A0A077Z2V5_TRITR Loading...

Signal peptidase complex subunit 1

Component of the signal peptidase complex (SPC) which catalyzes the cleavage of N-terminal signal sequences from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum. Dispensable for SPC enzymatic activity.

AlphaFold DB , UniProt , Accession A0A077Z2V5, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 97 aa.

						>A0A077Z2V5_TRITR|A0A077Z2V5
MMSFLVSNLPKFSTHIDFVGQAKAERTYQVVLVIAGVIGFVVGYSMQQFSITIYTTLAGFLLACMLVLPPWPFLRRHPVACTLSQMQVVYRCKKRKE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	61.5	Low	65.6	Low	194 Å²	194	128.5 Å²	128.5	96%	0.956	68%	0.678	S	S	*	*				0	-44.9	0	-89.1	174.6	72.5	0	0	113.4	S3 F4 L5	M1-S3 PolarHBondContact O-N 3.08Å; M1-S3 VanDerWaalsContact O-N 3.16Å; M1-F4 PolarHBondContact O-N 3.02Å; M1-F4 VanDerWaalsContact O-N 3.09Å; M1-L5 PolarHBondContact O-N 2.78Å
2	M	65.9	Low	65.6	Low	166 Å²	166	132.1 Å²	132.1	82%	0.818	69%	0.685	S	S	*	*	H	α-helix	trans	-53.3	-33.7	176.8	-68.6	-90.5	168.8	0	0	113.7	L5 V6	M2-L5 PolarHBondContact O-N 3.06Å; M2-V6 PolarHBondContact O-N 3.31Å
3	S	65.7	Low	65.7	Low	80 Å²	80	129.1 Å²	129.1	56%	0.559	68%	0.682	S	S	*	*	H	α-helix	trans	-65.9	-34.8	177.4	44.5	0	0	0	0	114.5	M1 V6 S7	M1-S3 PolarHBondContact O-N 3.08Å; M1-S3 VanDerWaalsContact O-N 3.16Å; S3-V6 PolarHBondContact O-N 3.49Å; S3-S7 PolarHBondContact O-N 3.5Å
4	F	71.5	Confident	65.7	Low	150 Å²	150	129.8 Å²	129.8	66%	0.658	69%	0.694	S	S	*	*	H	α-helix	trans	-74.3	-31.9	177.1	-77.8	-78.5	0	0	0	112.4	M1 V6 S7 N8	M1-F4 PolarHBondContact O-N 3.02Å; M1-F4 VanDerWaalsContact O-N 3.09Å; F4-V6 VanDerWaalsContact C-N 3.32Å; F4-S7 PolarHBondContact O-OG 3.33Å; F4-S7 VanDerWaalsContact O-OG 3.13Å; F4-N8 PolarHBondContact O-ND2 2.84Å
5	L	65.7	Low	66	Low	125 Å²	125	130 Å²	130	65%	0.654	69%	0.689	S	S	*	*	H	α-helix	trans	-67.5	-38.7	173.7	-63.9	179.8	0	0	0	110.5	M1 M2 N8 L9	M1-L5 PolarHBondContact O-N 2.78Å; M2-L5 PolarHBondContact O-N 3.06Å; L5-N8 PolarHBondContact O-N 3Å; L5-L9 PolarHBondContact O-N 3.48Å
6	V	67.8	Low	66.2	Low	97 Å²	97	127.9 Å²	127.9	59%	0.588	68%	0.677	S	S	*	*	H	α-helix	trans	-68.9	-39.3	-179.2	126.3	0	0	0	0	113	M2 S3 F4 N8 L9	M2-V6 PolarHBondContact O-N 3.31Å; S3-V6 PolarHBondContact O-N 3.49Å; F4-V6 VanDerWaalsContact C-N 3.32Å; V6-N8 PolarHBondContact O-N 3.07Å; V6-L9 HydrophobicContact CB-CD1 4.27Å; V6-L9 HydrophobicContact CG2-CD1 3.65Å; V6-L9 WeakPolarHBondContact O-CB 3.47Å; V6-L9 PolarHBondContact O-N 3.48Å; V6-L9 VanDerWaalsContact O-N 3.11Å
7	S	63.2	Low	66.5	Low	85 Å²	85	124.3 Å²	124.3	59%	0.594	66%	0.658	S	S	*	*	H	α-helix	trans	-67.9	-26.4	179.2	61.5	0	0	0	0	113.2	S3 F4 L9	S3-S7 PolarHBondContact O-N 3.5Å; F4-S7 PolarHBondContact O-OG 3.33Å; F4-S7 VanDerWaalsContact O-OG 3.13Å; S7-L9 VanDerWaalsContact C-N 3.3Å
8	N	65.6	Low	66.9	Low	129 Å²	129	124.2 Å²	124.2	69%	0.69	65%	0.651	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82	-6.6	175.6	-75.3	-56.9	0	0	0	113.1	F4 L5 V6 P10	F4-N8 PolarHBondContact O-ND2 2.84Å; L5-N8 PolarHBondContact O-N 3Å; V6-N8 PolarHBondContact O-N 3.07Å; N8-P10 WeakPolarHBondContact O-CD 3.38Å
9	L	64.6	Low	67.3	Low	96 Å²	96	122.4 Å²	122.4	50%	0.503	65%	0.646	S	S	.	*	S	Bend	trans	-67.3	124	173.2	-72.8	155.6	0	0	0	108.3	L5 V6 S7 K11	L5-L9 PolarHBondContact O-N 3.48Å; V6-L9 HydrophobicContact CB-CD1 4.27Å; V6-L9 HydrophobicContact CG2-CD1 3.65Å; V6-L9 WeakPolarHBondContact O-CB 3.47Å; V6-L9 PolarHBondContact O-N 3.48Å; V6-L9 VanDerWaalsContact O-N 3.11Å; S7-L9 VanDerWaalsContact C-N 3.3Å; L9-K11 PolarHBondContact O-N 3.23Å
10	P	63.4	Low	67.7	Low	83 Å²	83	116.5 Å²	116.5	54%	0.539	62%	0.616	S	S	.	*			trans	-56.2	130.8	175	23.4	-31.8	0	0	0	108.6	N8 F12	N8-P10 WeakPolarHBondContact O-CD 3.38Å; P10-F12 PolarHBondContact O-N 2.84Å
11	K	67.3	Low	68.4	Low	208 Å²	208	116 Å²	116	90%	0.904	61%	0.61	S	S	*	*			trans	-53.9	109.3	173	-77	174.9	178	164.8	0	108.1	L9 S13	L9-K11 PolarHBondContact O-N 3.23Å; K11-S13 PolarHBondContact O-N 3.44Å
12	F	65.3	Low	69.5	Low	172 Å²	172	109.4 Å²	109.4	75%	0.754	59%	0.586	S	S	*	*			trans	-65.1	110.6	175.1	-70.1	-74.2	0	0	0	107.7	P10 T14	P10-F12 PolarHBondContact O-N 2.84Å; F12-T14 PolarHBondContact O-N 3.05Å
13	S	66.6	Low	70.4	Confident	93 Å²	93	105.3 Å²	105.3	65%	0.65	56%	0.564	S	S	*	*			trans	-58.4	123.8	164.4	-174.1	0	0	0	0	106.6	K11 H15	K11-S13 PolarHBondContact O-N 3.44Å; S13-H15 PolarHBondContact O-N 2.98Å; S13-H15 VanDerWaalsContact O-N 3.1Å
14	T	66.1	Low	71.4	Confident	139 Å²	139	102.4 Å²	102.4	85%	0.853	55%	0.545	S	S	*	.	S	Bend	trans	-62.2	-14.8	176.6	49.2	0	0	0	0	112.2	F12 I16	F12-T14 PolarHBondContact O-N 3.05Å; T14-I16 PolarHBondContact O-N 3.02Å
15	H	70.3	Confident	72.3	Confident	133 Å²	133	100 Å²	100	62%	0.616	54%	0.536	S	S	*	.			trans	-75.9	102.2	173.6	-166.7	-78.3	0	0	0	110.6	S13	S13-H15 PolarHBondContact O-N 2.98Å; S13-H15 VanDerWaalsContact O-N 3.1Å
16	I	68.9	Low	73.5	Confident	96 Å²	96	101.7 Å²	101.7	49%	0.492	53%	0.533	S	S	.	.			trans	-77.6	130.2	177.2	-68.3	151.2	0	0	0	109.9	T14	T14-I16 PolarHBondContact O-N 3.02Å
17	D	71.5	Confident	74.6	Confident	67 Å²	67	100.1 Å²	100.1	36%	0.358	52%	0.524	S	S	.	.			trans	-89.4	106	174	-175.4	-26.1	0	0	0	110.3	V19 G20 Q21	D17-V19 PolarHBondContact O-N 3.33Å; D17-V19 PolarHBondContact OD1-N 3.3Å; D17-G20 PolarHBondContact OD1-N 3.37Å; D17-Q21 WeakPolarHBondContact O-CB 3.39Å; D17-Q21 PolarHBondContact O-N 2.86Å
