A0A077Z374_TRITR Loading...

Cytochrome c oxidase, subunit VB

AlphaFold DB , UniProt , Accession A0A077Z374, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 93 aa.

						>A0A077Z374_TRITR|A0A077Z374
MFRTEDVTVAMKKKHLYDRIMGDDRYESRIYVQAPGTTESPNVIVSSVSQRIVGCLCSPNEAHAKYMVLEKGKNKQCACGYWFQLVDDNPEPF
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53.5	Low	78.3	Confident	239 Å²	239	122.1 Å²	122.1	100%	1.177	63%	0.629	S	S	*	*				0	111.4	0	-168.4	168.1	-173.5	0	0	106.8
2	F	64.6	Low	79.2	Confident	178 Å²	178	124.8 Å²	124.8	78%	0.781	63%	0.632	S	S	*	*			trans	-67.1	139.4	176.8	-61.5	-78.9	0	0	0	108.9	V7	F2-V7 HydrophobicContact CB-CG2 4.14Å
3	R	70.3	Confident	80.2	Confident	182 Å²	182	124.3 Å²	124.3	69%	0.687	62%	0.623	S	S	*	*			trans	-68.9	141.1	174.3	-67.6	178.2	169.8	177.9	-2.7	108	E5 D6 V7	R3-E5 PolarHBondContact O-N 2.81Å; R3-D6 WeakPolarHBondContact CB-OD2 3.36Å; R3-D6 PolarHBondContact N-OD2 3.11Å; R3-D6 WeakPolarHBondContact O-CB 3.34Å; R3-D6 PolarHBondContact O-N 3.3Å; R3-V7 PolarHBondContact O-N 3.49Å
4	T	73.8	Confident	80.8	Confident	116 Å²	116	123.2 Å²	123.2	71%	0.712	61%	0.613	S	S	*	*	H	α-helix	trans	-55.5	-36.5	-180	-37.5	0	0	0	0	111.5	D6 V7 T8	T4-D6 PolarHBondContact O-N 3Å; T4-V7 PolarHBondContact O-N 3.04Å; T4-T8 WeakPolarHBondContact O-CG2 3.42Å; T4-T8 PolarHBondContact O-N 3.41Å
5	E	73.9	Confident	81.3	Confident	140 Å²	140	119.5 Å²	119.5	65%	0.654	59%	0.593	S	S	*	*	H	α-helix	trans	-57	-45.5	175.5	-65.9	177.9	153.5	0	0	111.9	R3 V7 T8 V9	R3-E5 PolarHBondContact O-N 2.81Å; E5-V7 VanDerWaalsContact C-N 3.31Å; E5-V7 PolarHBondContact O-N 2.86Å; E5-T8 PolarHBondContact O-N 3.06Å; E5-T8 PolarHBondContact O-OG1 2.85Å; E5-V9 WeakPolarHBondContact O-CG2 3.45Å; E5-V9 PolarHBondContact O-N 2.9Å; E5-V9 VanDerWaalsContact O-N 3.09Å
6	D	84.7	Confident	81.9	Confident	94 Å²	94	118.4 Å²	118.4	50%	0.503	59%	0.589	S	S	.	*	H	α-helix	trans	-60.4	-42.3	179.7	-60.2	-34.8	0	0	0	111.4	R3 T4 V9 A10	R3-D6 WeakPolarHBondContact CB-OD2 3.36Å; R3-D6 PolarHBondContact N-OD2 3.11Å; R3-D6 WeakPolarHBondContact O-CB 3.34Å; R3-D6 PolarHBondContact O-N 3.3Å; T4-D6 PolarHBondContact O-N 3Å; D6-V9 PolarHBondContact O-N 3.46Å; D6-A10 WeakPolarHBondContact O-CB 3.12Å; D6-A10 PolarHBondContact O-N 2.85Å
