A0A077Z2I0_TRITR Loading...

ATPase inhibitor, mitochondrial

Thought to be a regulatory component of the ATP-synthesizing complex in the mitochondria.

AlphaFold DB , UniProt , Accession A0A077Z2I0, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 126 aa.

						>A0A077Z2I0_TRITR|A0A077Z2I0
MAQRLLNSMNALGLRQNSLKRLDSLNTVRCFGNEPGELGSGEGKGGGGGGSVRSAGGAFGRMEVAREEEYFYKQQKKQLAMLRKTLDEEVASHKKHIEIHQDAIERHKQKIAELVKEEKKLETFEK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.8	Very low	54.8	Low	226 Å²	226	149.3 Å²	149.3	100%	1.113	80%	0.795	S	S	*	*				0	-24.8	0	-91.8	179.5	-177.8	0	0	114.1
2	A	49.6	Very low	54.4	Low	81 Å²	81	151.2 Å²	151.2	67%	0.669	80%	0.804	S	S	*	*			trans	-88.9	-31.6	-176.8	0	0	0	0	0	116.2	R4	A2-R4 VanDerWaalsContact C-N 3.27Å; A2-R4 PolarHBondContact O-N 3.14Å
3	Q	51.7	Low	54.2	Low	162 Å²	162	145.2 Å²	145.2	76%	0.757	80%	0.8	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.5	-4.4	-177.2	-117.2	70.5	24.4	0	0	115.6	L5	Q3-L5 VanDerWaalsContact C-N 3.34Å
4	R	53.4	Low	53.5	Low	229 Å²	229	145.9 Å²	145.9	86%	0.864	80%	0.801	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.8	-5.6	179.8	-76.4	-176.6	178.8	163.6	-1	114	A2	A2-R4 VanDerWaalsContact C-N 3.27Å; A2-R4 PolarHBondContact O-N 3.14Å
5	L	54.9	Low	53.6	Low	141 Å²	141	151.5 Å²	151.5	74%	0.738	81%	0.805	S	S	*	*	S	Bend	trans	-104	-13.4	-174.2	-78.5	169.3	0	0	0	115.7	Q3	Q3-L5 VanDerWaalsContact C-N 3.34Å
6	L	53.4	Low	53.3	Low	153 Å²	153	151.8 Å²	151.8	80%	0.801	80%	0.8	S	S	*	*	S	Bend	trans	-96.3	-20.4	-179.6	-125.5	86.2	0	0	0	114.4	S8	L6-S8 VanDerWaalsContact C-N 3.26Å; L6-S8 PolarHBondContact O-N 2.84Å
7	N	63.6	Low	53.4	Low	146 Å²	146	150.3 Å²	150.3	78%	0.781	79%	0.793	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.3	7.5	-172.8	-68.9	-5.8	0	0	0	114.3
8	S	58.5	Low	53.3	Low	90 Å²	90	147 Å²	147	63%	0.629	79%	0.785	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.2	0.8	-176.3	61.2	0	0	0	0	115.4	L6	L6-S8 VanDerWaalsContact C-N 3.26Å; L6-S8 PolarHBondContact O-N 2.84Å
9	M	52.8	Low	53.1	Low	160 Å²	160	145.8 Å²	145.8	79%	0.788	78%	0.778	S	S	*	*	S	Bend	trans	-103.3	-12.9	-177.4	-78.1	-164.8	61	0	0	116.3	A11	M9-A11 VanDerWaalsContact C-N 3.28Å; M9-A11 PolarHBondContact O-N 3.07Å
10	N	59.3	Low	52.8	Low	170 Å²	170	147.7 Å²	147.7	91%	0.909	78%	0.778	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.7	14.2	-177.7	-70.7	-9.8	0	0	0	114.3
11	A	57.6	Low	52.7	Low	84 Å²	84	151.4 Å²	151.4	69%	0.694	78%	0.782	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100.6	6	-174.8	0	0	0	0	0	115.1	M9	M9-A11 VanDerWaalsContact C-N 3.28Å; M9-A11 PolarHBondContact O-N 3.07Å
12	L	50.6	Low	52.9	Low	172 Å²	172	147.9 Å²	147.9	90%	0.901	77%	0.767	S	S	*	*	S	Bend	trans	-125.7	86.6	-177.2	-83.8	152	0	0	0	110.7
13	G	51.1	Low	52.6	Low	73 Å²	73	152.1 Å²	152.1	75%	0.753	78%	0.778	S	S	*	*			trans	175.1	26.2	174.9	0	0	0	0	0	117.7	R15	G13-R15 PolarHBondContact O-N 3.15Å
14	L	45.3	Very low	52.8	Low	155 Å²	155	148.9 Å²	148.9	81%	0.812	77%	0.773	S	S	*	*			trans	-61.3	115.5	158.1	-85.9	118	0	0	0	108.7
15	R	55.1	Low	52.8	Low	230 Å²	230	146.5 Å²	146.5	87%	0.868	78%	0.777	S	S	*	*			trans	-147.5	85.1	152.1	-113.7	-178.4	159.2	-136.1	-6.4	111.1	G13	G13-R15 PolarHBondContact O-N 3.15Å
16	Q	48.4	Very low	52.4	Low	156 Å²	156	147 Å²	147	73%	0.729	78%	0.781	S	S	*	*			trans	-52.3	140.1	151.3	-63.8	170.7	-19.6	0	0	109.4
17	N	55.2	Low	52.5	Low	127 Å²	127	144.6 Å²	144.6	68%	0.679	77%	0.772	S	S	*	*			trans	-176.6	91.7	147.3	-88.6	-15.7	0	0	0	104.9
18	S	51.6	Low	51.8	Low	91 Å²	91	143.7 Å²	143.7	64%	0.636	77%	0.772	S	S	*	*				40.9	100.6	68	107.2	0	0	0	0	109.1
19	L	48.2	Very low	51.1	Low	125 Å²	125	149 Å²	149	65%	0.654	78%	0.778	S	S	*	*				168.4	97.9	124.1	-82.3	161.6	0	0	0	108.6
20	K	47.6	Very low	50.7	Low	182 Å²	182	146.8 Å²	146.8	79%	0.791	78%	0.777	S	S	*	*				69.2	143.3	125.4	-63.5	173.5	-176.7	160.3	0	117.8
21	R	50.4	Low	49.9	Very low	227 Å²	227	145.8 Å²	145.8	86%	0.857	77%	0.765	S	S	*	*			trans	96.7	94.5	139.2	-134.3	173.2	-163.6	-179.2	1.2	112.5
22	L	53.2	Low	49.6	Very low	151 Å²	151	144 Å²	144	79%	0.791	75%	0.754	S	S	*	*				-177.6	89	99.7	-86.4	162.8	0	0	0	108.2	S24	L22-S24 PolarHBondContact O-N 2.74Å
23	D	42.9	Very low	49.7	Very low	171 Å²	171	142.6 Å²	142.6	91%	0.914	75%	0.748	S	S	*	*			trans	-69.3	106.1	147.9	-70.9	-45.5	0	0	0	106.9
24	S	55.3	Low	50.1	Low	93 Å²	93	145.5 Å²	145.5	65%	0.65	74%	0.742	S	S	*	*			trans	-178.1	100.4	143.5	58.9	0	0	0	0	109.4	L22	L22-S24 PolarHBondContact O-N 2.74Å
25	L	53.2	Low	50.8	Low	180 Å²	180	144 Å²	144	94%	0.942	74%	0.741	S	S	*	*			trans	-170.4	105.3	133.9	-95.9	165	0	0	0	106.2
26	N	48.3	Very low	51.3	Low	152 Å²	152	135.2 Å²	135.2	81%	0.813	72%	0.723	S	S	*	*			trans	-55.7	133.9	-179.2	-80.5	-48.8	0	0	0	112.2
27	T	55.1	Low	52.6	Low	101 Å²	101	133.9 Å²	133.9	62%	0.62	72%	0.716	S	S	*	*				47.3	83.5	129.2	-48.9	0	0	0	0	116.3	R29	T27-R29 HydrophobicContact CG2-CB 4.46Å; T27-R29 HydrophobicContact CG2-CG 4.15Å
28	V	49	Very low	53.7	Low	128 Å²	128	133.6 Å²	133.6	78%	0.776	71%	0.714	S	S	*	*			trans	-110	84.2	144.5	-177.2	0	0	0	0	107.5	C30	V28-C30 VanDerWaalsContact C-N 3.33Å; V28-C30 WeakPolarHBondContact CG1-SG 3.1Å; V28-C30 PolarHBondContact O-N 2.91Å; V28-C30 VanDerWaalsContact O-N 3.14Å
29	R	42.9	Very low	55	Low	201 Å²	201	130.6 Å²	130.6	76%	0.758	70%	0.697	S	S	*	*			trans	-74.1	86.6	164.5	-82	170.9	168.7	169.7	2.9	107.9	T27 F31	T27-R29 HydrophobicContact CG2-CB 4.46Å; T27-R29 HydrophobicContact CG2-CG 4.15Å; R29-F31 VanDerWaalsContact C-N 3.27Å; R29-F31 HydrophobicContact CB-CD2 3.84Å; R29-F31 HydrophobicContact CB-CE2 3.88Å; R29-F31 HydrophobicContact CG-CD2 4.37Å; R29-F31 HydrophobicContact CG-CE2 3.89Å; R29-F31 PolarHBondContact O-N 3.45Å; R29-F31 VanDerWaalsContact O-N 3.1Å
30	C	44.6	Very low	56.1	Low	113 Å²	113	125.4 Å²	125.4	76%	0.764	67%	0.671	S	S	*	*			trans	-80.6	78.7	166.4	-75.4	0	0	0	0	109.6	V28 G32	V28-C30 VanDerWaalsContact C-N 3.33Å; V28-C30 WeakPolarHBondContact CG1-SG 3.1Å; V28-C30 PolarHBondContact O-N 2.91Å; V28-C30 VanDerWaalsContact O-N 3.14Å; C30-G32 PolarHBondContact O-N 3.47Å
31	F	43.5	Very low	57.3	Low	149 Å²	149	119.5 Å²	119.5	65%	0.654	66%	0.663	S	S	*	*			trans	-73.9	75.3	163.8	-76.5	-80.8	0	0	0	109.5	R29	R29-F31 VanDerWaalsContact C-N 3.27Å; R29-F31 HydrophobicContact CB-CD2 3.84Å; R29-F31 HydrophobicContact CB-CE2 3.88Å; R29-F31 HydrophobicContact CG-CD2 4.37Å; R29-F31 HydrophobicContact CG-CE2 3.89Å; R29-F31 PolarHBondContact O-N 3.45Å; R29-F31 VanDerWaalsContact O-N 3.1Å