18	F	73.4	Confident	76.1	Confident	123 Å²	123	99.1 Å²	99.1	54%	0.539	51%	0.508	S	S	.	.	H	α-helix	trans	-67.5	-32.1	-179.8	-63.8	-76.4	0	0	0	113.9	A22 M86	F18-A22 WeakPolarHBondContact O-CB 3.17Å; F18-A22 PolarHBondContact O-N 3.41Å; F18-M86 HydrophobicContact CB-CE 4.37Å; F18-M86 HydrophobicContact CD2-CE 3.28Å; F18-M86 HydrophobicContact CE2-CE 3.75Å; F18-M86 HydrophobicContact CG-CE 4Å
19	V	74.7	Confident	77.5	Confident	89 Å²	89	96.3 Å²	96.3	54%	0.539	49%	0.49	S	S	.	.	H	α-helix	trans	-75.3	-46.6	-177.3	179.8	0	0	0	0	109.5	D17 K23 V79	D17-V19 PolarHBondContact O-N 3.33Å; D17-V19 PolarHBondContact OD1-N 3.3Å; V19-K23 PolarHBondContact O-N 3.12Å; V19-V79 HydrophobicContact CG2-CG1 4.31Å
20	G	75.7	Confident	79	Confident	5 Å²	5	95.8 Å²	95.8	5%	0.052	49%	0.491	C	S	.	.	H	α-helix	trans	-59.8	-49.5	172.6	0	0	0	0	0	111.1	D17 A22 K23 A24 L74	D17-G20 PolarHBondContact OD1-N 3.37Å; G20-A22 PolarHBondContact O-N 2.81Å; G20-K23 WeakPolarHBondContact O-CB 3.48Å; G20-K23 PolarHBondContact O-N 3.5Å; G20-K23 VanDerWaalsContact O-N 3.08Å; G20-A24 PolarHBondContact O-N 3.1Å; G20-L74 WeakPolarHBondContact O-CD1 3.44Å
21	Q	82.3	Confident	80.5	Confident	107 Å²	107	93.7 Å²	93.7	50%	0.5	48%	0.477	S	S	.	.	H	α-helix	trans	-58.4	-44.2	-179.7	-177.1	177.3	-26.7	0	0	112.7	D17 K23 A24 E25	D17-Q21 WeakPolarHBondContact O-CB 3.39Å; D17-Q21 PolarHBondContact O-N 2.86Å; Q21-K23 VanDerWaalsContact C-N 3.27Å; Q21-K23 PolarHBondContact O-N 3.16Å; Q21-A24 WeakPolarHBondContact O-CB 3.32Å; Q21-A24 PolarHBondContact O-N 3.29Å; Q21-E25 WeakPolarHBondContact O-CB 3.46Å; Q21-E25 PolarHBondContact O-N 2.79Å
22	A	84	Confident	81.9	Confident	54 Å²	54	85.9 Å²	85.9	45%	0.446	45%	0.445	S	S	.	.	H	α-helix	trans	-60.8	-38.1	177.3	0	0	0	0	0	112.1	F18 G20 E25 R26	F18-A22 WeakPolarHBondContact O-CB 3.17Å; F18-A22 PolarHBondContact O-N 3.41Å; G20-A22 PolarHBondContact O-N 2.81Å; A22-E25 PolarHBondContact O-N 3.45Å; A22-R26 WeakPolarHBondContact O-CG 3.04Å; A22-R26 PolarHBondContact O-N 2.97Å; A22-R26 VanDerWaalsContact O-N 3.08Å
23	K	85.3	Confident	83.4	Confident	81 Å²	81	82.1 Å²	82.1	35%	0.352	44%	0.435	S	S	.	.	H	α-helix	trans	-69.3	-41.7	177.2	-166.8	-178.8	-164.4	-176.1	0	112.4	V19 G20 Q21 E25 R26 T27 F73	V19-K23 PolarHBondContact O-N 3.12Å; G20-K23 WeakPolarHBondContact O-CB 3.48Å; G20-K23 PolarHBondContact O-N 3.5Å; G20-K23 VanDerWaalsContact O-N 3.08Å; Q21-K23 VanDerWaalsContact C-N 3.27Å; Q21-K23 PolarHBondContact O-N 3.16Å; K23-E25 VanDerWaalsContact C-N 3.32Å; K23-R26 PolarHBondContact O-N 3.41Å; K23-T27 PolarHBondContact O-N 3.02Å; K23-T27 PolarHBondContact O-OG1 2.94Å; K23-F73 HydrophobicContact CD-CE1 3.98Å; K23-F73 HydrophobicContact CD-CZ 4.5Å
24	A	87.3	Confident	84.8	Confident	19 Å²	19	82.2 Å²	82.2	16%	0.157	43%	0.428	C	S	.	.	H	α-helix	trans	-58.9	-45.6	173.9	0	0	0	0	0	110.8	G20 Q21 R26 T27 Y28 V67 L74	G20-A24 PolarHBondContact O-N 3.1Å; Q21-A24 WeakPolarHBondContact O-CB 3.32Å; Q21-A24 PolarHBondContact O-N 3.29Å; A24-R26 PolarHBondContact O-N 3.39Å; A24-T27 PolarHBondContact O-N 3.25Å; A24-Y28 WeakPolarHBondContact O-CB 3.25Å; A24-Y28 PolarHBondContact O-N 3.07Å; A24-V67 HydrophobicContact CB-CG1 3.87Å; A24-L74 HydrophobicContact CB-CD1 4.27Å
25	E	89.9	Confident	86.2	Confident	100 Å²	100	76.4 Å²	76.4	47%	0.467	39%	0.394	S	S	.	.	H	α-helix	trans	-60.2	-46.3	177.2	-173.2	-172.6	88.2	0	0	112.1	Q21 A22 K23 T27 Y28 Q29	Q21-E25 WeakPolarHBondContact O-CB 3.46Å; Q21-E25 PolarHBondContact O-N 2.79Å; A22-E25 PolarHBondContact O-N 3.45Å; K23-E25 VanDerWaalsContact C-N 3.32Å; E25-T27 VanDerWaalsContact C-N 3.34Å; E25-T27 PolarHBondContact O-N 2.82Å; E25-Y28 WeakPolarHBondContact O-CB 3.07Å; E25-Y28 PolarHBondContact O-N 3.32Å; E25-Q29 WeakPolarHBondContact O-CB 3.41Å; E25-Q29 VanDerWaalsContact O-CG 3.29Å; E25-Q29 WeakPolarHBondContact O-CG 3.45Å; E25-Q29 PolarHBondContact O-N 2.88Å; E25-Q29 PolarHBondContact OE1-NE2 3.46Å
26	R	90.7	Very high	87.5	Confident	159 Å²	159	71.3 Å²	71.3	60%	0.6	38%	0.377	S	S	*	.	H	α-helix	trans	-62.1	-42	177.3	-69.2	-54.6	-170	-172.4	2.8	112.5	A22 K23 A24 Y28 Q29 V30	A22-R26 WeakPolarHBondContact O-CG 3.04Å; A22-R26 PolarHBondContact O-N 2.97Å; A22-R26 VanDerWaalsContact O-N 3.08Å; K23-R26 PolarHBondContact O-N 3.41Å; A24-R26 PolarHBondContact O-N 3.39Å; R26-Y28 VanDerWaalsContact C-N 3.35Å; R26-Q29 PolarHBondContact O-N 3.42Å; R26-V30 VanDerWaalsContact O-CG2 3.3Å; R26-V30 WeakPolarHBondContact O-CG2 3.33Å; R26-V30 PolarHBondContact O-N 2.9Å
27	T	90.6	Very high	88.8	Confident	65 Å²	65	70.9 Å²	70.9	40%	0.399	38%	0.378	S	S	.	.	H	α-helix	trans	-63.1	-46.1	178.1	-51.7	0	0	0	0	110.4	K23 A24 E25 Q29 V30 V31	K23-T27 PolarHBondContact O-N 3.02Å; K23-T27 PolarHBondContact O-OG1 2.94Å; A24-T27 PolarHBondContact O-N 3.25Å; E25-T27 VanDerWaalsContact C-N 3.34Å; E25-T27 PolarHBondContact O-N 2.82Å; T27-Q29 PolarHBondContact O-N 3.3Å; T27-V30 PolarHBondContact O-N 2.95Å; T27-V31 WeakPolarHBondContact O-CG2 3.34Å; T27-V31 PolarHBondContact O-N 2.88Å