7	V	84	Confident	82.4	Confident	70 Å²	70	119.3 Å²	119.3	42%	0.424	59%	0.585	S	S	.	*	H	α-helix	trans	-67.4	-43	-180	-178.5	0	0	0	0	110.9	F2 R3 T4 E5 V9 A10 M11	F2-V7 HydrophobicContact CB-CG2 4.14Å; R3-V7 PolarHBondContact O-N 3.49Å; T4-V7 PolarHBondContact O-N 3.04Å; E5-V7 VanDerWaalsContact C-N 3.31Å; E5-V7 PolarHBondContact O-N 2.86Å; V7-V9 VanDerWaalsContact C-N 3.33Å; V7-V9 PolarHBondContact O-N 2.92Å; V7-A10 PolarHBondContact O-N 3.45Å; V7-M11 HydrophobicContact CG1-CG 4.47Å; V7-M11 HydrophobicContact CG1-SD 4.27Å; V7-M11 WeakPolarHBondContact O-CG 3.49Å; V7-M11 PolarHBondContact O-N 3.03Å
8	T	87.9	Confident	82.8	Confident	65 Å²	65	113.8 Å²	113.8	40%	0.399	56%	0.559	S	S	.	*	H	α-helix	trans	-63.6	-39.5	179.5	60.7	0	0	0	0	112.4	T4 E5 K12	T4-T8 WeakPolarHBondContact O-CG2 3.42Å; T4-T8 PolarHBondContact O-N 3.41Å; E5-T8 PolarHBondContact O-N 3.06Å; E5-T8 PolarHBondContact O-OG1 2.85Å; T8-K12 WeakPolarHBondContact O-CB 3.35Å; T8-K12 WeakPolarHBondContact O-CG 3.42Å; T8-K12 PolarHBondContact O-N 2.85Å
9	V	89.7	Confident	83	Confident	95 Å²	95	115.2 Å²	115.2	58%	0.576	56%	0.557	S	S	*	*	H	α-helix	trans	-66.8	-43.7	176.8	173.7	0	0	0	0	110.4	E5 D6 V7 M11 K12 K13	E5-V9 WeakPolarHBondContact O-CG2 3.45Å; E5-V9 PolarHBondContact O-N 2.9Å; E5-V9 VanDerWaalsContact O-N 3.09Å; D6-V9 PolarHBondContact O-N 3.46Å; V7-V9 VanDerWaalsContact C-N 3.33Å; V7-V9 PolarHBondContact O-N 2.92Å; V9-M11 PolarHBondContact O-N 2.93Å; V9-K12 PolarHBondContact O-N 3.27Å; V9-K13 WeakPolarHBondContact O-CB 3.44Å; V9-K13 PolarHBondContact O-N 3.16Å
10	A	89.5	Confident	83.4	Confident	59 Å²	59	115.5 Å²	115.5	49%	0.488	56%	0.56	S	S	.	*	H	α-helix	trans	-59.6	-45.1	176.8	0	0	0	0	0	112.3	D6 V7 K13 K14	D6-A10 WeakPolarHBondContact O-CB 3.12Å; D6-A10 PolarHBondContact O-N 2.85Å; V7-A10 PolarHBondContact O-N 3.45Å; A10-K13 PolarHBondContact O-N 2.88Å; A10-K14 PolarHBondContact O-N 2.77Å
11	M	89.1	Confident	83.7	Confident	105 Å²	105	117.1 Å²	117.1	52%	0.517	57%	0.569	S	S	.	*	H	α-helix	trans	-64.1	-46.5	177.4	-71.7	-178.3	71.6	0	0	112.4	V7 V9 K13 K14 H15	V7-M11 HydrophobicContact CG1-CG 4.47Å; V7-M11 HydrophobicContact CG1-SD 4.27Å; V7-M11 WeakPolarHBondContact O-CG 3.49Å; V7-M11 PolarHBondContact O-N 3.03Å; V9-M11 PolarHBondContact O-N 2.93Å; M11-K13 VanDerWaalsContact C-N 3.28Å; M11-K13 PolarHBondContact O-N 2.91Å; M11-K14 PolarHBondContact O-N 2.83Å; M11-H15 PolarHBondContact O-CD2 2.9Å; M11-H15 PolarHBondContact O-N 3.07Å