32	G	50.4	Low	58.2	Low	46 Å²	46	113.1 Å²	113.1	47%	0.474	64%	0.642	S	S	.	*			trans	-92.4	86.6	161.5	0	0	0	0	0	108.6	C30 E34	C30-G32 PolarHBondContact O-N 3.47Å; G32-E34 PolarHBondContact O-N 2.92Å
33	N	52	Low	58.8	Low	144 Å²	144	109 Å²	109	77%	0.77	64%	0.636	S	S	*	*			trans	-74.3	56.1	-173	-66.3	-46.7	0	0	0	113.7
34	E	59.1	Low	59.6	Low	134 Å²	134	107.4 Å²	107.4	63%	0.626	62%	0.621	S	S	*	*	S	Bend	trans	-142.4	110.6	164.4	178.8	-170.6	-133.4	0	0	106.9	G32 G36 K44	G32-E34 PolarHBondContact O-N 2.92Å; E34-G36 PolarHBondContact O-N 3.09Å; E34-K44 VanDerWaalsContact CB-NZ 3.31Å; E34-K44 WeakPolarHBondContact O-CE 3.32Å; E34-K44 PolarHBondContact O-NZ 3.23Å; E34-K44 IonicContact OE2-NZ 2.93Å; E34-K44 PolarHBondContact OE2-NZ 3.26Å
35	P	61.8	Low	60	Low	122 Å²	122	106 Å²	106	79%	0.792	62%	0.621	S	S	*	*	P	Polyproline II helix	trans	-58.9	128.9	-175.4	23.1	-29.9	0	0	0	108.3
36	G	65.7	Low	60.3	Low	47 Å²	47	100.5 Å²	100.5	49%	0.485	61%	0.608	S	S	.	*	P	Polyproline II helix	trans	-54.5	149	168.7	0	0	0	0	0	109.6	E34 L38	E34-G36 PolarHBondContact O-N 3.09Å; G36-L38 PolarHBondContact O-N 3.37Å
37	E	75.4	Confident	60.9	Low	127 Å²	127	96.4 Å²	96.4	59%	0.593	60%	0.602	S	S	*	*	P	Polyproline II helix	trans	-55	128.7	175.1	-179.5	-176	-173.9	0	0	109	G39 S40 R61	E37-G39 PolarHBondContact O-N 3.39Å; E37-S40 VanDerWaalsContact O-CB 3.23Å; E37-S40 WeakPolarHBondContact O-CB 3.15Å; E37-S40 PolarHBondContact O-N 2.8Å; E37-S40 PolarHBondContact O-OG 2.97Å; E37-R61 WeakPolarHBondContact OE1-CD 3.32Å
38	L	76.8	Confident	61.4	Low	122 Å²	122	94.6 Å²	94.6	64%	0.639	60%	0.603	S	S	*	*	T	Hydrogen-bonded Turn	trans	-55.3	128	-177.8	-70.5	171	0	0	0	109.5	G36 S40 V64	G36-L38 PolarHBondContact O-N 3.37Å; L38-S40 VanDerWaalsContact C-N 3.28Å; L38-S40 PolarHBondContact O-N 2.85Å; L38-V64 HydrophobicContact CB-CG1 3.9Å; L38-V64 HydrophobicContact CB-CG2 4.03Å; L38-V64 HydrophobicContact CD1-CG1 4.49Å
39	G	79.5	Confident	62.4	Low	27 Å²	27	89.6 Å²	89.6	28%	0.278	58%	0.577	S	S	.	*	T	Hydrogen-bonded Turn	trans	78.5	0.9	-179.8	0	0	0	0	0	115.5	E37 G41 G57 G60 R61	E37-G39 PolarHBondContact O-N 3.39Å; G39-G41 PolarHBondContact O-N 3.47Å; G39-G41 VanDerWaalsContact O-N 3.14Å; G39-G57 CarbonylContact O-C 3.56Å; G39-G57 WeakPolarHBondContact O-CA 3.46Å; G39-G60 VanDerWaalsContact CA-C 3.43Å; G39-G60 CarbonylContact O-C 3.22Å; G39-G60 VanDerWaalsContact O-C 3.22Å; G39-G60 WeakPolarHBondContact O-CA 3.45Å; G39-R61 PolarHBondContact O-N 2.81Å; G39-R61 VanDerWaalsContact O-N 3.11Å
40	S	72.7	Confident	64.1	Low	16 Å²	16	82.1 Å²	82.1	11%	0.112	56%	0.563	C	S	.	*			trans	-67.4	-11.6	-178.3	57.4	0	0	0	0	115.3	E37 L38 E42 G57	E37-S40 VanDerWaalsContact O-CB 3.23Å; E37-S40 WeakPolarHBondContact O-CB 3.15Å; E37-S40 PolarHBondContact O-N 2.8Å; E37-S40 PolarHBondContact O-OG 2.97Å; L38-S40 VanDerWaalsContact C-N 3.28Å; L38-S40 PolarHBondContact O-N 2.85Å; S40-E42 PolarHBondContact O-N 3.28Å; S40-G57 WeakPolarHBondContact O-CA 3.43Å
41	G	71	Confident	65.8	Low	59 Å²	59	81.5 Å²	81.5	61%	0.608	56%	0.56	S	S	*	*			trans	63.4	-6.1	177.2	0	0	0	0	0	115.5	G39	G39-G41 PolarHBondContact O-N 3.47Å; G39-G41 VanDerWaalsContact O-N 3.14Å
42	E	70.6	Confident	67.5	Low	92 Å²	92	80 Å²	80	43%	0.43	56%	0.563	S	S	.	*			trans	-106.6	114.3	-178	-66.8	-174.2	167.5	0	0	109.6	S40	S40-E42 PolarHBondContact O-N 3.28Å
43	G	64.9	Low	68.9	Low	64 Å²	64	84 Å²	84	66%	0.66	56%	0.564	S	S	*	*			trans	-80.5	167.3	177.4	0	0	0	0	0	113.3	G45	G43-G45 PolarHBondContact O-N 2.87Å
44	K	60.9	Low	70.2	Confident	139 Å²	139	80.3 Å²	80.3	60%	0.604	55%	0.549	S	S	*	.	S	Bend	trans	-70.2	68.4	173.2	-131.8	100.1	177.7	165.1	0	110	E34	E34-K44 VanDerWaalsContact CB-NZ 3.31Å; E34-K44 WeakPolarHBondContact O-CE 3.32Å; E34-K44 PolarHBondContact O-NZ 3.23Å; E34-K44 IonicContact OE2-NZ 2.93Å; E34-K44 PolarHBondContact OE2-NZ 3.26Å
45	G	63.8	Low	71.4	Confident	62 Å²	62	76 Å²	76	64%	0.639	54%	0.536	S	S	*	.	S	Bend	trans	161	115.7	178.5	0	0	0	0	0	114.3	G43	G43-G45 PolarHBondContact O-N 2.87Å
46	G	58.9	Low	72.4	Confident	65 Å²	65	72 Å²	72	67%	0.67	52%	0.517	S	S	*	.	S	Bend	trans	91.6	126.3	172.3	0	0	0	0	0	113.1
47	G	61.1	Low	73.3	Confident	67 Å²	67	69.8 Å²	69.8	69%	0.691	49%	0.494	S	S	*	.	S	Bend	trans	-48.2	158.3	-171.6	0	0	0	0	0	115.6	G49	G47-G49 VanDerWaalsContact O-CA 3.31Å; G47-G49 WeakPolarHBondContact O-CA 3.47Å; G47-G49 PolarHBondContact O-N 3.26Å
48	G	65.6	Low	73.7	Confident	62 Å²	62	65.8 Å²	65.8	64%	0.639	48%	0.483	S	S	*	.			trans	-41.2	103.9	-176.8	0	0	0	0	0	110.7	G50	G48-G50 PolarHBondContact O-N 3.33Å
49	G	68.9	Low	74.3	Confident	23 Å²	23	66.3 Å²	66.3	24%	0.237	48%	0.48	C	S	.	.			trans	-79.4	48	-155.1	0	0	0	0	0	115.1	G47 R53	G47-G49 VanDerWaalsContact O-CA 3.31Å; G47-G49 WeakPolarHBondContact O-CA 3.47Å; G47-G49 PolarHBondContact O-N 3.26Å; G49-R53 VanDerWaalsContact O-CG 3.32Å; G49-R53 WeakPolarHBondContact O-CG 3.31Å
50	G	78.2	Confident	74.7	Confident	44 Å²	44	65.7 Å²	65.7	45%	0.454	47%	0.474	S	S	.	.	H	α-helix	trans	79.7	172	-177.1	0	0	0	0	0	113.5	G48 V52 R53 S54	G48-G50 PolarHBondContact O-N 3.33Å; G50-V52 PolarHBondContact O-N 3.11Å; G50-V52 VanDerWaalsContact O-N 3.14Å; G50-R53 PolarHBondContact O-N 3.12Å; G50-R53 VanDerWaalsContact O-N 3.15Å; G50-S54 PolarHBondContact O-N 3.03Å
51	S	80.6	Confident	75.5	Confident	100 Å²	100	69.2 Å²	69.2	70%	0.699	49%	0.485	S	S	*	.	H	α-helix	trans	-55	-29.2	176.9	53.9	0	0	0	0	113.1	A55	S51-A55 WeakPolarHBondContact O-CB 3.31Å; S51-A55 PolarHBondContact O-N 3.41Å
52	V	79.6	Confident	76.5	Confident	119 Å²	119	70.9 Å²	70.9	72%	0.721	48%	0.478	S	S	*	.	H	α-helix	trans	-66.2	-48.8	177.1	180	0	0	0	0	111.7	G50 G56	G50-V52 PolarHBondContact O-N 3.11Å; G50-V52 VanDerWaalsContact O-N 3.14Å; V52-G56 PolarHBondContact O-N 3.11Å
53	R	80.8	Confident	77.4	Confident	130 Å²	130	72 Å²	72	49%	0.491	48%	0.483	S	S	.	.	H	α-helix	trans	-67.9	-41.2	176.6	-70.9	-166.3	-138.6	163.3	3.8	111.2	G49 G50 A55 G56 G57	G49-R53 VanDerWaalsContact O-CG 3.32Å; G49-R53 WeakPolarHBondContact O-CG 3.31Å; G50-R53 PolarHBondContact O-N 3.12Å; G50-R53 VanDerWaalsContact O-N 3.15Å; R53-A55 PolarHBondContact O-N 2.87Å; R53-G56 PolarHBondContact O-N 3.26Å; R53-G57 PolarHBondContact O-N 3.47Å
54	S	79	Confident	78.6	Confident	66 Å²	66	70.4 Å²	70.4	46%	0.462	46%	0.46	S	S	.	.	H	α-helix	trans	-60.8	-43.8	176.5	-173.6	0	0	0	0	112.3	G50 G57 A58	G50-S54 PolarHBondContact O-N 3.03Å; S54-G57 PolarHBondContact O-N 2.96Å; S54-A58 PolarHBondContact O-N 3.36Å
