Å; W111-I114 PolarHBondContact O-N 3.32Å; W111-I114 VanDerWaalsContact O-N 3.13Å; D112-I114 VanDerWaalsContact C-N 3.33Å; D112-I114 PolarHBondContact O-N 3.27Å; I114-F117 PolarHBondContact O-N 2.98Å; I114-M118 HydrophobicContact CG2-CE 4.15Å; I114-M118 HydrophobicContact CG2-CG 4.47Å; I114-M118 HydrophobicContact CG2-SD 4.48Å; I114-M118 WeakPolarHBondContact O-CG 3.48Å; I114-M118 PolarHBondContact O-N 3.45Å
115	C	91.3	Very high	89.6	Confident	33 Å²	33	97.8 Å²	97.8	22%	0.223	50%	0.498	C	S	.	.	H	α-helix	trans	-59.6	-46.2	175.1	-77.8	0	0	0	0	111.8	W111 D112 F117 M118 Q119	W111-C115 PolarHBondContact O-N 3.47Å; D112-C115 WeakPolarHBondContact O-CB 3.45Å; D112-C115 PolarHBondContact O-N 3.07Å; C115-F117 PolarHBondContact O-N 2.91Å; C115-M118 PolarHBondContact O-N 3.45Å; C115-Q119 WeakPolarHBondContact O-CG 3.47Å; C115-Q119 PolarHBondContact O-N 2.86Å
116	D	92.7	Very high	89.6	Confident	89 Å²	89	93.4 Å²	93.4	48%	0.476	49%	0.49	S	S	.	.	H	α-helix	trans	-62.7	-41.3	177.3	-74	-10.3	0	0	0	111.9	D112 Q119 S120	D112-D116 PolarHBondContact O-N 3.15Å; D116-Q119 PolarHBondContact O-N 3.34Å; D116-S120 WeakPolarHBondContact O-CB 3.4Å; D116-S120 PolarHBondContact O-N 3.34Å; D116-S120 PolarHBondContact O-OG 2.85Å
117	F	91.5	Very high	89.3	Confident	150 Å²	150	92.2 Å²	92.2	66%	0.658	49%	0.488	S	S	*	.	H	α-helix	trans	-62.5	-47.1	174.9	177.5	-99.6	0	0	0	111.7	N113 I114 C115 Q119 S120 A121	N113-F117 WeakPolarHBondContact O-CB 3.22Å; N113-F117 PolarHBondContact O-N 2.96Å; I114-F117 PolarHBondContact O-N 2.98Å; C115-F117 PolarHBondContact O-N 2.91Å; F117-Q119 PolarHBondContact O-N 3.39Å; F117-S120 PolarHBondContact O-N 3Å; F117-A121 WeakPolarHBondContact O-CB 3.26Å; F117-A121 PolarHBondContact O-N 3.47Å
118	M	89	Confident	88.8	Confident	92 Å²	92	93.7 Å²	93.7	45%	0.453	49%	0.493	S	S	.	.	H	α-helix	trans	-62.7	-41.9	178	-73.3	-167.8	-58.5	0	0	112.1	I114 C115 S120 A121 L122	I114-M118 HydrophobicContact CG2-CE 4.15Å; I114-M118 HydrophobicContact CG2-CG 4.47Å; I114-M118 HydrophobicContact CG2-SD 4.48Å; I114-M118 WeakPolarHBondContact O-CG 3.48Å; I114-M118 PolarHBondContact O-N 3.45Å; C115-M118 PolarHBondContact O-N 3.45Å; M118-S120 VanDerWaalsContact C-N 3.34Å; M118-S120 PolarHBondContact O-N 3.39Å; M118-A121 PolarHBondContact O-N 3.31Å; M118-L122 WeakPolarHBondContact O-CB 3.49Å; M118-L122 WeakPolarHBondContact O-CG 3.3Å; M118-L122 PolarHBondContact O-N 3.15Å