12	K	90.1	Very high	85.2	Confident	154 Å²	154	108.7 Å²	108.7	67%	0.67	54%	0.543	S	S	*	.	H	α-helix	trans	-59.5	-41.2	176.9	-75.4	176.8	-179.4	178.9	0	111.6	T8 V9 H15 L16	T8-K12 WeakPolarHBondContact O-CB 3.35Å; T8-K12 WeakPolarHBondContact O-CG 3.42Å; T8-K12 PolarHBondContact O-N 2.85Å; V9-K12 PolarHBondContact O-N 3.27Å; K12-H15 PolarHBondContact O-N 3.37Å; K12-L16 WeakPolarHBondContact O-CB 3.32Å; K12-L16 PolarHBondContact O-N 3.13Å
13	K	91.3	Very high	86.1	Confident	119 Å²	119	102.1 Å²	102.1	52%	0.517	52%	0.516	S	S	.	.	H	α-helix	trans	-63	-43.9	176.8	-177.3	170	177.8	175.2	0	111.3	V9 A10 M11 L16 Y17	V9-K13 WeakPolarHBondContact O-CB 3.44Å; V9-K13 PolarHBondContact O-N 3.16Å; A10-K13 PolarHBondContact O-N 2.88Å; M11-K13 VanDerWaalsContact C-N 3.28Å; M11-K13 PolarHBondContact O-N 2.91Å; K13-L16 PolarHBondContact O-N 3.09Å; K13-Y17 HydrophobicContact CD-CE2 4.09Å; K13-Y17 VanDerWaalsContact CE-CE2 3.44Å; K13-Y17 WeakPolarHBondContact CE-OH 3.34Å; K13-Y17 HydrophobicContact CG-CD2 3.92Å; K13-Y17 HydrophobicContact CG-CE2 3.49Å; K13-Y17 VanDerWaalsContact CG-CE2 3.49Å; K13-Y17 WeakPolarHBondContact O-CD2 3.37Å; K13-Y17 PolarHBondContact O-N 3.28Å
14	K	88.6	Confident	86.6	Confident	109 Å²	109	95.5 Å²	95.5	47%	0.474	49%	0.494	S	S	.	.	H	α-helix	trans	-58.8	-53.1	174.6	179.9	-178.8	174.1	-178.9	0	111.8	A10 M11 L16 Y17 D18 Y26	A10-K14 PolarHBondContact O-N 2.77Å; M11-K14 PolarHBondContact O-N 2.83Å; K14-L16 PolarHBondContact O-N 3.47Å; K14-Y17 WeakPolarHBondContact O-CB 3.21Å; K14-Y17 PolarHBondContact O-N 3.41Å; K14-D18 PolarHBondContact O-N 2.8Å; K14-Y26 PolarHBondContact NZ-OH 2.97Å
15	H	89.3	Confident	86.8	Confident	67 Å²	67	92.8 Å²	92.8	31%	0.31	47%	0.471	S	S	.	.	H	α-helix	trans	-61.1	-34.4	-179.2	-64.9	-176	0	0	0	112.2	M11 K12 R19 Y26	M11-H15 PolarHBondContact O-CD2 2.9Å; M11-H15 PolarHBondContact O-N 3.07Å; K12-H15 PolarHBondContact O-N 3.37Å; H15-R19 VanDerWaalsContact O-CB 3.31Å; H15-R19 WeakPolarHBondContact O-CB 3.45Å; H15-R19 PolarHBondContact O-N 2.92Å; H15-Y26 AromaticContact CD2-CD2 3.68Å; H15-Y26 AromaticContact CD2-CE2 3.95Å; H15-Y26 AromaticContact CD2-CG 3.76Å; H15-Y26 AromaticContact CE1-CD1 3.87Å; H15-Y26 AromaticContact CE1-CG 3.9Å; H15-Y26 AromaticContact NE2-CD1 3.56Å; H15-Y26 AromaticContact NE2-CE1 3.78Å; H15-Y26 AromaticContact NE2-CG 3.68Å