28	Y	93.9	Very high	90	Very high	64 Å²	64	72.3 Å²	72.3	25%	0.251	39%	0.385	S	S	.	.	H	α-helix	trans	-58	-47	176	-177	-97.4	0	0	0	112.2	A24 E25 R26 V31 L32 F60 A63 V67	A24-Y28 WeakPolarHBondContact O-CB 3.25Å; A24-Y28 PolarHBondContact O-N 3.07Å; E25-Y28 WeakPolarHBondContact O-CB 3.07Å; E25-Y28 PolarHBondContact O-N 3.32Å; R26-Y28 VanDerWaalsContact C-N 3.35Å; Y28-V31 PolarHBondContact O-N 3.47Å; Y28-L32 HydrophobicContact CD1-CD1 3.88Å; Y28-L32 HydrophobicContact CE1-CD1 3.22Å; Y28-L32 HydrophobicContact CE1-CG 4.21Å; Y28-L32 HydrophobicContact CE2-CD1 4.27Å; Y28-L32 VanDerWaalsContact CZ-CD1 3.45Å; Y28-L32 WeakPolarHBondContact O-CB 3.24Å; Y28-L32 PolarHBondContact O-N 2.67Å; Y28-F60 WeakPolarHBondContact OH-CD2 2.98Å; Y28-F60 WeakPolarHBondContact OH-CE2 3.3Å; Y28-A63 HydrophobicContact CD2-CB 3.64Å; Y28-A63 HydrophobicContact CE2-CB 3.71Å; Y28-V67 HydrophobicContact CD2-CG2 4.41Å
29	Q	96	Very high	91.1	Very high	70 Å²	70	66.4 Å²	66.4	33%	0.327	36%	0.359	S	S	.	.	H	α-helix	trans	-59.2	-48	176.4	-74.8	169.9	3.5	0	0	111.8	E25 R26 T27 V31 L32 V33	E25-Q29 WeakPolarHBondContact O-CB 3.41Å; E25-Q29 VanDerWaalsContact O-CG 3.29Å; E25-Q29 WeakPolarHBondContact O-CG 3.45Å; E25-Q29 PolarHBondContact O-N 2.88Å; E25-Q29 PolarHBondContact OE1-NE2 3.46Å; R26-Q29 PolarHBondContact O-N 3.42Å; T27-Q29 PolarHBondContact O-N 3.3Å; Q29-V31 PolarHBondContact O-N 2.82Å; Q29-L32 PolarHBondContact O-N 3.35Å; Q29-V33 WeakPolarHBondContact O-CB 3.24Å; Q29-V33 VanDerWaalsContact O-CG2 3.24Å; Q29-V33 WeakPolarHBondContact O-CG2 3.45Å; Q29-V33 PolarHBondContact O-N 3.25Å
30	V	95.9	Very high	92.1	Very high	85 Å²	85	68.9 Å²	68.9	52%	0.515	36%	0.363	S	S	.	.	H	α-helix	trans	-62	-45.8	-179.3	170.3	0	0	0	0	111.4	R26 T27 L32 V33 I34	R26-V30 VanDerWaalsContact O-CG2 3.3Å; R26-V30 WeakPolarHBondContact O-CG2 3.33Å; R26-V30 PolarHBondContact O-N 2.9Å; T27-V30 PolarHBondContact O-N 2.95Å; V30-L32 PolarHBondContact O-N 3.46Å; V30-V33 PolarHBondContact O-N 2.96Å; V30-I34 HydrophobicContact CG1-CD1 3.81Å; V30-I34 WeakPolarHBondContact O-CG1 3.31Å; V30-I34 PolarHBondContact O-N 3.34Å
31	V	94.5	Very high	93	Very high	39 Å²	39	72.5 Å²	72.5	24%	0.236	38%	0.384	C	S	.	.	H	α-helix	trans	-61.4	-45.9	178.8	173.6	0	0	0	0	110.9	T27 Y28 Q29 I34 A35 A63	T27-V31 WeakPolarHBondContact O-CG2 3.34Å; T27-V31 PolarHBondContact O-N 2.88Å; Y28-V31 PolarHBondContact O-N 3.47Å; Q29-V31 PolarHBondContact O-N 2.82Å; V31-I34 PolarHBondContact O-N 3.49Å; V31-A35 WeakPolarHBondContact O-CB 3.25Å; V31-A35 PolarHBondContact O-N 3.38Å; V31-A63 HydrophobicContact CB-CB 4.34Å; V31-A63 HydrophobicContact CG1-CB 3.89Å
32	L	96.2	Very high	93.6	Very high	44 Å²	44	70.2 Å²	70.2	23%	0.23	38%	0.377	C	S	.	.	H	α-helix	trans	-64.8	-39.7	177.9	-80.7	-176.8	0	0	0	113	Y28 Q29 V30 A35 G36 F60	Y28-L32 HydrophobicContact CD1-CD1 3.88Å; Y28-L32 HydrophobicContact CE1-CD1 3.22Å; Y28-L32 HydrophobicContact CE1-CG 4.21Å; Y28-L32 HydrophobicContact CE2-CD1 4.27Å; Y28-L32 VanDerWaalsContact CZ-CD1 3.45Å; Y28-L32 WeakPolarHBondContact O-CB 3.24Å; Y28-L32 PolarHBondContact O-N 2.67Å; Q29-L32 PolarHBondContact O-N 3.35Å; V30-L32 PolarHBondContact O-N 3.46Å; L32-A35 PolarHBondContact O-N 3.45Å; L32-G36 PolarHBondContact O-N 3.49Å; L32-F60 HydrophobicContact CD2-CB 4.06Å
33	V	97.3	Very high	94.2	Very high	93 Å²	93	67.8 Å²	67.8	56%	0.564	36%	0.358	S	S	*	.	H	α-helix	trans	-63.7	-45.1	177.7	168.3	0	0	0	0	110.5	Q29 V30 G36 V37	Q29-V33 WeakPolarHBondContact O-CB 3.24Å; Q29-V33 VanDerWaalsContact O-CG2 3.24Å; Q29-V33 WeakPolarHBondContact O-CG2 3.45Å; Q29-V33 PolarHBondContact O-N 3.25Å; V30-V33 PolarHBondContact O-N 2.96Å; V33-G36 PolarHBondContact O-N 3.02Å; V33-V37 HydrophobicContact CG1-CG2 4.43Å; V33-V37 WeakPolarHBondContact O-CG2 3.41Å; V33-V37 PolarHBondContact O-N 3.46Å
34	I	96.9	Very high	94.6	Very high	95 Å²	95	72.5 Å²	72.5	49%	0.487	38%	0.375	S	S	.	.	H	α-helix	trans	-61.9	-46.7	177.1	-67.2	167.4	0	0	0	110.4	V30 V31 G36 V37 I38	V30-I34 HydrophobicContact CG1-CD1 3.81Å; V30-I34 WeakPolarHBondContact O-CG1 3.31Å; V30-I34 PolarHBondContact O-N 3.34Å; V31-I34 PolarHBondContact O-N 3.49Å; I34-G36 VanDerWaalsContact C-N 3.29Å; I34-G36 PolarHBondContact O-N 3.03Å; I34-V37 PolarHBondContact O-N 3.26Å; I34-I38 HydrophobicContact CG2-CD1 3.73Å; I34-I38 HydrophobicContact CG2-CG1 4.46Å; I34-I38 VanDerWaalsContact O-CG1 3.3Å; I34-I38 WeakPolarHBondContact O-CG1 3.38Å; I34-I38 PolarHBondContact O-N 3.29Å
35	A	95.8	Very high	95	Very high	17 Å²	17	75.9 Å²	75.9	14%	0.14	40%	0.397	C	S	.	.	H	α-helix	trans	-60.9	-38.6	176.9	0	0	0	0	0	112.2	V31 L32 G39	V31-A35 WeakPolarHBondContact O-CB 3.25Å; V31-A35 PolarHBondContact O-N 3.38Å; L32-A35 PolarHBondContact O-N 3.45Å; A35-G39 PolarHBondContact O-N 3.32Å
36	G	96.7	Very high	95.2	Very high	25 Å²	25	76.8 Å²	76.8	26%	0.258	40%	0.403	S	S	.	.	H	α-helix	trans	-67.2	-43.4	176.5	0	0	0	0	0	112.9	L32 V33 I34 G39 F40	L32-G36 PolarHBondContact O-N 3.49Å; V33-G36 PolarHBondContact O-N 3.02Å; I34-G36 VanDerWaalsContact C-N 3.29Å; I34-G36 PolarHBondContact O-N 3.03Å; G36-G39 PolarHBondContact O-N 3Å; G36-F40 VanDerWaalsContact O-CB 3.25Å; G36-F40 WeakPolarHBondContact O-CB 3.3Å; G36-F40 PolarHBondContact O-N 2.97Å