55	A	82.9	Confident	80.1	Confident	43 Å²	43	66.4 Å²	66.4	36%	0.355	45%	0.453	S	S	.	.	H	α-helix	trans	-64.9	-45.7	174.4	0	0	0	0	0	111.6	S51 R53 G57 A58 F59	S51-A55 WeakPolarHBondContact O-CB 3.31Å; S51-A55 PolarHBondContact O-N 3.41Å; R53-A55 PolarHBondContact O-N 2.87Å; A55-G57 VanDerWaalsContact C-N 3.28Å; A55-G57 PolarHBondContact O-N 2.93Å; A55-A58 WeakPolarHBondContact O-CB 3.18Å; A55-A58 PolarHBondContact O-N 2.98Å; A55-A58 VanDerWaalsContact O-N 3.09Å; A55-F59 WeakPolarHBondContact O-CD2 3.33Å; A55-F59 PolarHBondContact O-N 3.14Å
56	G	83.7	Confident	81.5	Confident	38 Å²	38	71 Å²	71	39%	0.392	45%	0.451	S	S	.	.	H	α-helix	trans	-59.1	-37.8	175.2	0	0	0	0	0	112.9	V52 R53 F59 G60	V52-G56 PolarHBondContact O-N 3.11Å; R53-G56 PolarHBondContact O-N 3.26Å; G56-F59 PolarHBondContact O-N 2.84Å; G56-G60 PolarHBondContact O-N 2.8Å
57	G	83.6	Confident	83.2	Confident	0 Å²	0	73.3 Å²	73.3	0%	0	44%	0.444	C	S	.	.	H	α-helix	trans	-68.4	-34.9	172.7	0	0	0	0	0	113.9	G39 S40 R53 S54 A55 R61	G39-G57 CarbonylContact O-C 3.56Å; G39-G57 WeakPolarHBondContact O-CA 3.46Å; S40-G57 WeakPolarHBondContact O-CA 3.43Å; R53-G57 PolarHBondContact O-N 3.47Å; S54-G57 PolarHBondContact O-N 2.96Å; A55-G57 VanDerWaalsContact C-N 3.28Å; A55-G57 PolarHBondContact O-N 2.93Å; G57-R61 WeakPolarHBondContact O-CB 3.42Å; G57-R61 WeakPolarHBondContact O-CG 3.41Å; G57-R61 PolarHBondContact O-N 3.11Å
58	A	85.5	Confident	84.7	Confident	44 Å²	44	75.6 Å²	75.6	36%	0.364	44%	0.437	S	S	.	.	H	α-helix	trans	-67.9	-42.6	173.1	0	0	0	0	0	111.9	S54 A55 M62	S54-A58 PolarHBondContact O-N 3.36Å; A55-A58 WeakPolarHBondContact O-CB 3.18Å; A55-A58 PolarHBondContact O-N 2.98Å; A55-A58 VanDerWaalsContact O-N 3.09Å; A58-M62 WeakPolarHBondContact O-CB 3.15Å; A58-M62 PolarHBondContact O-N 3.15Å
59	F	88.1	Confident	86.1	Confident	133 Å²	133	77.6 Å²	77.6	58%	0.583	43%	0.43	S	S	*	.	H	α-helix	trans	-64	-44.5	173.7	-74.5	-66.3	0	0	0	111.6	A55 G56 R61 M62 E63	A55-F59 WeakPolarHBondContact O-CD2 3.33Å; A55-F59 PolarHBondContact O-N 3.14Å; G56-F59 PolarHBondContact O-N 2.84Å; F59-R61 PolarHBondContact O-N 2.6Å; F59-M62 CarbonylContact O-C 3.56Å; F59-M62 WeakPolarHBondContact O-CB 3.45Å; F59-M62 PolarHBondContact O-N 3.08Å; F59-M62 VanDerWaalsContact O-N 3.11Å; F59-E63 WeakPolarHBondContact O-CG 3.23Å; F59-E63 PolarHBondContact O-N 2.96Å
60	G	89.4	Confident	87.4	Confident	13 Å²	13	82.9 Å²	82.9	13%	0.134	44%	0.444	C	S	.	.	H	α-helix	trans	-63.1	-41.9	177.7	0	0	0	0	0	112.5	G39 G56 M62 E63 V64	G39-G60 VanDerWaalsContact CA-C 3.43Å; G39-G60 CarbonylContact O-C 3.22Å; G39-G60 VanDerWaalsContact O-C 3.22Å; G39-G60 WeakPolarHBondContact O-CA 3.45Å; G56-G60 PolarHBondContact O-N 2.8Å; G60-M62 VanDerWaalsContact C-N 3.3Å; G60-M62 PolarHBondContact O-N 3.42Å; G60-E63 PolarHBondContact O-N 3.45Å; G60-V64 WeakPolarHBondContact O-CG2 3.49Å; G60-V64 PolarHBondContact O-N 3.45Å
61	R	89.1	Confident	88.3	Confident	91 Å²	91	86.1 Å²	86.1	34%	0.343	45%	0.446	S	S	.	.	H	α-helix	trans	-59.9	-39.9	171.8	-75.5	-172.6	-61.3	-90.5	-2.5	112.1	E37 G39 G57 F59 A65	E37-R61 WeakPolarHBondContact OE1-CD 3.32Å; G39-R61 PolarHBondContact O-N 2.81Å; G39-R61 VanDerWaalsContact O-N 3.11Å; G57-R61 WeakPolarHBondContact O-CB 3.42Å; G57-R61 WeakPolarHBondContact O-CG 3.41Å; G57-R61 PolarHBondContact O-N 3.11Å; F59-R61 PolarHBondContact O-N 2.6Å; R61-A65 PolarHBondContact O-N 3.31Å; R61-A65 VanDerWaalsContact O-N 3.11Å
62	M	90.7	Very high	89	Confident	94 Å²	94	88.5 Å²	88.5	46%	0.463	44%	0.44	S	S	.	.	H	α-helix	trans	-67.7	-39	176.6	-176	179.6	-69	0	0	112.3	A58 F59 G60 R66	A58-M62 WeakPolarHBondContact O-CB 3.15Å; A58-M62 PolarHBondContact O-N 3.15Å; F59-M62 CarbonylContact O-C 3.56Å; F59-M62 WeakPolarHBondContact O-CB 3.45Å; F59-M62 PolarHBondContact O-N 3.08Å; F59-M62 VanDerWaalsContact O-N 3.11Å; G60-M62 VanDerWaalsContact C-N 3.3Å; G60-M62 PolarHBondContact O-N 3.42Å; M62-R66 VanDerWaalsContact O-CG 3.31Å; M62-R66 WeakPolarHBondContact O-CG 3.42Å; M62-R66 PolarHBondContact O-N 3.15Å; M62-R66 VanDerWaalsContact O-N 3.12Å; M62-R66 PolarHBondContact SD-NH2 3.27Å
63	E	89.7	Confident	89.9	Confident	114 Å²	114	87.6 Å²	87.6	53%	0.533	43%	0.427	S	S	.	.	H	α-helix	trans	-65.1	-45.4	176.2	-76	179.2	172.2	0	0	111.2	F59 G60 A65 R66 E67	F59-E63 WeakPolarHBondContact O-CG 3.23Å; F59-E63 PolarHBondContact O-N 2.96Å; G60-E63 PolarHBondContact O-N 3.45Å; E63-A65 PolarHBondContact O-N 2.87Å; E63-R66 WeakPolarHBondContact O-CB 3.44Å; E63-R66 PolarHBondContact O-N 3.25Å; E63-R66 VanDerWaalsContact O-N 3.15Å; E63-E67 WeakPolarHBondContact O-CG 3.04Å; E63-E67 PolarHBondContact O-N 3.41Å
64	V	91.6	Very high	90.7	Very high	32 Å²	32	84.1 Å²	84.1	19%	0.194	42%	0.416	C	S	.	.	H	α-helix	trans	-57.8	-47.6	175.1	170.7	0	0	0	0	111.2	L38 G60 R66 E67 E68	L38-V64 HydrophobicContact CB-CG1 3.9Å; L38-V64 HydrophobicContact CB-CG2 4.03Å; L38-V64 HydrophobicContact CD1-CG1 4.49Å; G60-V64 WeakPolarHBondContact O-CG2 3.49Å; G60-V64 PolarHBondContact O-N 3.45Å; V64-R66 VanDerWaalsContact C-N 3.29Å; V64-R66 PolarHBondContact O-N 3.24Å; V64-E67 PolarHBondContact O-N 2.64Å; V64-E68 HydrophobicContact CG1-CG 4.28Å; V64-E68 WeakPolarHBondContact O-CB 3.16Å; V64-E68 VanDerWaalsContact O-CG 3.3Å; V64-E68 WeakPolarHBondContact O-CG 3.44Å; V64-E68 PolarHBondContact O-N 3.41Å
65	A	91.6	Very high	91.6	Very high	55 Å²	55	86.4 Å²	86.4	46%	0.455	42%	0.419	S	S	.	.	H	α-helix	trans	-60.7	-37.3	178.2	0	0	0	0	0	112.8	R61 E63 E69	R61-A65 PolarHBondContact O-N 3.31Å; R61-A65 VanDerWaalsContact O-N 3.11Å; E63-A65 PolarHBondContact O-N 2.87Å; A65-E69 WeakPolarHBondContact O-CB 3.3Å; A65-E69 PolarHBondContact O-N 2.86Å; A65-E69 VanDerWaalsContact O-N 3.08Å
66	R	93.3	Very high	92.3	Very high	158 Å²	158	90.7 Å²	90.7	60%	0.596	43%	0.43	S	S	*	.	H	α-helix	trans	-69.9	-42.8	176.7	-74	172.5	176.7	-179.2	1.4	112.1	M62 E63 V64 E69 Y70	M62-R66 VanDerWaalsContact O-CG 3.31Å; M62-R66 WeakPolarHBondContact O-CG 3.42Å; M62-R66 PolarHBondContact O-N 3.15Å; M62-R66 VanDerWaalsContact O-N 3.12Å; M62-R66 PolarHBondContact SD-NH2 3.27Å; E63-R66 WeakPolarHBondContact O-CB 3.44Å; E63-R66 PolarHBondContact O-N 3.25Å; E63-R66 VanDerWaalsContact O-N 3.15Å; V64-R66 VanDerWaalsContact C-N 3.29Å; V64-R66 PolarHBondContact O-N 3.24Å; R66-E69 PolarHBondContact O-N 2.9Å; R66-Y70 WeakPolarHBondContact O-CB 3.41Å; R66-Y70 PolarHBondContact O-N 3.48Å