119	Q	92.4	Very high	88.3	Confident	120 Å²	120	95.5 Å²	95.5	56%	0.561	50%	0.497	S	S	*	.	H	α-helix	trans	-60.6	-44.3	175.2	-75.6	-179.7	5	0	0	111.6	C115 D116 F117 L122 L123	C115-Q119 WeakPolarHBondContact O-CG 3.47Å; C115-Q119 PolarHBondContact O-N 2.86Å; D116-Q119 PolarHBondContact O-N 3.34Å; F117-Q119 PolarHBondContact O-N 3.39Å; Q119-L122 PolarHBondContact O-N 2.95Å; Q119-L123 WeakPolarHBondContact O-CG 3.24Å; Q119-L123 PolarHBondContact O-N 2.93Å
120	S	91.2	Very high	87.7	Confident	65 Å²	65	95.1 Å²	95.1	46%	0.455	50%	0.504	S	S	.	.	H	α-helix	trans	-63.9	-42.1	177.8	-59.9	0	0	0	0	112.3	D116 F117 M118 L123 L124	D116-S120 WeakPolarHBondContact O-CB 3.4Å; D116-S120 PolarHBondContact O-N 3.34Å; D116-S120 PolarHBondContact O-OG 2.85Å; F117-S120 PolarHBondContact O-N 3Å; M118-S120 VanDerWaalsContact C-N 3.34Å; M118-S120 PolarHBondContact O-N 3.39Å; S120-L123 PolarHBondContact O-N 3.45Å; S120-L124 PolarHBondContact O-N 3.41Å; S120-L124 VanDerWaalsContact O-N 3.09Å
121	A	85.5	Confident	87	Confident	39 Å²	39	96.3 Å²	96.3	32%	0.322	51%	0.509	S	S	.	.	H	α-helix	trans	-65.6	-42.6	177	0	0	0	0	0	112.1	F117 M118 L124 V125	F117-A121 WeakPolarHBondContact O-CB 3.26Å; F117-A121 PolarHBondContact O-N 3.47Å; M118-A121 PolarHBondContact O-N 3.31Å; A121-L124 PolarHBondContact O-N 2.98Å; A121-V125 WeakPolarHBondContact O-CG2 3.47Å; A121-V125 PolarHBondContact O-N 3.08Å; A121-V125 VanDerWaalsContact O-N 3.07Å
122	L	87.5	Confident	85.7	Confident	117 Å²	117	96.3 Å²	96.3	61%	0.613	52%	0.52	S	S	*	.	H	α-helix	trans	-60.4	-44.4	174.5	-83.7	160	0	0	0	111.7	M118 Q119 L124 V125 V126	M118-L122 WeakPolarHBondContact O-CB 3.49Å; M118-L122 WeakPolarHBondContact O-CG 3.3Å; M118-L122 PolarHBondContact O-N 3.15Å; Q119-L122 PolarHBondContact O-N 2.95Å; L122-L124 VanDerWaalsContact C-N 3.34Å; L122-L124 PolarHBondContact O-N 3.32Å; L122-V125 PolarHBondContact O-N 3.02Å; L122-V126 WeakPolarHBondContact O-CG2 3.11Å; L122-V126 PolarHBondContact O-N 3.18Å
123	L	87.1	Confident	83.9	Confident	112 Å²	112	100.6 Å²	100.6	59%	0.586	55%	0.549	S	S	*	.	H	α-helix	trans	-59.4	-42.2	176	-76.9	165.5	0	0	0	112.3	Q119 S120 V126 L127	Q119-L123 WeakPolarHBondContact O-CG 3.24Å; Q119-L123 PolarHBondContact O-N 2.93Å; S120-L123 PolarHBondContact O-N 3.45Å; L123-V126 PolarHBondContact O-N 3.22Å; L123-L127 WeakPolarHBondContact O-CB 3.46Å; L123-L127 WeakPolarHBondContact O-CD1 3.31Å; L123-L127 WeakPolarHBondContact O-CG 3.45Å; L123-L127 PolarHBondContact O-N 3.44Å