16	L	89.7	Confident	87.2	Confident	103 Å²	103	90.7 Å²	90.7	54%	0.539	46%	0.458	S	S	.	.	H	α-helix	trans	-64.1	-44.2	173.8	179.5	62.4	0	0	0	111.7	K12 K13 K14 I20	K12-L16 WeakPolarHBondContact O-CB 3.32Å; K12-L16 PolarHBondContact O-N 3.13Å; K13-L16 PolarHBondContact O-N 3.09Å; K14-L16 PolarHBondContact O-N 3.47Å; L16-I20 HydrophobicContact CD1-CD1 4.12Å; L16-I20 HydrophobicContact CD1-CG1 4.45Å; L16-I20 HydrophobicContact CG-CD1 3.97Å; L16-I20 WeakPolarHBondContact O-CD1 3.3Å; L16-I20 VanDerWaalsContact O-CG1 3.23Å; L16-I20 WeakPolarHBondContact O-CG1 3.37Å; L16-I20 PolarHBondContact O-N 3.21Å
17	Y	91.5	Very high	87	Confident	133 Å²	133	89.1 Å²	89.1	52%	0.522	45%	0.448	S	S	.	.	H	α-helix	trans	-62.9	-47.3	175.3	-77.9	-64.1	0	0	0	112.1	K13 K14 R19 I20 M21	K13-Y17 HydrophobicContact CD-CE2 4.09Å; K13-Y17 VanDerWaalsContact CE-CE2 3.44Å; K13-Y17 WeakPolarHBondContact CE-OH 3.34Å; K13-Y17 HydrophobicContact CG-CD2 3.92Å; K13-Y17 HydrophobicContact CG-CE2 3.49Å; K13-Y17 VanDerWaalsContact CG-CE2 3.49Å; K13-Y17 WeakPolarHBondContact O-CD2 3.37Å; K13-Y17 PolarHBondContact O-N 3.28Å; K14-Y17 WeakPolarHBondContact O-CB 3.21Å; K14-Y17 PolarHBondContact O-N 3.41Å; Y17-R19 VanDerWaalsContact C-N 3.29Å; Y17-R19 PolarHBondContact O-N 3.27Å; Y17-I20 PolarHBondContact O-N 2.82Å; Y17-I20 VanDerWaalsContact O-N 3.09Å; Y17-M21 WeakPolarHBondContact O-CG 3.4Å; Y17-M21 PolarHBondContact O-N 2.8Å
18	D	88.4	Confident	86.7	Confident	21 Å²	21	91.8 Å²	91.8	11%	0.112	47%	0.469	C	S	.	.	H	α-helix	trans	-56.6	-46.7	179.1	-65.1	-20.8	0	0	0	110.1	K14 I20 M21 G22 D23 Y26	K14-D18 PolarHBondContact O-N 2.8Å; D18-I20 PolarHBondContact O-N 2.92Å; D18-M21 CarbonylContact O-C 3.46Å; D18-M21 WeakPolarHBondContact O-CA 3.45Å; D18-M21 PolarHBondContact O-N 3.02Å; D18-M21 VanDerWaalsContact O-N 3.08Å; D18-G22 PolarHBondContact O-N 2.8Å; D18-G22 VanDerWaalsContact O-N 3.12Å; D18-D23 CarbonylContact C-O 3.59Å; D18-D23 VanDerWaalsContact C-O 3.26Å; D18-D23 HydrophobicContact CB-CB 4.03Å; D18-D23 WeakPolarHBondContact O-CA 3.5Å; D18-D23 WeakPolarHBondContact O-CB 3.35Å; D18-D23 PolarHBondContact O-N 2.96Å; D18-Y26 VanDerWaalsContact OD2-CE2 3.22Å; D18-Y26 WeakPolarHBondContact OD2-CE2 3.42Å