67	E	93.8	Very high	92.9	Very high	113 Å²	113	94.7 Å²	94.7	53%	0.528	44%	0.436	S	S	.	.	H	α-helix	trans	-63.1	-47.1	176.7	-75	-177.1	179.4	0	0	110.8	E63 V64 E69 Y70 F71	E63-E67 WeakPolarHBondContact O-CG 3.04Å; E63-E67 PolarHBondContact O-N 3.41Å; V64-E67 PolarHBondContact O-N 2.64Å; E67-E69 VanDerWaalsContact C-N 3.34Å; E67-E69 PolarHBondContact O-N 3.34Å; E67-Y70 WeakPolarHBondContact O-CB 3.41Å; E67-Y70 PolarHBondContact O-N 3Å; E67-Y70 VanDerWaalsContact O-N 3.15Å; E67-F71 HydrophobicContact CB-CD2 4.32Å; E67-F71 HydrophobicContact CB-CE2 4.07Å; E67-F71 WeakPolarHBondContact O-CD2 2.98Å; E67-F71 PolarHBondContact O-N 3.35Å
68	E	93.6	Very high	93.6	Very high	115 Å²	115	100.4 Å²	100.4	54%	0.537	46%	0.463	S	S	.	.	H	α-helix	trans	-57.1	-46.5	175.6	-74.8	179.3	174	0	0	111.8	V64 Y70 F71 Y72	V64-E68 HydrophobicContact CG1-CG 4.28Å; V64-E68 WeakPolarHBondContact O-CB 3.16Å; V64-E68 VanDerWaalsContact O-CG 3.3Å; V64-E68 WeakPolarHBondContact O-CG 3.44Å; V64-E68 PolarHBondContact O-N 3.41Å; E68-Y70 VanDerWaalsContact C-N 3.34Å; E68-Y70 PolarHBondContact O-N 3.23Å; E68-F71 PolarHBondContact O-N 2.97Å; E68-Y72 VanDerWaalsContact O-CB 3.3Å; E68-Y72 WeakPolarHBondContact O-CB 3.43Å; E68-Y72 PolarHBondContact O-N 3.47Å
69	E	95.4	Very high	94.2	Very high	104 Å²	104	103.7 Å²	103.7	49%	0.486	47%	0.474	S	S	.	.	H	α-helix	trans	-61.3	-42.8	176.4	-167.6	-168.8	174.7	0	0	111.8	A65 R66 E67 Y72 K73	A65-E69 WeakPolarHBondContact O-CB 3.3Å; A65-E69 PolarHBondContact O-N 2.86Å; A65-E69 VanDerWaalsContact O-N 3.08Å; R66-E69 PolarHBondContact O-N 2.9Å; E67-E69 VanDerWaalsContact C-N 3.34Å; E67-E69 PolarHBondContact O-N 3.34Å; E69-Y72 PolarHBondContact O-N 2.9Å; E69-K73 HydrophobicContact CG-CD 4.25Å; E69-K73 WeakPolarHBondContact O-CB 3.3Å; E69-K73 WeakPolarHBondContact O-CG 3.29Å; E69-K73 PolarHBondContact O-N 3.41Å; E69-K73 WeakPolarHBondContact OE1-CE 3.46Å; E69-K73 IonicContact OE1-NZ 2.6Å; E69-K73 PolarHBondContact OE1-NZ 2.96Å
70	Y	96.3	Very high	94.6	Very high	134 Å²	134	99.5 Å²	99.5	53%	0.525	46%	0.464	S	S	.	.	H	α-helix	trans	-61.3	-51	177.2	175	-98.2	0	0	0	111.5	R66 E67 E68 Y72 K73 Q74	R66-Y70 WeakPolarHBondContact O-CB 3.41Å; R66-Y70 PolarHBondContact O-N 3.48Å; E67-Y70 WeakPolarHBondContact O-CB 3.41Å; E67-Y70 PolarHBondContact O-N 3Å; E67-Y70 VanDerWaalsContact O-N 3.15Å; E68-Y70 VanDerWaalsContact C-N 3.34Å; E68-Y70 PolarHBondContact O-N 3.23Å; Y70-Y72 VanDerWaalsContact C-N 3.32Å; Y70-Y72 PolarHBondContact O-N 2.97Å; Y70-K73 PolarHBondContact O-N 3.26Å; Y70-Q74 HydrophobicContact CD1-CG 4.22Å; Y70-Q74 HydrophobicContact CD2-CG 4.4Å; Y70-Q74 HydrophobicContact CE1-CG 3.81Å; Y70-Q74 HydrophobicContact CE2-CG 3.99Å; Y70-Q74 HydrophobicContact CG-CG 4.5Å; Y70-Q74 WeakPolarHBondContact O-CG 3.34Å; Y70-Q74 PolarHBondContact O-N 2.99Å
71	F	96	Very high	95	Very high	113 Å²	113	104.9 Å²	104.9	50%	0.496	49%	0.487	S	S	.	.	H	α-helix	trans	-64	-37.8	179.7	-71.1	-61.1	0	0	0	112	E67 E68 Q74 Q75	E67-F71 HydrophobicContact CB-CD2 4.32Å; E67-F71 HydrophobicContact CB-CE2 4.07Å; E67-F71 WeakPolarHBondContact O-CD2 2.98Å; E67-F71 PolarHBondContact O-N 3.35Å; E68-F71 PolarHBondContact O-N 2.97Å; F71-Q74 PolarHBondContact O-N 3.1Å; F71-Q75 WeakPolarHBondContact O-CB 3.31Å; F71-Q75 VanDerWaalsContact O-CG 3.29Å; F71-Q75 WeakPolarHBondContact O-CG 3.45Å; F71-Q75 PolarHBondContact O-N 3.39Å; F71-Q75 PolarHBondContact O-NE2 3.42Å
72	Y	96	Very high	95.5	Very high	149 Å²	149	105.4 Å²	105.4	58%	0.584	50%	0.496	S	S	*	.	H	α-helix	trans	-61	-48.2	174	178	-99.3	0	0	0	111.6	E68 E69 Y70 Q74 Q75 K76	E68-Y72 VanDerWaalsContact O-CB 3.3Å; E68-Y72 WeakPolarHBondContact O-CB 3.43Å; E68-Y72 PolarHBondContact O-N 3.47Å; E69-Y72 PolarHBondContact O-N 2.9Å; Y70-Y72 VanDerWaalsContact C-N 3.32Å; Y70-Y72 PolarHBondContact O-N 2.97Å; Y72-Q74 VanDerWaalsContact C-N 3.31Å; Y72-Q74 PolarHBondContact O-N 3.14Å; Y72-Q75 PolarHBondContact O-N 3.22Å; Y72-K76 WeakPolarHBondContact O-CB 3.33Å; Y72-K76 PolarHBondContact O-N 2.91Å
73	K	97.5	Very high	95.8	Very high	101 Å²	101	109.7 Å²	109.7	44%	0.439	51%	0.507	S	S	.	.	H	α-helix	trans	-60	-41.3	176	-76.3	170	171.3	170.5	0	111.7	E69 Y70 K76 K77	E69-K73 HydrophobicContact CG-CD 4.25Å; E69-K73 WeakPolarHBondContact O-CB 3.3Å; E69-K73 WeakPolarHBondContact O-CG 3.29Å; E69-K73 PolarHBondContact O-N 3.41Å; E69-K73 WeakPolarHBondContact OE1-CE 3.46Å; E69-K73 IonicContact OE1-NZ 2.6Å; E69-K73 PolarHBondContact OE1-NZ 2.96Å; Y70-K73 PolarHBondContact O-N 3.26Å; K73-K76 PolarHBondContact O-N 2.93Å; K73-K77 VanDerWaalsContact O-CG 3.31Å; K73-K77 WeakPolarHBondContact O-CG 3.36Å; K73-K77 PolarHBondContact O-N 2.76Å
74	Q	97.6	Very high	96.2	Very high	56 Å²	56	110.7 Å²	110.7	26%	0.262	51%	0.51	S	S	.	.	H	α-helix	trans	-66.6	-45.6	178.8	-71.6	-63.2	98.6	0	0	112.2	Y70 F71 Y72 K76 K77 Q78	Y70-Q74 HydrophobicContact CD1-CG 4.22Å; Y70-Q74 HydrophobicContact CD2-CG 4.4Å; Y70-Q74 HydrophobicContact CE1-CG 3.81Å; Y70-Q74 HydrophobicContact CE2-CG 3.99Å; Y70-Q74 HydrophobicContact CG-CG 4.5Å; Y70-Q74 WeakPolarHBondContact O-CG 3.34Å; Y70-Q74 PolarHBondContact O-N 2.99Å; F71-Q74 PolarHBondContact O-N 3.1Å; Y72-Q74 VanDerWaalsContact C-N 3.31Å; Y72-Q74 PolarHBondContact O-N 3.14Å; Q74-K76 VanDerWaalsContact C-N 3.33Å; Q74-K76 PolarHBondContact O-N 3.26Å; Q74-K77 PolarHBondContact O-N 3.21Å; Q74-Q78 WeakPolarHBondContact O-CG 3.48Å; Q74-Q78 PolarHBondContact O-N 3.15Å
75	Q	97.4	Very high	96.5	Very high	115 Å²	115	112.2 Å²	112.2	54%	0.537	52%	0.519	S	S	.	.	H	α-helix	trans	-59.1	-45.3	174.8	-73.5	173.9	83.5	0	0	111.3	F71 Y72 K77 Q78 L79	F71-Q75 WeakPolarHBondContact O-CB 3.31Å; F71-Q75 VanDerWaalsContact O-CG 3.29Å; F71-Q75 WeakPolarHBondContact O-CG 3.45Å; F71-Q75 PolarHBondContact O-N 3.39Å; F71-Q75 PolarHBondContact O-NE2 3.42Å; Y72-Q75 PolarHBondContact O-N 3.22Å; Q75-K77 VanDerWaalsContact C-N 3.33Å; Q75-K77 PolarHBondContact O-N 3.39Å; Q75-Q78 PolarHBondContact O-N 2.98Å; Q75-L79 WeakPolarHBondContact O-CG 3.38Å; Q75-L79 PolarHBondContact O-N 3.43Å
76	K	97.6	Very high	96.8	Very high	133 Å²	133	113.7 Å²	113.7	58%	0.578	52%	0.519	S	S	*	.	H	α-helix	trans	-59.8	-41.7	176.5	-174	176.9	-179.3	176.8	0	112.3	Y72 K73 Q74 A80	Y72-K76 WeakPolarHBondContact O-CB 3.33Å; Y72-K76 PolarHBondContact O-N 2.91Å; K73-K76 PolarHBondContact O-N 2.93Å; Q74-K76 VanDerWaalsContact C-N 3.33Å; Q74-K76 PolarHBondContact O-N 3.26Å; K76-A80 WeakPolarHBondContact O-CB 3.35Å; K76-A80 PolarHBondContact O-N 2.87Å