37	V	97.2	Very high	95.3	Very high	87 Å²	87	78.1 Å²	78.1	53%	0.527	42%	0.416	S	S	.	.	H	α-helix	trans	-64.2	-46.6	176.7	171.7	0	0	0	0	110.8	V33 I34 F40 V41	V33-V37 HydrophobicContact CG1-CG2 4.43Å; V33-V37 WeakPolarHBondContact O-CG2 3.41Å; V33-V37 PolarHBondContact O-N 3.46Å; I34-V37 PolarHBondContact O-N 3.26Å; V37-F40 PolarHBondContact O-N 2.83Å; V37-V41 WeakPolarHBondContact O-CG2 3.46Å; V37-V41 PolarHBondContact O-N 3.49Å
38	I	95.9	Very high	95.3	Very high	97 Å²	97	80.7 Å²	80.7	50%	0.497	42%	0.423	S	S	.	.	H	α-helix	trans	-61.4	-47.9	176.4	-66	168.8	0	0	0	109.9	I34 F40 V41 V42	I34-I38 HydrophobicContact CG2-CD1 3.73Å; I34-I38 HydrophobicContact CG2-CG1 4.46Å; I34-I38 VanDerWaalsContact O-CG1 3.3Å; I34-I38 WeakPolarHBondContact O-CG1 3.38Å; I34-I38 PolarHBondContact O-N 3.29Å; I38-F40 VanDerWaalsContact C-N 3.3Å; I38-F40 PolarHBondContact O-N 2.97Å; I38-V41 PolarHBondContact O-N 3.48Å; I38-V42 HydrophobicContact CG2-CG2 4.34Å; I38-V42 WeakPolarHBondContact O-CG2 3.49Å; I38-V42 PolarHBondContact O-N 2.87Å
39	G	96	Very high	95.2	Very high	0 Å²	0	85.1 Å²	85.1	0%	0	44%	0.444	C	S	.	.	H	α-helix	trans	-57.7	-42.3	177.5	0	0	0	0	0	112.7	A35 G36 G43 T52 T55	A35-G39 PolarHBondContact O-N 3.32Å; G36-G39 PolarHBondContact O-N 3Å; G39-G43 PolarHBondContact O-N 2.94Å; G39-T52 WeakPolarHBondContact O-CG2 3.45Å; G39-T55 WeakPolarHBondContact CA-OG1 3.45Å
40	F	95.3	Very high	95.2	Very high	140 Å²	140	85 Å²	85	61%	0.614	45%	0.45	S	S	*	.	H	α-helix	trans	-63.7	-48.2	177.3	-177.5	-100.6	0	0	0	112.2	G36 V37 I38 V42 G43 Y44	G36-F40 VanDerWaalsContact O-CB 3.25Å; G36-F40 WeakPolarHBondContact O-CB 3.3Å; G36-F40 PolarHBondContact O-N 2.97Å; V37-F40 PolarHBondContact O-N 2.83Å; I38-F40 VanDerWaalsContact C-N 3.3Å; I38-F40 PolarHBondContact O-N 2.97Å; F40-V42 PolarHBondContact O-N 2.9Å; F40-G43 PolarHBondContact O-N 2.91Å; F40-Y44 WeakPolarHBondContact O-CB 3.33Å; F40-Y44 PolarHBondContact O-N 3.32Å
41	V	96.4	Very high	95.1	Very high	82 Å²	82	82.9 Å²	82.9	50%	0.497	44%	0.436	S	S	.	.	H	α-helix	trans	-62.5	-45.3	179.4	173.2	0	0	0	0	111.4	V37 I38 S45	V37-V41 WeakPolarHBondContact O-CG2 3.46Å; V37-V41 PolarHBondContact O-N 3.49Å; I38-V41 PolarHBondContact O-N 3.48Å; V41-S45 WeakPolarHBondContact O-CB 3.32Å; V41-S45 PolarHBondContact O-N 3.15Å; V41-S45 PolarHBondContact O-OG 3.32Å
42	V	94.4	Very high	95.1	Very high	58 Å²	58	82 Å²	82	35%	0.352	43%	0.431	S	S	.	.	H	α-helix	trans	-68	-45.7	179.7	176.1	0	0	0	0	111	I38 F40 Y44 S45 M46 I51	I38-V42 HydrophobicContact CG2-CG2 4.34Å; I38-V42 WeakPolarHBondContact O-CG2 3.49Å; I38-V42 PolarHBondContact O-N 2.87Å; F40-V42 PolarHBondContact O-N 2.9Å; V42-Y44 PolarHBondContact O-N 3.28Å; V42-S45 PolarHBondContact O-N 3.42Å; V42-M46 WeakPolarHBondContact O-CG 3.33Å; V42-M46 PolarHBondContact O-N 3.43Å; V42-I51 HydrophobicContact CG1-CG2 3.92Å
43	G	96	Very high	95.1	Very high	4 Å²	4	84 Å²	84	4%	0.041	44%	0.441	C	S	.	.	H	α-helix	trans	-67.3	-34.8	179.5	0	0	0	0	0	113.3	G39 F40 M46 Q47 Q48	G39-G43 PolarHBondContact O-N 2.94Å; F40-G43 PolarHBondContact O-N 2.91Å; G43-M46 PolarHBondContact O-N 3.44Å; G43-Q47 PolarHBondContact O-N 3.29Å; G43-Q48 PolarHBondContact O-N 3.38Å
44	Y	94.8	Very high	95.1	Very high	180 Å²	180	87.3 Å²	87.3	71%	0.706	44%	0.444	S	S	*	.	H	α-helix	trans	-64.4	-45.7	172.4	-178.1	-101.3	0	0	0	111.3	F40 V42 M46 Q47	F40-Y44 WeakPolarHBondContact O-CB 3.33Å; F40-Y44 PolarHBondContact O-N 3.32Å; V42-Y44 PolarHBondContact O-N 3.28Å; Y44-M46 VanDerWaalsContact C-N 3.26Å; Y44-M46 PolarHBondContact O-N 2.85Å; Y44-Q47 PolarHBondContact O-N 3.03Å; Y44-Q47 VanDerWaalsContact O-N 3.08Å
45	S	95.1	Very high	95	Very high	90 Å²	90	84.8 Å²	84.8	63%	0.629	43%	0.433	S	S	*	.	H	α-helix	trans	-62.5	-34.1	179.1	-56.5	0	0	0	0	112.7	V41 V42	V41-S45 WeakPolarHBondContact O-CB 3.32Å; V41-S45 PolarHBondContact O-N 3.15Å; V41-S45 PolarHBondContact O-OG 3.32Å; V42-S45 PolarHBondContact O-N 3.42Å
46	M	93	Very high	94.9	Very high	118 Å²	118	86.7 Å²	86.7	58%	0.581	44%	0.443	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88.4	-4.8	178.1	-66.2	-70	-179.4	0	0	113.3	V42 G43 Y44 Q48 I51	V42-M46 WeakPolarHBondContact O-CG 3.33Å; V42-M46 PolarHBondContact O-N 3.43Å; G43-M46 PolarHBondContact O-N 3.44Å; Y44-M46 VanDerWaalsContact C-N 3.26Å; Y44-M46 PolarHBondContact O-N 2.85Å; M46-Q48 WeakPolarHBondContact O-CG 3.49Å; M46-Q48 PolarHBondContact O-N 3.38Å; M46-I51 HydrophobicContact CB-CD1 3.48Å; M46-I51 VanDerWaalsContact CB-CD1 3.48Å; M46-I51 HydrophobicContact CG-CD1 3.71Å
47	Q	93.4	Very high	94.9	Very high	188 Å²	188	89.9 Å²	89.9	88%	0.879	45%	0.454	S	S	*	.	T	Hydrogen-bonded Turn	trans	53.9	25.4	-177.6	-148.8	167.2	-4.1	0	0	113.8	G43 Y44	G43-Q47 PolarHBondContact O-N 3.29Å; Y44-Q47 PolarHBondContact O-N 3.03Å; Y44-Q47 VanDerWaalsContact O-N 3.08Å
48	Q	90.5	Very high	94.9	Very high	118 Å²	118	88.1 Å²	88.1	55%	0.551	45%	0.448	S	S	*	.			trans	-126.7	120.1	-177.1	-73.5	-175.7	8.2	0	0	110.9	G43 M46 S50 I51	G43-Q48 PolarHBondContact O-N 3.38Å; M46-Q48 WeakPolarHBondContact O-CG 3.49Å; M46-Q48 PolarHBondContact O-N 3.38Å; Q48-S50 VanDerWaalsContact C-N 3.33Å; Q48-S50 PolarHBondContact O-N 3.48Å; Q48-I51 HydrophobicContact CB-CD1 4.05Å; Q48-I51 HydrophobicContact CB-CG1 4.33Å