124	L	82.5	Confident	83.4	Confident	106 Å²	106	100.5 Å²	100.5	56%	0.555	55%	0.549	S	S	*	.	H	α-helix	trans	-63	-41.5	176.2	-78.7	165.6	0	0	0	112.6	S120 A121 L122 L127 N128	S120-L124 PolarHBondContact O-N 3.41Å; S120-L124 VanDerWaalsContact O-N 3.09Å; A121-L124 PolarHBondContact O-N 2.98Å; L122-L124 VanDerWaalsContact C-N 3.34Å; L122-L124 PolarHBondContact O-N 3.32Å; L124-L127 PolarHBondContact O-N 2.66Å; L124-N128 WeakPolarHBondContact O-CB 3.39Å; L124-N128 PolarHBondContact O-N 3.01Å; L124-N128 PolarHBondContact O-ND2 3.14Å
125	V	82.6	Confident	83.1	Confident	84 Å²	84	102 Å²	102	51%	0.509	56%	0.559	S	S	.	*	H	α-helix	trans	-63.9	-45.3	176.1	173	0	0	0	0	110.7	A121 L122 N128 I129	A121-V125 WeakPolarHBondContact O-CG2 3.47Å; A121-V125 PolarHBondContact O-N 3.08Å; A121-V125 VanDerWaalsContact O-N 3.07Å; L122-V125 PolarHBondContact O-N 3.02Å; V125-N128 PolarHBondContact O-N 2.94Å; V125-I129 HydrophobicContact CG1-CD1 3.94Å; V125-I129 WeakPolarHBondContact O-CG1 3.48Å; V125-I129 PolarHBondContact O-N 3.38Å
126	V	87.3	Confident	82.6	Confident	81 Å²	81	105.8 Å²	105.8	49%	0.491	58%	0.577	S	S	.	*	H	α-helix	trans	-60.8	-45.9	177	172.2	0	0	0	0	111.1	L122 L123 N128 I129 C130	L122-V126 WeakPolarHBondContact O-CG2 3.11Å; L122-V126 PolarHBondContact O-N 3.18Å; L123-V126 PolarHBondContact O-N 3.22Å; V126-N128 VanDerWaalsContact C-N 3.35Å; V126-N128 PolarHBondContact O-N 3.43Å; V126-I129 PolarHBondContact O-N 2.9Å; V126-C130 PolarHBondContact O-N 3.41Å; V126-C130 PolarHBondContact O-SG 3.41Å; V126-C130 VanDerWaalsContact O-SG 3.33Å
127	L	84.3	Confident	82	Confident	100 Å²	100	106.8 Å²	106.8	52%	0.524	58%	0.583	S	S	.	*	H	α-helix	trans	-57.6	-45.8	175.6	-85.5	156.6	0	0	0	112	L123 L124 I129 C130 I131	L123-L127 WeakPolarHBondContact O-CB 3.46Å; L123-L127 WeakPolarHBondContact O-CD1 3.31Å; L123-L127 WeakPolarHBondContact O-CG 3.45Å; L123-L127 PolarHBondContact O-N 3.44Å; L124-L127 PolarHBondContact O-N 2.66Å; L127-I129 PolarHBondContact O-N 3.25Å; L127-C130 PolarHBondContact O-N 2.94Å; L127-I131 WeakPolarHBondContact O-CD1 3.42Å; L127-I131 VanDerWaalsContact O-CG1 3.24Å; L127-I131 WeakPolarHBondContact O-CG1 3.44Å; L127-I131 PolarHBondContact O-N 3.45Å