77	K	97.6	Very high	97.1	Very high	121 Å²	121	111.5 Å²	111.5	53%	0.526	52%	0.519	S	S	.	.	H	α-helix	trans	-63.6	-44.4	175.7	-74.6	174	-170	170.7	0	111.9	K73 Q74 Q75 A80 M81	K73-K77 VanDerWaalsContact O-CG 3.31Å; K73-K77 WeakPolarHBondContact O-CG 3.36Å; K73-K77 PolarHBondContact O-N 2.76Å; Q74-K77 PolarHBondContact O-N 3.21Å; Q75-K77 VanDerWaalsContact C-N 3.33Å; Q75-K77 PolarHBondContact O-N 3.39Å; K77-A80 PolarHBondContact O-N 3.25Å; K77-M81 WeakPolarHBondContact O-CG 3.42Å; K77-M81 PolarHBondContact O-N 3.49Å
78	Q	97.8	Very high	97.3	Very high	120 Å²	120	112.3 Å²	112.3	56%	0.561	52%	0.523	S	S	*	.	H	α-helix	trans	-60.5	-46.8	178.3	-71.2	171.8	3.1	0	0	111.3	Q74 Q75 A80 M81 L82	Q74-Q78 WeakPolarHBondContact O-CG 3.48Å; Q74-Q78 PolarHBondContact O-N 3.15Å; Q75-Q78 PolarHBondContact O-N 2.98Å; Q78-A80 VanDerWaalsContact C-N 3.33Å; Q78-A80 PolarHBondContact O-N 2.9Å; Q78-M81 PolarHBondContact O-N 3.14Å; Q78-L82 PolarHBondContact O-N 3.44Å
79	L	97.7	Very high	97.5	Very high	113 Å²	113	111.5 Å²	111.5	59%	0.592	52%	0.519	S	S	*	.	H	α-helix	trans	-62.2	-39.9	176	-68.9	174.4	0	0	0	112.4	Q75 L82 R83	Q75-L79 WeakPolarHBondContact O-CG 3.38Å; Q75-L79 PolarHBondContact O-N 3.43Å; L79-L82 PolarHBondContact O-N 2.98Å; L79-R83 WeakPolarHBondContact O-CB 3.49Å; L79-R83 WeakPolarHBondContact O-CG 3.35Å; L79-R83 PolarHBondContact O-N 3.22Å
80	A	97.6	Very high	97.6	Very high	45 Å²	45	110.1 Å²	110.1	37%	0.372	52%	0.518	S	S	.	.	H	α-helix	trans	-66	-39.1	176.5	0	0	0	0	0	112.3	K76 K77 Q78 K84	K76-A80 WeakPolarHBondContact O-CB 3.35Å; K76-A80 PolarHBondContact O-N 2.87Å; K77-A80 PolarHBondContact O-N 3.25Å; Q78-A80 VanDerWaalsContact C-N 3.33Å; Q78-A80 PolarHBondContact O-N 2.9Å; A80-K84 WeakPolarHBondContact O-CG 3.33Å; A80-K84 PolarHBondContact O-N 2.95Å; A80-K84 VanDerWaalsContact O-N 3.15Å
81	M	97.8	Very high	97.7	Very high	126 Å²	126	105.8 Å²	105.8	62%	0.621	51%	0.509	S	S	*	.	H	α-helix	trans	-65.8	-46.1	174.8	-71.8	-156.4	-67.8	0	0	111.5	K77 Q78 R83 K84 T85	K77-M81 WeakPolarHBondContact O-CG 3.42Å; K77-M81 PolarHBondContact O-N 3.49Å; Q78-M81 PolarHBondContact O-N 3.14Å; M81-R83 VanDerWaalsContact C-N 3.31Å; M81-R83 PolarHBondContact O-N 3.32Å; M81-K84 PolarHBondContact O-N 3.49Å; M81-K84 VanDerWaalsContact O-N 3.14Å; M81-T85 PolarHBondContact O-N 3.21Å; M81-T85 PolarHBondContact O-OG1 2.97Å
82	L	98	Very high	97.8	Very high	103 Å²	103	102.8 Å²	102.8	54%	0.539	50%	0.503	S	S	.	.	H	α-helix	trans	-58.6	-43.5	178	-177.9	60.5	0	0	0	111.9	Q78 L79 K84 T85 L86	Q78-L82 PolarHBondContact O-N 3.44Å; L79-L82 PolarHBondContact O-N 2.98Å; L82-K84 PolarHBondContact O-N 2.92Å; L82-T85 PolarHBondContact O-N 3.43Å; L82-L86 HydrophobicContact CD1-CD1 4.4Å; L82-L86 HydrophobicContact CD1-CG 4.45Å; L82-L86 HydrophobicContact CG-CD1 4.22Å; L82-L86 WeakPolarHBondContact O-CG 3.43Å; L82-L86 PolarHBondContact O-N 3.36Å
83	R	97.8	Very high	97.9	Very high	184 Å²	184	101.2 Å²	101.2	69%	0.694	50%	0.5	S	S	*	.	H	α-helix	trans	-57.3	-48.4	174.4	-79.2	177	142.1	-168.3	-6.8	112.3	L79 M81 L86 D87	L79-R83 WeakPolarHBondContact O-CB 3.49Å; L79-R83 WeakPolarHBondContact O-CG 3.35Å; L79-R83 PolarHBondContact O-N 3.22Å; M81-R83 VanDerWaalsContact C-N 3.31Å; M81-R83 PolarHBondContact O-N 3.32Å; R83-L86 PolarHBondContact O-N 2.95Å; R83-D87 VanDerWaalsContact O-CG 3.3Å; R83-D87 PolarHBondContact O-N 3.02Å
84	K	98.2	Very high	97.9	Very high	135 Å²	135	103.1 Å²	103.1	59%	0.587	51%	0.509	S	S	*	.	H	α-helix	trans	-60.8	-46.4	179.1	-73.4	177.8	177.4	-170.6	0	112.3	A80 M81 L82 L86 D87 E88	A80-K84 WeakPolarHBondContact O-CG 3.33Å; A80-K84 PolarHBondContact O-N 2.95Å; A80-K84 VanDerWaalsContact O-N 3.15Å; M81-K84 PolarHBondContact O-N 3.49Å; M81-K84 VanDerWaalsContact O-N 3.14Å; L82-K84 PolarHBondContact O-N 2.92Å; K84-L86 VanDerWaalsContact C-N 3.32Å; K84-L86 PolarHBondContact O-N 3.31Å; K84-D87 PolarHBondContact O-N 3.49Å; K84-E88 WeakPolarHBondContact O-CG 3.41Å; K84-E88 PolarHBondContact O-N 2.93Å
85	T	98.2	Very high	97.9	Very high	64 Å²	64	107 Å²	107	39%	0.393	52%	0.524	S	S	.	.	H	α-helix	trans	-60.2	-43.4	178.4	-57.9	0	0	0	0	111.2	M81 L82 D87 E88 E89	M81-T85 PolarHBondContact O-N 3.21Å; M81-T85 PolarHBondContact O-OG1 2.97Å; L82-T85 PolarHBondContact O-N 3.43Å; T85-D87 PolarHBondContact O-N 3.05Å; T85-E88 PolarHBondContact O-N 3.22Å; T85-E89 WeakPolarHBondContact O-CG 3.33Å; T85-E89 PolarHBondContact O-N 3.42Å
86	L	98.3	Very high	98	Very high	86 Å²	86	106 Å²	106	45%	0.45	52%	0.52	S	S	.	.	H	α-helix	trans	-64	-40.8	176	-69.6	171.8	0	0	0	112.3	L82 R83 K84 E88 E89 V90	L82-L86 HydrophobicContact CD1-CD1 4.4Å; L82-L86 HydrophobicContact CD1-CG 4.45Å; L82-L86 HydrophobicContact CG-CD1 4.22Å; L82-L86 WeakPolarHBondContact O-CG 3.43Å; L82-L86 PolarHBondContact O-N 3.36Å; R83-L86 PolarHBondContact O-N 2.95Å; K84-L86 VanDerWaalsContact C-N 3.32Å; K84-L86 PolarHBondContact O-N 3.31Å; L86-E88 VanDerWaalsContact C-N 3.33Å; L86-E88 PolarHBondContact O-N 3.23Å; L86-E89 PolarHBondContact O-N 2.87Å; L86-V90 WeakPolarHBondContact O-CB 3.33Å; L86-V90 VanDerWaalsContact O-CG2 3.28Å; L86-V90 WeakPolarHBondContact O-CG2 3.44Å; L86-V90 PolarHBondContact O-N 3.43Å
87	D	98	Very high	98	Very high	112 Å²	112	104.1 Å²	104.1	60%	0.599	52%	0.515	S	S	*	.	H	α-helix	trans	-63.4	-39.9	176.5	-70.8	-30.6	0	0	0	111.6	R83 K84 T85 A91	R83-D87 VanDerWaalsContact O-CG 3.3Å; R83-D87 PolarHBondContact O-N 3.02Å; K84-D87 PolarHBondContact O-N 3.49Å; T85-D87 PolarHBondContact O-N 3.05Å; D87-A91 WeakPolarHBondContact O-CB 3.44Å; D87-A91 PolarHBondContact O-N 2.97Å
88	E	98.1	Very high	98	Very high	130 Å²	130	103.9 Å²	103.9	61%	0.607	52%	0.516	S	S	*	.	H	α-helix	trans	-64.9	-43.8	175	-73	169	-168.7	0	0	111.9	K84 T85 L86 A91 S92	K84-E88 WeakPolarHBondContact O-CG 3.41Å; K84-E88 PolarHBondContact O-N 2.93Å; T85-E88 PolarHBondContact O-N 3.22Å; L86-E88 VanDerWaalsContact C-N 3.33Å; L86-E88 PolarHBondContact O-N 3.23Å; E88-A91 PolarHBondContact O-N 2.9Å; E88-S92 WeakPolarHBondContact O-CB 3.46Å; E88-S92 PolarHBondContact O-N 3.48Å
89	E	98.2	Very high	98	Very high	98 Å²	98	102.7 Å²	102.7	46%	0.458	51%	0.513	S	S	.	.	H	α-helix	trans	-61.7	-45.6	175.5	-75.2	174.2	-174.9	0	0	111.4	T85 L86 A91 S92 H93	T85-E89 WeakPolarHBondContact O-CG 3.33Å; T85-E89 PolarHBondContact O-N 3.42Å; L86-E89 PolarHBondContact O-N 2.87Å; E89-A91 VanDerWaalsContact C-N 3.33Å; E89-A91 PolarHBondContact O-N 3.17Å; E89-S92 WeakPolarHBondContact O-CB 3.43Å; E89-S92 PolarHBondContact O-N 3.34Å; E89-H93 PolarHBondContact O-CD2 3.18Å; E89-H93 PolarHBondContact O-N 3.43Å