49	F	92.4	Very high	94.9	Very high	158 Å²	158	83.8 Å²	83.8	69%	0.693	43%	0.428	S	S	*	.	H	α-helix	trans	-69.8	-29.2	-179.5	-171.1	-111.8	0	0	0	113	I51 T52 I53	F49-I51 PolarHBondContact O-N 3.32Å; F49-I51 VanDerWaalsContact O-N 3.16Å; F49-T52 HydrophobicContact CD2-CG2 4.46Å; F49-T52 PolarHBondContact O-N 3.17Å; F49-T52 VanDerWaalsContact O-N 3.12Å; F49-T52 PolarHBondContact O-OG1 2.84Å; F49-I53 HydrophobicContact CD1-CD1 3.79Å; F49-I53 HydrophobicContact CD1-CG1 4.17Å; F49-I53 HydrophobicContact CE1-CD1 3.68Å; F49-I53 HydrophobicContact CE1-CG1 3.89Å; F49-I53 HydrophobicContact CZ-CG1 4.43Å; F49-I53 PolarHBondContact O-N 3.39Å
50	S	95.3	Very high	95	Very high	66 Å²	66	87.8 Å²	87.8	46%	0.462	45%	0.445	S	S	.	.	H	α-helix	trans	-57.1	-34.2	-179.6	-47.8	0	0	0	0	113.1	Q48 T52 I53 Y54	Q48-S50 VanDerWaalsContact C-N 3.33Å; Q48-S50 PolarHBondContact O-N 3.48Å; S50-T52 PolarHBondContact O-N 3.38Å; S50-I53 PolarHBondContact O-N 3.08Å; S50-Y54 WeakPolarHBondContact O-CD2 3.35Å; S50-Y54 PolarHBondContact O-N 2.87Å; S50-Y54 VanDerWaalsContact O-N 3.1Å
51	I	94.4	Very high	95	Very high	42 Å²	42	85.9 Å²	85.9	22%	0.215	44%	0.441	C	S	.	.	H	α-helix	trans	-66.5	-40.1	-179.1	-61.6	171.1	0	0	0	110.8	V42 M46 Q48 F49 I53 Y54 T55	V42-I51 HydrophobicContact CG1-CG2 3.92Å; M46-I51 HydrophobicContact CB-CD1 3.48Å; M46-I51 VanDerWaalsContact CB-CD1 3.48Å; M46-I51 HydrophobicContact CG-CD1 3.71Å; Q48-I51 HydrophobicContact CB-CD1 4.05Å; Q48-I51 HydrophobicContact CB-CG1 4.33Å; F49-I51 PolarHBondContact O-N 3.32Å; F49-I51 VanDerWaalsContact O-N 3.16Å; I51-I53 VanDerWaalsContact C-N 3.26Å; I51-I53 PolarHBondContact O-N 2.9Å; I51-Y54 PolarHBondContact O-N 3.34Å; I51-T55 HydrophobicContact CG2-CG2 4.32Å; I51-T55 WeakPolarHBondContact O-CG2 3.32Å; I51-T55 PolarHBondContact O-N 3.2Å; I51-T55 PolarHBondContact O-OG1 3.33Å; I51-T55 VanDerWaalsContact O-OG1 3.07Å
52	T	95	Very high	94.9	Very high	20 Å²	20	87.2 Å²	87.2	12%	0.123	45%	0.445	C	S	.	.	H	α-helix	trans	-61.6	-38.1	177.9	74	0	0	0	0	111.1	G39 F49 S50 T55 T56	G39-T52 WeakPolarHBondContact O-CG2 3.45Å; F49-T52 HydrophobicContact CD2-CG2 4.46Å; F49-T52 PolarHBondContact O-N 3.17Å; F49-T52 VanDerWaalsContact O-N 3.12Å; F49-T52 PolarHBondContact O-OG1 2.84Å; S50-T52 PolarHBondContact O-N 3.38Å; T52-T55 WeakPolarHBondContact CA-OG1 3.39Å; T52-T55 PolarHBondContact O-OG1 3.48Å; T52-T56 VanDerWaalsContact O-CB 3.24Å; T52-T56 WeakPolarHBondContact O-CB 3.29Å; T52-T56 PolarHBondContact O-N 2.9Å; T52-T56 PolarHBondContact O-OG1 3.13Å
53	I	96.4	Very high	94.9	Very high	85 Å²	85	84.5 Å²	84.5	44%	0.436	43%	0.428	S	S	.	.	H	α-helix	trans	-65.2	-49.7	177.6	-60.3	173.7	0	0	0	109.7	F49 S50 I51 T55 T56 L57	F49-I53 HydrophobicContact CD1-CD1 3.79Å; F49-I53 HydrophobicContact CD1-CG1 4.17Å; F49-I53 HydrophobicContact CE1-CD1 3.68Å; F49-I53 HydrophobicContact CE1-CG1 3.89Å; F49-I53 HydrophobicContact CZ-CG1 4.43Å; F49-I53 PolarHBondContact O-N 3.39Å; S50-I53 PolarHBondContact O-N 3.08Å; I51-I53 VanDerWaalsContact C-N 3.26Å; I51-I53 PolarHBondContact O-N 2.9Å; I53-T55 PolarHBondContact O-N 2.88Å; I53-T56 PolarHBondContact O-N 2.91Å; I53-L57 VanDerWaalsContact O-CB 3.25Å; I53-L57 WeakPolarHBondContact O-CB 3.47Å; I53-L57 PolarHBondContact O-N 3.33Å
54	Y	96.1	Very high	94.7	Very high	164 Å²	164	85.6 Å²	85.6	64%	0.643	44%	0.435	S	S	*	.	H	α-helix	trans	-63.2	-41.7	-179.3	-67.5	-53.4	0	0	0	112.5	S50 I51 L57 A58	S50-Y54 WeakPolarHBondContact O-CD2 3.35Å; S50-Y54 PolarHBondContact O-N 2.87Å; S50-Y54 VanDerWaalsContact O-N 3.1Å; I51-Y54 PolarHBondContact O-N 3.34Å; Y54-L57 PolarHBondContact O-N 2.92Å; Y54-A58 VanDerWaalsContact O-CB 3.31Å; Y54-A58 WeakPolarHBondContact O-CB 3.37Å; Y54-A58 PolarHBondContact O-N 3.34Å
55	T	94.3	Very high	94.5	Very high	42 Å²	42	83.4 Å²	83.4	26%	0.258	43%	0.433	S	S	.	.	H	α-helix	trans	-66.9	-40	176.7	53.5	0	0	0	0	111.9	G39 I51 T52 I53 A58 G59	G39-T55 WeakPolarHBondContact CA-OG1 3.45Å; I51-T55 HydrophobicContact CG2-CG2 4.32Å; I51-T55 WeakPolarHBondContact O-CG2 3.32Å; I51-T55 PolarHBondContact O-N 3.2Å; I51-T55 PolarHBondContact O-OG1 3.33Å; I51-T55 VanDerWaalsContact O-OG1 3.07Å; T52-T55 WeakPolarHBondContact CA-OG1 3.39Å; T52-T55 PolarHBondContact O-OG1 3.48Å; I53-T55 PolarHBondContact O-N 2.88Å; T55-A58 PolarHBondContact O-N 3.28Å; T55-G59 PolarHBondContact O-N 3.08Å
56	T	95.3	Very high	94.1	Very high	57 Å²	57	83.6 Å²	83.6	35%	0.35	43%	0.426	S	S	.	.	H	α-helix	trans	-67.8	-41	178	-56.5	0	0	0	0	110.8	T52 I53 G59 F60	T52-T56 VanDerWaalsContact O-CB 3.24Å; T52-T56 WeakPolarHBondContact O-CB 3.29Å; T52-T56 PolarHBondContact O-N 2.9Å; T52-T56 PolarHBondContact O-OG1 3.13Å; I53-T56 PolarHBondContact O-N 2.91Å; T56-G59 PolarHBondContact O-N 3.07Å; T56-F60 WeakPolarHBondContact O-CB 3.07Å; T56-F60 PolarHBondContact O-N 3.48Å
57	L	96.8	Very high	93.8	Very high	92 Å²	92	79.9 Å²	79.9	48%	0.482	41%	0.41	S	S	.	.	H	α-helix	trans	-65.4	-42.6	176.4	-176.7	63	0	0	0	111.5	I53 Y54 G59 F60 L61	I53-L57 VanDerWaalsContact O-CB 3.25Å; I53-L57 WeakPolarHBondContact O-CB 3.47Å; I53-L57 PolarHBondContact O-N 3.33Å; Y54-L57 PolarHBondContact O-N 2.92Å; L57-G59 VanDerWaalsContact C-N 3.33Å; L57-G59 PolarHBondContact O-N 2.91Å; L57-F60 HydrophobicContact CD1-CD1 4.48Å; L57-F60 WeakPolarHBondContact O-CB 3Å; L57-F60 PolarHBondContact O-N 3.48Å; L57-L61 WeakPolarHBondContact O-CG 3.44Å; L57-L61 PolarHBondContact O-N 3.25Å