128	N	77.4	Confident	81.4	Confident	99 Å²	99	104.1 Å²	104.1	53%	0.529	58%	0.579	S	S	.	*	H	α-helix	trans	-64.1	-38.8	178.6	-77.2	-23.4	0	0	0	112.5	L124 V125 V126 I131 L132	L124-N128 WeakPolarHBondContact O-CB 3.39Å; L124-N128 PolarHBondContact O-N 3.01Å; L124-N128 PolarHBondContact O-ND2 3.14Å; V125-N128 PolarHBondContact O-N 2.94Å; V126-N128 VanDerWaalsContact C-N 3.35Å; V126-N128 PolarHBondContact O-N 3.43Å; N128-I131 PolarHBondContact O-N 3.07Å; N128-L132 PolarHBondContact O-N 3.21Å; N128-L132 VanDerWaalsContact O-N 3.11Å
129	I	81.2	Confident	80.9	Confident	102 Å²	102	104.9 Å²	104.9	52%	0.523	59%	0.587	S	S	.	*	H	α-helix	trans	-65.6	-44.6	175.1	-66.6	167.1	0	0	0	110.5	V125 V126 L127 I131 L132 V133	V125-I129 HydrophobicContact CG1-CD1 3.94Å; V125-I129 WeakPolarHBondContact O-CG1 3.48Å; V125-I129 PolarHBondContact O-N 3.38Å; V126-I129 PolarHBondContact O-N 2.9Å; L127-I129 PolarHBondContact O-N 3.25Å; I129-I131 PolarHBondContact O-N 2.99Å; I129-L132 PolarHBondContact O-N 3.08Å; I129-L132 VanDerWaalsContact O-N 3.11Å; I129-V133 HydrophobicContact CG2-CG2 4.45Å; I129-V133 WeakPolarHBondContact O-CG2 3.34Å; I129-V133 PolarHBondContact O-N 2.94Å
130	C	79.8	Confident	80.1	Confident	87 Å²	87	103.9 Å²	103.9	59%	0.588	59%	0.589	S	S	*	*	H	α-helix	trans	-65.1	-22.9	177.5	-69	0	0	0	0	113.8	V126 L127	V126-C130 PolarHBondContact O-N 3.41Å; V126-C130 PolarHBondContact O-SG 3.41Å; V126-C130 VanDerWaalsContact O-SG 3.33Å; L127-C130 PolarHBondContact O-N 2.94Å
131	I	76.7	Confident	79.3	Confident	128 Å²	128	106.8 Å²	106.8	66%	0.656	60%	0.599	S	S	*	*	H	α-helix	trans	-84	-27	174	-66.9	163.7	0	0	0	111.4	L127 N128 I129	L127-I131 WeakPolarHBondContact O-CD1 3.42Å; L127-I131 VanDerWaalsContact O-CG1 3.24Å; L127-I131 WeakPolarHBondContact O-CG1 3.44Å; L127-I131 PolarHBondContact O-N 3.45Å; N128-I131 PolarHBondContact O-N 3.07Å; I129-I131 PolarHBondContact O-N 2.99Å
132	L	63.2	Low	78.7	Confident	161 Å²	161	112.5 Å²	112.5	84%	0.843	62%	0.622	S	S	*	*	H	α-helix	trans	-84.6	-18.4	-178	-126.5	100.1	0	0	0	114.2	N128 I129	N128-L132 PolarHBondContact O-N 3.21Å; N128-L132 VanDerWaalsContact O-N 3.11Å; I129-L132 PolarHBondContact O-N 3.08Å; I129-L132 VanDerWaalsContact O-N 3.11Å
133	V	55.3	Low	77.9	Confident	173 Å²	173	112.1 Å²	112.1	100%	1.048	62%	0.623	S	S	*	*			trans	-95.6	0	177.3	176.7	0	0	0	0	110	I129	I129-V133 HydrophobicContact CG2-CG2 4.45Å; I129-V133 WeakPolarHBondContact O-CG2 3.34Å; I129-V133 PolarHBondContact O-N 2.94Å

Retrieved 133 of 133 residues in 24.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).