90	V	98.1	Very high	98	Very high	74 Å²	74	103 Å²	103	45%	0.448	51%	0.511	S	S	.	.	H	α-helix	trans	-60.6	-43.4	175.5	169.1	0	0	0	0	111	L86 H93 K94	L86-V90 WeakPolarHBondContact O-CB 3.33Å; L86-V90 VanDerWaalsContact O-CG2 3.28Å; L86-V90 WeakPolarHBondContact O-CG2 3.44Å; L86-V90 PolarHBondContact O-N 3.43Å; V90-H93 PolarHBondContact O-N 3.3Å; V90-K94 HydrophobicContact CG1-CD 4.28Å; V90-K94 WeakPolarHBondContact O-CG 3.49Å; V90-K94 PolarHBondContact O-N 3.48Å
91	A	97.7	Very high	98	Very high	43 Å²	43	106.4 Å²	106.4	36%	0.355	52%	0.519	S	S	.	.	H	α-helix	trans	-64.4	-40.1	177	0	0	0	0	0	112.1	D87 E88 E89 K94 K95	D87-A91 WeakPolarHBondContact O-CB 3.44Å; D87-A91 PolarHBondContact O-N 2.97Å; E88-A91 PolarHBondContact O-N 2.9Å; E89-A91 VanDerWaalsContact C-N 3.33Å; E89-A91 PolarHBondContact O-N 3.17Å; A91-K94 PolarHBondContact O-N 2.93Å; A91-K95 WeakPolarHBondContact O-CG 3.46Å; A91-K95 PolarHBondContact O-N 3.37Å
92	S	98.1	Very high	98	Very high	50 Å²	50	103.9 Å²	103.9	35%	0.35	51%	0.508	S	S	.	.	H	α-helix	trans	-60.7	-49.8	174.6	-174.7	0	0	0	0	111.3	E88 E89 K94 K95 H96	E88-S92 WeakPolarHBondContact O-CB 3.46Å; E88-S92 PolarHBondContact O-N 3.48Å; E89-S92 WeakPolarHBondContact O-CB 3.43Å; E89-S92 PolarHBondContact O-N 3.34Å; S92-K94 VanDerWaalsContact C-N 3.32Å; S92-K94 PolarHBondContact O-N 3.08Å; S92-K95 WeakPolarHBondContact O-CB 3.34Å; S92-K95 PolarHBondContact O-N 3.3Å; S92-K95 VanDerWaalsContact O-N 3.13Å; S92-H96 PolarHBondContact O-CD2 2.99Å; S92-H96 PolarHBondContact O-N 3.43Å
93	H	98.1	Very high	98	Very high	116 Å²	116	100 Å²	100	54%	0.537	49%	0.49	S	S	.	.	H	α-helix	trans	-60.6	-39.5	178.2	-70.5	-43.3	0	0	0	112.8	E89 V90 K95 H96 I97	E89-H93 PolarHBondContact O-CD2 3.18Å; E89-H93 PolarHBondContact O-N 3.43Å; V90-H93 PolarHBondContact O-N 3.3Å; H93-K95 VanDerWaalsContact C-N 3.35Å; H93-K95 PolarHBondContact O-N 3.5Å; H93-H96 PolarHBondContact O-N 2.94Å; H93-I97 VanDerWaalsContact O-CG1 3.29Å; H93-I97 WeakPolarHBondContact O-CG1 3.28Å; H93-I97 PolarHBondContact O-N 3.01Å
94	K	98	Very high	98.1	Very high	141 Å²	141	95.6 Å²	95.6	61%	0.613	48%	0.48	S	S	*	.	H	α-helix	trans	-58.6	-44.7	174.2	-75.1	174.2	179.8	178.6	0	112.3	V90 A91 S92 H96 I97 E98	V90-K94 HydrophobicContact CG1-CD 4.28Å; V90-K94 WeakPolarHBondContact O-CG 3.49Å; V90-K94 PolarHBondContact O-N 3.48Å; A91-K94 PolarHBondContact O-N 2.93Å; S92-K94 VanDerWaalsContact C-N 3.32Å; S92-K94 PolarHBondContact O-N 3.08Å; K94-H96 PolarHBondContact O-N 3.13Å; K94-I97 PolarHBondContact O-N 3.45Å; K94-E98 PolarHBondContact O-N 3.13Å; K94-E98 VanDerWaalsContact O-N 3.13Å
95	K	98.1	Very high	98	Very high	137 Å²	137	94.4 Å²	94.4	60%	0.596	48%	0.476	S	S	*	.	H	α-helix	trans	-62.6	-41.9	176.1	-68.7	174.7	-179	179.5	0	112.1	A91 S92 H93 I97 E98 I99	A91-K95 WeakPolarHBondContact O-CG 3.46Å; A91-K95 PolarHBondContact O-N 3.37Å; S92-K95 WeakPolarHBondContact O-CB 3.34Å; S92-K95 PolarHBondContact O-N 3.3Å; S92-K95 VanDerWaalsContact O-N 3.13Å; H93-K95 VanDerWaalsContact C-N 3.35Å; H93-K95 PolarHBondContact O-N 3.5Å; K95-I97 VanDerWaalsContact C-N 3.33Å; K95-I97 PolarHBondContact O-N 3.01Å; K95-E98 PolarHBondContact O-N 3.35Å; K95-I99 WeakPolarHBondContact O-CG1 3.33Å; K95-I99 PolarHBondContact O-N 3.43Å; K95-I99 VanDerWaalsContact O-N 3.08Å
96	H	98.3	Very high	98	Very high	94 Å²	94	97.3 Å²	97.3	44%	0.435	48%	0.48	S	S	.	.	H	α-helix	trans	-64.2	-39	177.2	-75	-66.7	0	0	0	112.2	S92 H93 K94 I99 H100	S92-H96 PolarHBondContact O-CD2 2.99Å; S92-H96 PolarHBondContact O-N 3.43Å; H93-H96 PolarHBondContact O-N 2.94Å; K94-H96 PolarHBondContact O-N 3.13Å; H96-I99 PolarHBondContact O-N 3.28Å; H96-H100 WeakPolarHBondContact O-CB 3.29Å; H96-H100 PolarHBondContact O-CD2 3.01Å; H96-H100 PolarHBondContact O-N 3.11Å
97	I	97.9	Very high	98	Very high	95 Å²	95	98.6 Å²	98.6	49%	0.487	48%	0.483	S	S	.	.	H	α-helix	trans	-60.1	-46.6	175.5	-70.3	164	0	0	0	110.6	H93 K94 K95 H100 Q101	H93-I97 VanDerWaalsContact O-CG1 3.29Å; H93-I97 WeakPolarHBondContact O-CG1 3.28Å; H93-I97 PolarHBondContact O-N 3.01Å; K94-I97 PolarHBondContact O-N 3.45Å; K95-I97 VanDerWaalsContact C-N 3.33Å; K95-I97 PolarHBondContact O-N 3.01Å; I97-H100 PolarHBondContact O-N 3.43Å; I97-Q101 HydrophobicContact CG2-CG 4.3Å; I97-Q101 WeakPolarHBondContact O-CB 3.26Å; I97-Q101 VanDerWaalsContact O-CG 3.26Å; I97-Q101 WeakPolarHBondContact O-CG 3.48Å; I97-Q101 PolarHBondContact O-N 3.31Å
98	E	97.5	Very high	98	Very high	115 Å²	115	100 Å²	100	54%	0.537	48%	0.484	S	S	.	.	H	α-helix	trans	-58.7	-49.8	177.9	-174	178.1	-171.4	0	0	111.6	K94 K95 H100 Q101 D102	K94-E98 PolarHBondContact O-N 3.13Å; K94-E98 VanDerWaalsContact O-N 3.13Å; K95-E98 PolarHBondContact O-N 3.35Å; E98-H100 VanDerWaalsContact C-N 3.29Å; E98-H100 PolarHBondContact O-N 3.24Å; E98-Q101 WeakPolarHBondContact O-CB 3.42Å; E98-Q101 PolarHBondContact O-N 2.96Å; E98-Q101 VanDerWaalsContact O-N 3.09Å; E98-D102 PolarHBondContact O-N 3.09Å
99	I	98	Very high	98	Very high	96 Å²	96	98.6 Å²	98.6	49%	0.492	48%	0.478	S	S	.	.	H	α-helix	trans	-58.8	-40.9	177.5	-66.5	164.7	0	0	0	111.8	K95 H96 A103	K95-I99 WeakPolarHBondContact O-CG1 3.33Å; K95-I99 PolarHBondContact O-N 3.43Å; K95-I99 VanDerWaalsContact O-N 3.08Å; H96-I99 PolarHBondContact O-N 3.28Å; I99-A103 PolarHBondContact O-N 3.33Å
100	H	98.3	Very high	98	Very high	119 Å²	119	99.8 Å²	99.8	55%	0.551	48%	0.481	S	S	*	.	H	α-helix	trans	-70	-35.9	177.3	-74.7	-53.2	0	0	0	112.4	H96 I97 E98 A103 I104	H96-H100 WeakPolarHBondContact O-CB 3.29Å; H96-H100 PolarHBondContact O-CD2 3.01Å; H96-H100 PolarHBondContact O-N 3.11Å; I97-H100 PolarHBondContact O-N 3.43Å; E98-H100 VanDerWaalsContact C-N 3.29Å; E98-H100 PolarHBondContact O-N 3.24Å; H100-A103 PolarHBondContact O-N 2.85Å; H100-I104 VanDerWaalsContact O-CG1 3.26Å; H100-I104 WeakPolarHBondContact O-CG1 3.38Å; H100-I104 PolarHBondContact O-N 3.38Å
101	Q	98.1	Very high	98	Very high	116 Å²	116	101.1 Å²	101.1	54%	0.542	49%	0.485	S	S	.	.	H	α-helix	trans	-62.3	-46	173.8	-75.3	171.9	-11.4	0	0	111.1	I97 E98 A103 I104 E105	I97-Q101 HydrophobicContact CG2-CG 4.3Å; I97-Q101 WeakPolarHBondContact O-CB 3.26Å; I97-Q101 VanDerWaalsContact O-CG 3.26Å; I97-Q101 WeakPolarHBondContact O-CG 3.48Å; I97-Q101 PolarHBondContact O-N 3.31Å; E98-Q101 WeakPolarHBondContact O-CB 3.42Å; E98-Q101 PolarHBondContact O-N 2.96Å; E98-Q101 VanDerWaalsContact O-N 3.09Å; Q101-A103 VanDerWaalsContact C-N 3.29Å; Q101-A103 PolarHBondContact O-N 2.94Å; Q101-I104 WeakPolarHBondContact O-CB 3.26Å; Q101-I104 PolarHBondContact O-N 3.26Å; Q101-I104 VanDerWaalsContact O-N 3.17Å; Q101-E105 PolarHBondContact O-N 3.09Å