58	A	96.8	Very high	93.3	Very high	49 Å²	49	77.5 Å²	77.5	41%	0.405	40%	0.403	S	S	.	.	H	α-helix	trans	-60.5	-44.5	173.2	0	0	0	0	0	111.1	Y54 T55 F60 L61 L62	Y54-A58 VanDerWaalsContact O-CB 3.31Å; Y54-A58 WeakPolarHBondContact O-CB 3.37Å; Y54-A58 PolarHBondContact O-N 3.34Å; T55-A58 PolarHBondContact O-N 3.28Å; A58-F60 VanDerWaalsContact C-N 3.34Å; A58-F60 PolarHBondContact O-N 3.29Å; A58-L61 PolarHBondContact O-N 3.04Å; A58-L62 VanDerWaalsContact O-CG 3.32Å; A58-L62 WeakPolarHBondContact O-CG 2.92Å; A58-L62 PolarHBondContact O-N 3.27Å
59	G	96.3	Very high	92.8	Very high	6 Å²	6	73.8 Å²	73.8	6%	0.062	39%	0.389	C	S	.	.	H	α-helix	trans	-60.6	-40.2	174.4	0	0	0	0	0	113.3	T55 T56 L57 L62 A63	T55-G59 PolarHBondContact O-N 3.08Å; T56-G59 PolarHBondContact O-N 3.07Å; L57-G59 VanDerWaalsContact C-N 3.33Å; L57-G59 PolarHBondContact O-N 2.91Å; G59-L62 PolarHBondContact O-N 2.86Å; G59-A63 WeakPolarHBondContact O-CB 3.35Å; G59-A63 PolarHBondContact O-N 2.92Å
60	F	96.5	Very high	91.6	Very high	84 Å²	84	71.4 Å²	71.4	37%	0.368	39%	0.389	S	S	.	.	H	α-helix	trans	-61.9	-48.2	174.6	171.9	-94.1	0	0	0	111.8	Y28 L32 T56 L57 A58 L62 A63 C64	Y28-F60 WeakPolarHBondContact OH-CD2 2.98Å; Y28-F60 WeakPolarHBondContact OH-CE2 3.3Å; L32-F60 HydrophobicContact CD2-CB 4.06Å; T56-F60 WeakPolarHBondContact O-CB 3.07Å; T56-F60 PolarHBondContact O-N 3.48Å; L57-F60 HydrophobicContact CD1-CD1 4.48Å; L57-F60 WeakPolarHBondContact O-CB 3Å; L57-F60 PolarHBondContact O-N 3.48Å; A58-F60 VanDerWaalsContact C-N 3.34Å; A58-F60 PolarHBondContact O-N 3.29Å; F60-L62 VanDerWaalsContact C-N 3.32Å; F60-L62 PolarHBondContact O-N 2.93Å; F60-A63 WeakPolarHBondContact O-CB 3.37Å; F60-A63 PolarHBondContact O-N 3.36Å; F60-A63 VanDerWaalsContact O-N 3.15Å; F60-C64 PolarHBondContact O-N 3.49Å; F60-C64 PolarHBondContact O-SG 2.81Å
61	L	96.7	Very high	90.4	Very high	101 Å²	101	74.5 Å²	74.5	53%	0.529	39%	0.391	S	S	.	.	H	α-helix	trans	-61.9	-41.2	178.2	-68.1	175.1	0	0	0	111.8	L57 A58 C64 M65	L57-L61 WeakPolarHBondContact O-CG 3.44Å; L57-L61 PolarHBondContact O-N 3.25Å; A58-L61 PolarHBondContact O-N 3.04Å; L61-C64 PolarHBondContact O-N 2.92Å; L61-M65 WeakPolarHBondContact O-CG 3.36Å; L61-M65 PolarHBondContact O-N 2.97Å
62	L	94.2	Very high	88.8	Confident	110 Å²	110	76.7 Å²	76.7	58%	0.576	41%	0.408	S	S	*	.	H	α-helix	trans	-62.6	-43.2	173.6	-71	172.5	0	0	0	111.7	A58 G59 F60 M65 L66	A58-L62 VanDerWaalsContact O-CG 3.32Å; A58-L62 WeakPolarHBondContact O-CG 2.92Å; A58-L62 PolarHBondContact O-N 3.27Å; G59-L62 PolarHBondContact O-N 2.86Å; F60-L62 VanDerWaalsContact C-N 3.32Å; F60-L62 PolarHBondContact O-N 2.93Å; L62-M65 PolarHBondContact O-N 2.7Å; L62-L66 WeakPolarHBondContact O-CB 3.49Å; L62-L66 WeakPolarHBondContact O-CG 3.46Å; L62-L66 PolarHBondContact O-N 2.86Å
63	A	94	Very high	87.2	Confident	1 Å²	1	81 Å²	81	1%	0.008	43%	0.425	C	S	.	.	H	α-helix	trans	-63.4	-41.5	176.8	0	0	0	0	0	111.7	Y28 V31 G59 F60 L66 V67	Y28-A63 HydrophobicContact CD2-CB 3.64Å; Y28-A63 HydrophobicContact CE2-CB 3.71Å; V31-A63 HydrophobicContact CB-CB 4.34Å; V31-A63 HydrophobicContact CG1-CB 3.89Å; G59-A63 WeakPolarHBondContact O-CB 3.35Å; G59-A63 PolarHBondContact O-N 2.92Å; F60-A63 WeakPolarHBondContact O-CB 3.37Å; F60-A63 PolarHBondContact O-N 3.36Å; F60-A63 VanDerWaalsContact O-N 3.15Å; A63-L66 PolarHBondContact O-N 3.47Å; A63-V67 WeakPolarHBondContact O-CB 3.5Å; A63-V67 WeakPolarHBondContact O-CG2 3.09Å; A63-V67 PolarHBondContact O-N 3.37Å
64	C	91.4	Very high	85.2	Confident	26 Å²	26	80 Å²	80	18%	0.176	42%	0.42	C	S	.	.	H	α-helix	trans	-60.3	-46.8	173.1	-68.8	0	0	0	0	111.4	F60 L61 L66 V67 L68	F60-C64 PolarHBondContact O-N 3.49Å; F60-C64 PolarHBondContact O-SG 2.81Å; L61-C64 PolarHBondContact O-N 2.92Å; C64-L66 VanDerWaalsContact C-N 3.25Å; C64-L66 PolarHBondContact O-N 3.08Å; C64-V67 PolarHBondContact O-N 3.28Å; C64-L68 HydrophobicContact CB-CD1 3.95Å; C64-L68 HydrophobicContact CB-CG 4.5Å; C64-L68 WeakPolarHBondContact O-CB 3.28Å; C64-L68 VanDerWaalsContact O-CG 3.28Å; C64-L68 WeakPolarHBondContact O-CG 3.17Å; C64-L68 PolarHBondContact O-N 2.88Å
65	M	89.7	Confident	83.3	Confident	135 Å²	135	82 Å²	82	67%	0.665	43%	0.427	S	S	*	.	H	α-helix	trans	-62.3	-30.4	175.4	-74	-104.4	91.5	0	0	112.8	L61 L62 P69	L61-M65 WeakPolarHBondContact O-CG 3.36Å; L61-M65 PolarHBondContact O-N 2.97Å; L62-M65 PolarHBondContact O-N 2.7Å; M65-P69 WeakPolarHBondContact O-CD 3.48Å; M65-P69 WeakPolarHBondContact O-CG 3.42Å
66	L	87	Confident	81.5	Confident	94 Å²	94	87.8 Å²	87.8	49%	0.492	44%	0.444	S	S	.	.	H	α-helix	trans	-84.8	-23.1	178.7	-74.6	171.5	0	0	0	113.9	L62 A63 C64 W71	L62-L66 WeakPolarHBondContact O-CB 3.49Å; L62-L66 WeakPolarHBondContact O-CG 3.46Å; L62-L66 PolarHBondContact O-N 2.86Å; A63-L66 PolarHBondContact O-N 3.47Å; C64-L66 VanDerWaalsContact C-N 3.25Å; C64-L66 PolarHBondContact O-N 3.08Å; L66-W71 PolarHBondContact O-NE1 3.38Å
67	V	86.6	Confident	79.5	Confident	40 Å²	40	91.5 Å²	91.5	24%	0.242	46%	0.457	C	S	.	.	H	α-helix	trans	-107.7	-32.9	-173.5	175.9	0	0	0	0	112.7	A24 Y28 A63 C64	A24-V67 HydrophobicContact CB-CG1 3.87Å; Y28-V67 HydrophobicContact CD2-CG2 4.41Å; A63-V67 WeakPolarHBondContact O-CB 3.5Å; A63-V67 WeakPolarHBondContact O-CG2 3.09Å; A63-V67 PolarHBondContact O-N 3.37Å; C64-V67 PolarHBondContact O-N 3.28Å