102	D	98	Very high	97.9	Very high	74 Å²	74	101.3 Å²	101.3	40%	0.396	49%	0.487	S	S	.	.	H	α-helix	trans	-61.7	-39.2	175.8	-67.1	-11.9	0	0	0	111.7	E98 E105 R106	E98-D102 PolarHBondContact O-N 3.09Å; D102-E105 PolarHBondContact O-N 3.06Å; D102-R106 WeakPolarHBondContact O-CG 3.45Å; D102-R106 PolarHBondContact O-N 3Å; D102-R106 PolarHBondContact O-NH1 3.31Å
103	A	98.1	Very high	97.9	Very high	20 Å²	20	104.5 Å²	104.5	17%	0.165	50%	0.496	C	S	.	.	H	α-helix	trans	-63.1	-43.7	175.5	0	0	0	0	0	111.9	I99 H100 Q101 E105 R106 H107	I99-A103 PolarHBondContact O-N 3.33Å; H100-A103 PolarHBondContact O-N 2.85Å; Q101-A103 VanDerWaalsContact C-N 3.29Å; Q101-A103 PolarHBondContact O-N 2.94Å; A103-E105 VanDerWaalsContact C-N 3.31Å; A103-E105 PolarHBondContact O-N 3.36Å; A103-R106 PolarHBondContact O-N 3.45Å; A103-H107 PolarHBondContact O-CD2 3.03Å; A103-H107 PolarHBondContact O-N 3.17Å
104	I	98.1	Very high	97.8	Very high	92 Å²	92	103.5 Å²	103.5	47%	0.472	49%	0.494	S	S	.	.	H	α-helix	trans	-60.1	-43.1	175.3	-70.7	163.6	0	0	0	110.3	H100 Q101 H107 K108	H100-I104 VanDerWaalsContact O-CG1 3.26Å; H100-I104 WeakPolarHBondContact O-CG1 3.38Å; H100-I104 PolarHBondContact O-N 3.38Å; Q101-I104 WeakPolarHBondContact O-CB 3.26Å; Q101-I104 PolarHBondContact O-N 3.26Å; Q101-I104 VanDerWaalsContact O-N 3.17Å; I104-H107 PolarHBondContact O-N 3.43Å; I104-K108 HydrophobicContact CG2-CD 4.09Å; I104-K108 HydrophobicContact CG2-CG 4.46Å; I104-K108 WeakPolarHBondContact O-CG 3.42Å; I104-K108 PolarHBondContact O-N 3.42Å
105	E	97.7	Very high	97.8	Very high	110 Å²	110	99.4 Å²	99.4	51%	0.514	48%	0.48	S	S	.	.	H	α-helix	trans	-62	-47.5	178.1	-170.3	-179.7	168.4	0	0	112	Q101 D102 A103 H107 K108 Q109	Q101-E105 PolarHBondContact O-N 3.09Å; D102-E105 PolarHBondContact O-N 3.06Å; A103-E105 VanDerWaalsContact C-N 3.31Å; A103-E105 PolarHBondContact O-N 3.36Å; E105-H107 VanDerWaalsContact C-N 3.28Å; E105-H107 PolarHBondContact O-N 3.12Å; E105-K108 WeakPolarHBondContact O-CB 3.44Å; E105-K108 PolarHBondContact O-N 3.32Å; E105-K108 VanDerWaalsContact O-N 3.12Å; E105-Q109 WeakPolarHBondContact O-CG 3.45Å; E105-Q109 PolarHBondContact O-N 2.96Å; E105-Q109 PolarHBondContact OE1-NE2 3.39Å
106	R	97.6	Very high	97.7	Very high	126 Å²	126	99.3 Å²	99.3	48%	0.475	48%	0.48	S	S	.	.	H	α-helix	trans	-57.8	-41.4	175.5	-70.2	-171.9	-59.2	-90.3	4.9	112.1	D102 A103 Q109 K110	D102-R106 WeakPolarHBondContact O-CG 3.45Å; D102-R106 PolarHBondContact O-N 3Å; D102-R106 PolarHBondContact O-NH1 3.31Å; A103-R106 PolarHBondContact O-N 3.45Å; R106-Q109 PolarHBondContact O-N 2.94Å; R106-K110 WeakPolarHBondContact O-CG 3.33Å; R106-K110 PolarHBondContact O-N 2.93Å; R106-K110 VanDerWaalsContact O-N 3.09Å
107	H	98.1	Very high	97.5	Very high	112 Å²	112	100 Å²	100	52%	0.519	48%	0.484	S	S	.	.	H	α-helix	trans	-67.1	-39.2	177.1	-70.1	-47.7	0	0	0	112.1	A103 I104 E105 Q109 K110 I111	A103-H107 PolarHBondContact O-CD2 3.03Å; A103-H107 PolarHBondContact O-N 3.17Å; I104-H107 PolarHBondContact O-N 3.43Å; E105-H107 VanDerWaalsContact C-N 3.28Å; E105-H107 PolarHBondContact O-N 3.12Å; H107-Q109 VanDerWaalsContact C-N 3.34Å; H107-Q109 PolarHBondContact O-N 3.42Å; H107-K110 PolarHBondContact O-N 3.41Å; H107-I111 WeakPolarHBondContact O-CD1 3.25Å; H107-I111 VanDerWaalsContact O-CG1 3.25Å; H107-I111 WeakPolarHBondContact O-CG1 3.49Å; H107-I111 PolarHBondContact O-N 3.46Å
108	K	98.1	Very high	97.4	Very high	141 Å²	141	100.8 Å²	100.8	61%	0.613	49%	0.485	S	S	*	.	H	α-helix	trans	-61.2	-41.6	174	-73.6	172.5	177.2	177.7	0	112.2	I104 E105 I111 A112	I104-K108 HydrophobicContact CG2-CD 4.09Å; I104-K108 HydrophobicContact CG2-CG 4.46Å; I104-K108 WeakPolarHBondContact O-CG 3.42Å; I104-K108 PolarHBondContact O-N 3.42Å; E105-K108 WeakPolarHBondContact O-CB 3.44Å; E105-K108 PolarHBondContact O-N 3.32Å; E105-K108 VanDerWaalsContact O-N 3.12Å; K108-I111 PolarHBondContact O-N 3.01Å; K108-A112 PolarHBondContact O-N 3.1Å
109	Q	97.7	Very high	97.2	Very high	101 Å²	101	101.5 Å²	101.5	47%	0.472	49%	0.486	S	S	.	.	H	α-helix	trans	-62.2	-47	176.2	-69.3	174.4	0.1	0	0	111.4	E105 R106 H107 I111 A112 E113	E105-Q109 WeakPolarHBondContact O-CG 3.45Å; E105-Q109 PolarHBondContact O-N 2.96Å; E105-Q109 PolarHBondContact OE1-NE2 3.39Å; R106-Q109 PolarHBondContact O-N 2.94Å; H107-Q109 VanDerWaalsContact C-N 3.34Å; H107-Q109 PolarHBondContact O-N 3.42Å; Q109-I111 VanDerWaalsContact C-N 3.34Å; Q109-I111 PolarHBondContact O-N 2.97Å; Q109-A112 WeakPolarHBondContact O-CB 3.44Å; Q109-A112 PolarHBondContact O-N 3.47Å; Q109-A112 VanDerWaalsContact O-N 3.1Å; Q109-E113 PolarHBondContact O-N 2.97Å
110	K	97.9	Very high	97	Very high	123 Å²	123	103 Å²	103	54%	0.535	49%	0.489	S	S	.	.	H	α-helix	trans	-60.1	-42.1	175.6	-71.6	179.9	178.6	-171.7	0	112.6	R106 H107 A112 E113 L114	R106-K110 WeakPolarHBondContact O-CG 3.33Å; R106-K110 PolarHBondContact O-N 2.93Å; R106-K110 VanDerWaalsContact O-N 3.09Å; H107-K110 PolarHBondContact O-N 3.41Å; K110-A112 VanDerWaalsContact C-N 3.3Å; K110-A112 PolarHBondContact O-N 3.25Å; K110-E113 PolarHBondContact O-N 3.34Å; K110-L114 WeakPolarHBondContact O-CG 3.35Å; K110-L114 PolarHBondContact O-N 2.93Å
111	I	98	Very high	96.6	Very high	103 Å²	103	102.8 Å²	102.8	53%	0.528	49%	0.492	S	S	.	.	H	α-helix	trans	-60.7	-43.3	174.7	-69.1	163.3	0	0	0	110.1	H107 K108 Q109 E113 L114 V115	H107-I111 WeakPolarHBondContact O-CD1 3.25Å; H107-I111 VanDerWaalsContact O-CG1 3.25Å; H107-I111 WeakPolarHBondContact O-CG1 3.49Å; H107-I111 PolarHBondContact O-N 3.46Å; K108-I111 PolarHBondContact O-N 3.01Å; Q109-I111 VanDerWaalsContact C-N 3.34Å; Q109-I111 PolarHBondContact O-N 2.97Å; I111-E113 VanDerWaalsContact C-N 3.31Å; I111-E113 PolarHBondContact O-N 3.21Å; I111-L114 PolarHBondContact O-N 3.01Å; I111-V115 HydrophobicContact CG2-CG2 4.32Å; I111-V115 WeakPolarHBondContact O-CB 3.37Å; I111-V115 VanDerWaalsContact O-CG2 3.25Å; I111-V115 WeakPolarHBondContact O-CG2 3.5Å; I111-V115 PolarHBondContact O-N 3.05Å
112	A	97.1	Very high	96.1	Very high	47 Å²	47	102.8 Å²	102.8	39%	0.388	49%	0.492	S	S	.	.	H	α-helix	trans	-64.9	-33.2	178	0	0	0	0	0	113.2	K108 Q109 K110 K116	K108-A112 PolarHBondContact O-N 3.1Å; Q109-A112 WeakPolarHBondContact O-CB 3.44Å; Q109-A112 PolarHBondContact O-N 3.47Å; Q109-A112 VanDerWaalsContact O-N 3.1Å; K110-A112 VanDerWaalsContact C-N 3.3Å; K110-A112 PolarHBondContact O-N 3.25Å; A112-K116 VanDerWaalsContact O-CG 3.3Å; A112-K116 WeakPolarHBondContact O-CG 3.49Å; A112-K116 PolarHBondContact O-N 2.98Å
113	E	97.1	Very high	95.8	Very high	116 Å²	116	103.9 Å²	103.9	54%	0.542	50%	0.501	S	S	.	.	H	α-helix	trans	-66.9	-48.7	172.5	-71.6	171.9	175.9	0	0	111.4	Q109 K110 I111 V115 K116 E117	Q109-E113 PolarHBondContact O-N 2.97Å; K110-E113 PolarHBondContact O-N 3.34Å; I111-E113 VanDerWaalsContact C-N 3.31Å; I111-E113 PolarHBondContact O-N 3.21Å; E113-V115 VanDerWaalsContact C-N 3.33Å; E113-V115 PolarHBondContact O-N 3.03Å; E113-K116 WeakPolarHBondContact O-CA 3.25Å; E113-K116 WeakPolarHBondContact O-CB 3.49Å; E113-K116 PolarHBondContact O-N 3.28Å; E113-E117 PolarHBondContact O-N 2.93Å
114	L	97	Very high	95.1	Very high	96 Å²	96	111 Å²	111	50%	0.503	53%	0.529	S	S	.	.	H	α-helix	trans	-58.5	-44.5	176.7	-68.7	171.2	0	0	0	111.7	K110 I111 K116 E117 E118	K110-L114 WeakPolarHBondContact O-CG 3.35Å; K110-L114 PolarHBondContact O-N 2.93Å; I111-L114 PolarHBondContact O-N 3.01Å; L114-K116 VanDerWaalsContact C-N 3.25Å; L114-K116 PolarHBondContact O-N 3.39Å; L114-E117 WeakPolarHBondContact O-CB 3.38Å; L114-E117 PolarHBondContact O-N 3.33Å; L114-E118 WeakPolarHBondContact O-CG 3.3Å; L114-E118 PolarHBondContact O-N 2.86Å
115	V	97.3	Very high	94.1	Very high	54 Å²	54	114.7 Å²	114.7	33%	0.327	54%	0.544	S	S	.	.	H	α-helix	trans	-62	-32.3	176.2	170.2	0	0	0	0	112.1	I111 E113 K119	I111-V115 HydrophobicContact CG2-CG2 4.32Å; I111-V115 WeakPolarHBondContact O-CB 3.37Å; I111-V115 VanDerWaalsContact O-CG2 3.25Å; I111-V115 WeakPolarHBondContact O-CG2 3.5Å; I111-V115 PolarHBondContact O-N 3.05Å; E113-V115 VanDerWaalsContact C-N 3.33Å; E113-V115 PolarHBondContact O-N 3.03Å; V115-K119 VanDerWaalsContact O-CG 3.31Å; V115-K119 WeakPolarHBondContact O-CG 3.43Å; V115-K119 PolarHBondContact O-N 3.17Å
116	K	95.5	Very high	92.7	Very high	135 Å²	135	120.5 Å²	120.5	59%	0.587	57%	0.567	S	S	*	*	H	α-helix	trans	-71.2	-37.1	174	-73.4	169.2	-175.2	175.1	0	111.5	A112 E113 L114 K120	A112-K116 VanDerWaalsContact O-CG 3.3Å; A112-K116 WeakPolarHBondContact O-CG 3.49Å; A112-K116 PolarHBondContact O-N 2.98Å; E113-K116 WeakPolarHBondContact O-CA 3.25Å; E113-K116 WeakPolarHBondContact O-CB 3.49Å; E113-K116 PolarHBondContact O-N 3.28Å; L114-K116 VanDerWaalsContact C-N 3.25Å; L114-K116 PolarHBondContact O-N 3.39Å; K116-K120 WeakPolarHBondContact O-CG 3.31Å; K116-K120 PolarHBondContact O-N 3.45Å
117	E	95	Very high	92.4	Very high	109 Å²	109	120.2 Å²	120.2	51%	0.509	57%	0.572	S	S	.	*	H	α-helix	trans	-68.3	-43.4	176.4	-68.7	179.7	168	0	0	111.5	E113 L114 K119 K120 L121	E113-E117 PolarHBondContact O-N 2.93Å; L114-E117 WeakPolarHBondContact O-CB 3.38Å; L114-E117 PolarHBondContact O-N 3.33Å; E117-K119 VanDerWaalsContact C-N 3.32Å; E117-K119 PolarHBondContact O-N 3.05Å; E117-K120 WeakPolarHBondContact O-CB 3.41Å; E117-K120 PolarHBondContact O-N 3.2Å; E117-L121 WeakPolarHBondContact O-CG 3Å; E117-L121 PolarHBondContact O-N 3.14Å
118	E	94.3	Very high	92.1	Very high	111 Å²	111	120.6 Å²	120.6	52%	0.519	58%	0.575	S	S	.	*	H	α-helix	trans	-54.6	-47.7	172.9	-73	172.4	172.1	0	0	111.3	L114 K120 L121 E122	L114-E118 WeakPolarHBondContact O-CG 3.3Å; L114-E118 PolarHBondContact O-N 2.86Å; E118-K120 VanDerWaalsContact C-N 3.3Å; E118-K120 PolarHBondContact O-N 3.38Å; E118-L121 PolarHBondContact O-N 3.23Å; E118-L121 VanDerWaalsContact O-N 3.14Å; E118-E122 PolarHBondContact O-N 3.3Å
119	K	94.1	Very high	91.8	Very high	130 Å²	130	119.5 Å²	119.5	57%	0.565	57%	0.573	S	S	*	*	H	α-helix	trans	-61.5	-35.7	176.2	-73.8	175	-177.6	-177	0	113.4	V115 E117 T123	V115-K119 VanDerWaalsContact O-CG 3.31Å; V115-K119 WeakPolarHBondContact O-CG 3.43Å; V115-K119 PolarHBondContact O-N 3.17Å; E117-K119 VanDerWaalsContact C-N 3.32Å; E117-K119 PolarHBondContact O-N 3.05Å; K119-T123 WeakPolarHBondContact O-CG2 3.36Å; K119-T123 PolarHBondContact O-N 3.33Å; K119-T123 PolarHBondContact O-OG1 3.24Å
120	K	93.3	Very high	91.4	Very high	128 Å²	128	120.6 Å²	120.6	56%	0.557	58%	0.579	S	S	*	*	H	α-helix	trans	-67	-41.4	175.7	-71.2	170.6	-175.9	176.8	0	110.5	K116 E117 E118 T123 F124	K116-K120 WeakPolarHBondContact O-CG 3.31Å; K116-K120 PolarHBondContact O-N 3.45Å; E117-K120 WeakPolarHBondContact O-CB 3.41Å; E117-K120 PolarHBondContact O-N 3.2Å; E118-K120 VanDerWaalsContact C-N 3.3Å; E118-K120 PolarHBondContact O-N 3.38Å; K120-T123 WeakPolarHBondContact CA-OG1 3.49Å; K120-T123 PolarHBondContact O-N 2.99Å; K120-T123 PolarHBondContact O-OG1 3.26Å; K120-F124 WeakPolarHBondContact O-CD2 3.48Å; K120-F124 PolarHBondContact O-N 2.99Å
121	L	89.7	Confident	91	Very high	115 Å²	115	120.4 Å²	120.4	60%	0.602	58%	0.581	S	S	*	*	H	α-helix	trans	-63.1	-45.2	177	-66	173.4	0	0	0	111.6	E117 E118 T123 F124 E125	E117-L121 WeakPolarHBondContact O-CG 3Å; E117-L121 PolarHBondContact O-N 3.14Å; E118-L121 PolarHBondContact O-N 3.23Å; E118-L121 VanDerWaalsContact O-N 3.14Å; L121-T123 PolarHBondContact O-N 2.66Å; L121-F124 PolarHBondContact O-N 2.98Å; L121-E125 PolarHBondContact O-N 3.2Å
122	E	88.8	Confident	90.6	Very high	116 Å²	116	121.6 Å²	121.6	54%	0.542	59%	0.585	S	S	.	*	H	α-helix	trans	-59.1	-29.8	175.2	-70.6	-179.9	-179.5	0	0	113.4	E118	E118-E122 PolarHBondContact O-N 3.3Å
123	T	90.4	Very high	90.1	Very high	96 Å²	96	126.9 Å²	126.9	59%	0.589	60%	0.599	S	S	*	*	H	α-helix	trans	-77	-21.8	175.3	55	0	0	0	0	113.9	K119 K120 L121	K119-T123 WeakPolarHBondContact O-CG2 3.36Å; K119-T123 PolarHBondContact O-N 3.33Å; K119-T123 PolarHBondContact O-OG1 3.24Å; K120-T123 WeakPolarHBondContact CA-OG1 3.49Å; K120-T123 PolarHBondContact O-N 2.99Å; K120-T123 PolarHBondContact O-OG1 3.26Å; L121-T123 PolarHBondContact O-N 2.66Å
124	F	83.4	Confident	89.6	Confident	169 Å²	169	127.8 Å²	127.8	74%	0.741	60%	0.603	S	S	*	*	H	α-helix	trans	-85.5	-23	176.5	-74.3	-67.5	0	0	0	113.1	K120 L121 K126	K120-F124 WeakPolarHBondContact O-CD2 3.48Å; K120-F124 PolarHBondContact O-N 2.99Å; L121-F124 PolarHBondContact O-N 2.98Å; F124-K126 VanDerWaalsContact C-N 3.3Å
125	E	78.6	Confident	89	Confident	171 Å²	171	130.4 Å²	130.4	80%	0.799	61%	0.612	S	S	*	*			trans	-78.3	-11.6	177.5	-68.3	-174.4	166.7	0	0	113.8	L121	L121-E125 PolarHBondContact O-N 3.2Å
126	K	67.4	Low	88.2	Confident	231 Å²	231	137.4 Å²	137.4	100%	1.004	64%	0.638	S	S	*	*			trans	-101.1	0	179.1	-67.1	178.1	-175.3	169.4	0	111.8	F124	F124-K126 VanDerWaalsContact C-N 3.3Å

Retrieved 126 of 126 residues in 186.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).