68	L	83.9	Confident	77.2	Confident	137 Å²	137	92.7 Å²	92.7	72%	0.717	47%	0.47	S	S	*	.	S	Bend	trans	-74.1	-41.7	-177	-68.5	174.4	0	0	0	114.7	C64	C64-L68 HydrophobicContact CB-CD1 3.95Å; C64-L68 HydrophobicContact CB-CG 4.5Å; C64-L68 WeakPolarHBondContact O-CB 3.28Å; C64-L68 VanDerWaalsContact O-CG 3.28Å; C64-L68 WeakPolarHBondContact O-CG 3.17Å; C64-L68 PolarHBondContact O-N 2.88Å
69	P	78.9	Confident	75.2	Confident	41 Å²	41	93.9 Å²	93.9	27%	0.266	47%	0.472	S	S	.	.	S	Bend	trans	-59.8	139.4	173.6	-16	27.8	0	0	0	108.2	M65 W71	M65-P69 WeakPolarHBondContact O-CD 3.48Å; M65-P69 WeakPolarHBondContact O-CG 3.42Å; P69-W71 HydrophobicContact CB-CD2 4.3Å; P69-W71 HydrophobicContact CB-CG 4.47Å; P69-W71 HydrophobicContact CB-CZ2 4.14Å; P69-W71 HydrophobicContact CG-CZ2 3.92Å; P69-W71 PolarHBondContact O-N 3.09Å
70	P	68.3	Low	72.9	Confident	108 Å²	108	96.9 Å²	96.9	70%	0.701	50%	0.496	S	S	*	.			trans	-71.6	71	177	30.4	-35.3	0	0	0	109.9
71	W	70.5	Confident	70.6	Confident	130 Å²	130	97.9 Å²	97.9	49%	0.492	51%	0.513	S	S	.	.			trans	-61.1	134.1	179	-63.7	104	0	0	0	109.1	L66 P69 F73 L74	L66-W71 PolarHBondContact O-NE1 3.38Å; P69-W71 HydrophobicContact CB-CD2 4.3Å; P69-W71 HydrophobicContact CB-CG 4.47Å; P69-W71 HydrophobicContact CB-CZ2 4.14Å; P69-W71 HydrophobicContact CG-CZ2 3.92Å; P69-W71 PolarHBondContact O-N 3.09Å; W71-F73 PolarHBondContact O-N 3.12Å; W71-L74 WeakPolarHBondContact O-CB 3.41Å; W71-L74 PolarHBondContact O-N 3.2Å
72	P	59.4	Low	68.2	Low	89 Å²	89	96.7 Å²	96.7	58%	0.578	51%	0.51	S	S	*	.	G	3₁₀ helix	trans	-59.3	-21.9	-174.5	23.7	-34.4	0	0	0	112.9	L74 R75	P72-L74 PolarHBondContact O-N 3.44Å; P72-R75 PolarHBondContact O-N 2.9Å; P72-R75 VanDerWaalsContact O-N 3.12Å
73	F	61.6	Low	66.5	Low	110 Å²	110	97.8 Å²	97.8	48%	0.482	52%	0.515	S	S	.	.	G	3₁₀ helix	trans	-57	-28.2	173.5	-176.8	-115.5	0	0	0	113.7	K23 W71	K23-F73 HydrophobicContact CD-CE1 3.98Å; K23-F73 HydrophobicContact CD-CZ 4.5Å; W71-F73 PolarHBondContact O-N 3.12Å
74	L	54.4	Low	64.6	Low	64 Å²	64	100.2 Å²	100.2	34%	0.335	53%	0.533	S	S	.	.	G	3₁₀ helix	trans	-76.7	-24.6	179.5	-158.9	63	0	0	0	112.8	G20 A24 W71 P72	G20-L74 WeakPolarHBondContact O-CD1 3.44Å; A24-L74 HydrophobicContact CB-CD1 4.27Å; W71-L74 WeakPolarHBondContact O-CB 3.41Å; W71-L74 PolarHBondContact O-N 3.2Å; P72-L74 PolarHBondContact O-N 3.44Å
75	R	57.7	Low	63.1	Low	205 Å²	205	104.5 Å²	104.5	77%	0.774	55%	0.55	S	S	*	*	G	3₁₀ helix	trans	-103.2	12.8	-174.2	-60.2	-144.6	-70	178	-3.6	114.7	P72 H77	P72-R75 PolarHBondContact O-N 2.9Å; P72-R75 VanDerWaalsContact O-N 3.12Å; R75-H77 VanDerWaalsContact C-N 3.31Å; R75-H77 PolarHBondContact O-N 3.4Å
76	R	54.9	Low	61.6	Low	165 Å²	165	102.1 Å²	102.1	62%	0.623	54%	0.538	S	S	*	.	S	Bend	trans	-74.7	-16.2	-174.3	-80.6	-168.8	178.3	138	2.5	115.3	P78	R76-P78 WeakPolarHBondContact O-CD 3.18Å
77	H	54.1	Low	60.5	Low	135 Å²	135	104.1 Å²	104.1	63%	0.625	55%	0.545	S	S	*	.			trans	-120.6	91	175.1	-59.8	-67.6	0	0	0	108.1	R75 V79	R75-H77 VanDerWaalsContact C-N 3.31Å; R75-H77 PolarHBondContact O-N 3.4Å; H77-V79 HydrophobicContact CB-CG1 4.19Å; H77-V79 PolarHBondContact O-N 2.75Å
78	P	49.4	Very low	59.5	Low	117 Å²	117	106.5 Å²	106.5	76%	0.76	56%	0.56	S	S	*	*			trans	-60.6	87.3	153.6	28.8	-32.2	0	0	0	105.4	R76 A80	R76-P78 WeakPolarHBondContact O-CD 3.18Å; P78-A80 PolarHBondContact O-N 3.19Å
79	V	53.4	Low	58.6	Low	73 Å²	73	104.6 Å²	104.6	44%	0.442	55%	0.554	S	S	.	*			trans	-65.2	104.1	161.6	-32.3	0	0	0	0	101.7	V19 H77 C81	V19-V79 HydrophobicContact CG2-CG1 4.31Å; H77-V79 HydrophobicContact CB-CG1 4.19Å; H77-V79 PolarHBondContact O-N 2.75Å; V79-C81 PolarHBondContact O-N 3.35Å
80	A	48.4	Very low	57.9	Low	69 Å²	69	110 Å²	110	57%	0.57	57%	0.57	S	S	*	*			trans	-45.3	134.3	161.3	0	0	0	0	0	105.2	P78 T82	P78-A80 PolarHBondContact O-N 3.19Å; A80-T82 PolarHBondContact O-N 2.99Å; A80-T82 PolarHBondContact O-OG1 3.46Å
81	C	47.8	Very low	58.1	Low	105 Å²	105	114.8 Å²	114.8	71%	0.709	57%	0.574	S	S	*	*			trans	-67.7	60	-178.1	-155.9	0	0	0	0	109.7	V79 L83	V79-C81 PolarHBondContact O-N 3.35Å; C81-L83 PolarHBondContact O-N 2.95Å
82	T	47	Very low	57.6	Low	77 Å²	77	112.7 Å²	112.7	47%	0.472	58%	0.578	S	S	.	*			trans	-83.1	106.7	172.3	-24	0	0	0	0	104.2	A80 S84 Q85	A80-T82 PolarHBondContact O-N 2.99Å; A80-T82 PolarHBondContact O-OG1 3.46Å; T82-S84 WeakPolarHBondContact CB-OG 3.5Å; T82-S84 VanDerWaalsContact CG2-OG 3.23Å; T82-S84 WeakPolarHBondContact CG2-OG 3.47Å; T82-S84 PolarHBondContact O-N 3.47Å; T82-Q85 PolarHBondContact O-N 2.8Å
83	L	57.6	Low	58.2	Low	132 Å²	132	115.4 Å²	115.4	69%	0.691	58%	0.58	S	S	*	*	H	α-helix	trans	-44.3	-26.4	173.2	-70.7	165.2	0	0	0	112.2	C81 Q85 M86 Q87	C81-L83 PolarHBondContact O-N 2.95Å; L83-Q85 PolarHBondContact O-N 3.24Å; L83-M86 PolarHBondContact O-N 2.87Å; L83-Q87 WeakPolarHBondContact O-CG 3.1Å; L83-Q87 PolarHBondContact O-N 3.47Å
84	S	55.9	Low	58.8	Low	53 Å²	53	118.3 Å²	118.3	37%	0.371	59%	0.593	S	S	.	*	H	α-helix	trans	-57.7	-41.6	174.8	63.6	0	0	0	0	114.8	T82 Q87 V88	T82-S84 WeakPolarHBondContact CB-OG 3.5Å; T82-S84 VanDerWaalsContact CG2-OG 3.23Å; T82-S84 WeakPolarHBondContact CG2-OG 3.47Å; T82-S84 PolarHBondContact O-N 3.47Å; S84-Q87 PolarHBondContact O-N 3.35Å; S84-V88 WeakPolarHBondContact O-CG2 3.46Å; S84-V88 PolarHBondContact O-N 3.44Å; S84-V88 VanDerWaalsContact O-N 3.09Å
85	Q	59	Low	60.1	Low	116 Å²	116	126.1 Å²	126.1	54%	0.542	62%	0.618	S	S	.	*	H	α-helix	trans	-73.4	-40	-178.4	-67.9	-64.1	-51.8	0	0	111.3	T82 L83 Q87 V88 V89	T82-Q85 PolarHBondContact O-N 2.8Å; L83-Q85 PolarHBondContact O-N 3.24Å; Q85-Q87 VanDerWaalsContact C-N 3.29Å; Q85-Q87 PolarHBondContact O-N 3.11Å; Q85-V88 PolarHBondContact O-N 3.2Å; Q85-V89 WeakPolarHBondContact O-CG2 3.23Å; Q85-V89 PolarHBondContact O-N 3.47Å; Q85-V89 VanDerWaalsContact O-N 3.08Å
86	M	58.6	Low	60.6	Low	85 Å²	85	125.5 Å²	125.5	42%	0.419	62%	0.621	S	S	.	*	H	α-helix	trans	-58.2	-44.7	170.6	-99.5	-157.8	-178.9	0	0	110.5	F18 L83 V88 V89 Y90	F18-M86 HydrophobicContact CB-CE 4.37Å; F18-M86 HydrophobicContact CD2-CE 3.28Å; F18-M86 HydrophobicContact CE2-CE 3.75Å; F18-M86 HydrophobicContact CG-CE 4Å; L83-M86 PolarHBondContact O-N 2.87Å; M86-V88 VanDerWaalsContact C-N 3.34Å; M86-V88 PolarHBondContact O-N 3.46Å; M86-V89 PolarHBondContact O-N 3.13Å; M86-Y90 WeakPolarHBondContact O-CB 3.33Å; M86-Y90 WeakPolarHBondContact O-CD2 3.37Å; M86-Y90 PolarHBondContact O-N 3.09Å; M86-Y90 HydrophobicContact SD-CE2 4.43Å
87	Q	63.7	Low	61.1	Low	135 Å²	135	127.9 Å²	127.9	63%	0.631	64%	0.639	S	S	*	*	H	α-helix	trans	-59.6	-41.2	178.4	-76.2	179.5	-66.6	0	0	112.6	L83 S84 Q85 R91	L83-Q87 WeakPolarHBondContact O-CG 3.1Å; L83-Q87 PolarHBondContact O-N 3.47Å; S84-Q87 PolarHBondContact O-N 3.35Å; Q85-Q87 VanDerWaalsContact C-N 3.29Å; Q85-Q87 PolarHBondContact O-N 3.11Å; Q87-R91 WeakPolarHBondContact O-CB 3.32Å; Q87-R91 PolarHBondContact O-N 3.16Å
88	V	64.1	Low	61.4	Low	91 Å²	91	127.6 Å²	127.6	55%	0.552	64%	0.64	S	S	*	*	H	α-helix	trans	-68.2	-45.4	179.1	175.4	0	0	0	0	111.6	S84 Q85 M86 Y90 R91 C92	S84-V88 WeakPolarHBondContact O-CG2 3.46Å; S84-V88 PolarHBondContact O-N 3.44Å; S84-V88 VanDerWaalsContact O-N 3.09Å; Q85-V88 PolarHBondContact O-N 3.2Å; M86-V88 VanDerWaalsContact C-N 3.34Å; M86-V88 PolarHBondContact O-N 3.46Å; V88-Y90 PolarHBondContact O-N 3.22Å; V88-R91 PolarHBondContact O-N 3.42Å; V88-C92 WeakPolarHBondContact O-CB 3.48Å; V88-C92 PolarHBondContact O-N 2.9Å
89	V	65.3	Low	62	Low	97 Å²	97	128.1 Å²	128.1	59%	0.588	63%	0.633	S	S	*	*	H	α-helix	trans	-61.9	-45.9	178.1	173.5	0	0	0	0	110.5	Q85 M86 C92 K93	Q85-V89 WeakPolarHBondContact O-CG2 3.23Å; Q85-V89 PolarHBondContact O-N 3.47Å; Q85-V89 VanDerWaalsContact O-N 3.08Å; M86-V89 PolarHBondContact O-N 3.13Å; V89-C92 PolarHBondContact O-N 3.05Å; V89-K93 WeakPolarHBondContact O-CB 3.34Å; V89-K93 PolarHBondContact O-N 3.24Å
90	Y	65.9	Low	62.5	Low	155 Å²	155	131.2 Å²	131.2	61%	0.608	64%	0.644	S	S	*	*	H	α-helix	trans	-65	-41.1	176	-90.4	-84.7	0	0	0	112.4	M86 V88 C92 K93 K94	M86-Y90 WeakPolarHBondContact O-CB 3.33Å; M86-Y90 WeakPolarHBondContact O-CD2 3.37Å; M86-Y90 PolarHBondContact O-N 3.09Å; M86-Y90 HydrophobicContact SD-CE2 4.43Å; V88-Y90 PolarHBondContact O-N 3.22Å; Y90-C92 PolarHBondContact O-N 2.91Å; Y90-K93 PolarHBondContact O-N 2.61Å; Y90-K94 WeakPolarHBondContact O-CB 3.41Å; Y90-K94 PolarHBondContact O-N 3.23Å
91	R	72.4	Confident	63.4	Low	208 Å²	208	134.8 Å²	134.8	79%	0.785	65%	0.648	S	S	*	*	H	α-helix	trans	-65.3	-38.8	179.5	-167.8	178.6	-169.1	-164.6	3.6	111.8	Q87 V88 R95	Q87-R91 WeakPolarHBondContact O-CB 3.32Å; Q87-R91 PolarHBondContact O-N 3.16Å; V88-R91 PolarHBondContact O-N 3.42Å; R91-R95 PolarHBondContact O-N 3.1Å
92	C	60.3	Low	64.3	Low	85 Å²	85	136.7 Å²	136.7	57%	0.574	65%	0.645	S	S	*	*	H	α-helix	trans	-70.7	-35.1	176.7	-161.3	0	0	0	0	111.8	V88 V89 Y90	V88-C92 WeakPolarHBondContact O-CB 3.48Å; V88-C92 PolarHBondContact O-N 2.9Å; V89-C92 PolarHBondContact O-N 3.05Å; Y90-C92 PolarHBondContact O-N 2.91Å
93	K	71.6	Confident	65.5	Low	146 Å²	146	140.7 Å²	140.7	64%	0.635	66%	0.656	S	S	*	*	H	α-helix	trans	-66.9	-46.5	176.2	-142.6	-176.1	-172.5	-167.1	0	111.3	V89 Y90 R95 K96	V89-K93 WeakPolarHBondContact O-CB 3.34Å; V89-K93 PolarHBondContact O-N 3.24Å; Y90-K93 PolarHBondContact O-N 2.61Å; K93-R95 PolarHBondContact O-N 3.22Å; K93-R95 VanDerWaalsContact O-N 3.13Å; K93-K96 PolarHBondContact O-N 3.35Å; K93-K96 VanDerWaalsContact O-N 3.17Å
94	K	73.4	Confident	66.1	Low	171 Å²	171	141.3 Å²	141.3	74%	0.743	65%	0.654	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.5	-11.3	-179.3	-150	-176.2	-172.2	-178.3	0	114.6	Y90	Y90-K94 WeakPolarHBondContact O-CB 3.41Å; Y90-K94 PolarHBondContact O-N 3.23Å
95	R	81.1	Confident	66.8	Low	229 Å²	229	148.1 Å²	148.1	86%	0.864	68%	0.675	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.2	-10.4	176.9	-154.6	-179.9	-145.8	-125.9	2.8	113.2	R91 K93	R91-R95 PolarHBondContact O-N 3.1Å; K93-R95 PolarHBondContact O-N 3.22Å; K93-R95 VanDerWaalsContact O-N 3.13Å
96	K	68.4	Low	67.5	Low	192 Å²	192	150.8 Å²	150.8	84%	0.835	69%	0.686	S	S	*	*	T	Hydrogen-bonded Turn	trans	-104.2	-11.2	-179.6	-72.8	-160.9	177.4	-169.4	0	114	K93	K93-K96 PolarHBondContact O-N 3.35Å; K93-K96 VanDerWaalsContact O-N 3.17Å
97	E	65.2	Low	68.3	Low	215 Å²	215	156.7 Å²	156.7	100%	1.005	71%	0.711	S	S	*	*			trans	-91.5	0	163.2	-78.3	165.9	90.4	0	0	108.9

Retrieved 97 of 97 residues in 211.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).