19	R	87.5	Confident	86.2	Confident	139 Å²	139	94.9 Å²	94.9	53%	0.525	47%	0.474	S	S	.	.	H	α-helix	trans	-60.2	-41.9	175.8	-176.7	-178.3	-178.5	142.9	-6.3	113.2	H15 Y17 M21 G22 D23 E27	H15-R19 VanDerWaalsContact O-CB 3.31Å; H15-R19 WeakPolarHBondContact O-CB 3.45Å; H15-R19 PolarHBondContact O-N 2.92Å; Y17-R19 VanDerWaalsContact C-N 3.29Å; Y17-R19 PolarHBondContact O-N 3.27Å; R19-M21 VanDerWaalsContact C-N 3.25Å; R19-M21 PolarHBondContact O-N 2.99Å; R19-G22 PolarHBondContact O-N 3.39Å; R19-G22 VanDerWaalsContact O-N 3.11Å; R19-D23 PolarHBondContact N-O 3.38Å; R19-E27 WeakPolarHBondContact CD-OE1 3.2Å; R19-E27 IonicContact CZ-OE1 2.63Å; R19-E27 IonicContact NE-OE1 2.92Å; R19-E27 IonicContact NH1-OE1 2.8Å; R19-E27 PolarHBondContact NH1-OE1 2.83Å; R19-E27 IonicContact NH1-OE2 3.94Å; R19-E27 PolarHBondContact NH1-OE2 3.01Å
20	I	90.6	Very high	85.6	Confident	121 Å²	121	97.4 Å²	97.4	62%	0.621	48%	0.482	S	S	*	.	H	α-helix	trans	-64.1	-35.3	177	-71.1	164.9	0	0	0	110.6	L16 Y17 D18 G22	L16-I20 HydrophobicContact CD1-CD1 4.12Å; L16-I20 HydrophobicContact CD1-CG1 4.45Å; L16-I20 HydrophobicContact CG-CD1 3.97Å; L16-I20 WeakPolarHBondContact O-CD1 3.3Å; L16-I20 VanDerWaalsContact O-CG1 3.23Å; L16-I20 WeakPolarHBondContact O-CG1 3.37Å; L16-I20 PolarHBondContact O-N 3.21Å; Y17-I20 PolarHBondContact O-N 2.82Å; Y17-I20 VanDerWaalsContact O-N 3.09Å; D18-I20 PolarHBondContact O-N 2.92Å; I20-G22 PolarHBondContact O-N 3.18Å
21	M	90.1	Very high	85.2	Confident	151 Å²	151	99.9 Å²	99.9	74%	0.744	48%	0.48	S	S	*	.	T	Hydrogen-bonded Turn	trans	-78.5	-0.6	175.5	-62.7	-62	-124.4	0	0	113.4	Y17 D18 R19	Y17-M21 WeakPolarHBondContact O-CG 3.4Å; Y17-M21 PolarHBondContact O-N 2.8Å; D18-M21 CarbonylContact O-C 3.46Å; D18-M21 WeakPolarHBondContact O-CA 3.45Å; D18-M21 PolarHBondContact O-N 3.02Å; D18-M21 VanDerWaalsContact O-N 3.08Å; R19-M21 VanDerWaalsContact C-N 3.25Å; R19-M21 PolarHBondContact O-N 2.99Å
22	G	84.7	Confident	84.6	Confident	62 Å²	62	101.8 Å²	101.8	64%	0.639	50%	0.497	S	S	*	.	T	Hydrogen-bonded Turn	trans	83.3	9.2	-179.5	0	0	0	0	0	114.7	D18 R19 I20	D18-G22 PolarHBondContact O-N 2.8Å; D18-G22 VanDerWaalsContact O-N 3.12Å; R19-G22 PolarHBondContact O-N 3.39Å; R19-G22 VanDerWaalsContact O-N 3.11Å; I20-G22 PolarHBondContact O-N 3.18Å
23	D	83.9	Confident	83.9	Confident	39 Å²	39	97.7 Å²	97.7	21%	0.209	48%	0.48	C	S	.	.			trans	-86	113.1	172.6	178.2	-3.5	0	0	0	110	D18 R19 R25	D18-D23 CarbonylContact C-O 3.59Å; D18-D23 VanDerWaalsContact C-O 3.26Å; D18-D23 HydrophobicContact CB-CB 4.03Å; D18-D23 WeakPolarHBondContact O-CA 3.5Å; D18-D23 WeakPolarHBondContact O-CB 3.35Å; D18-D23 PolarHBondContact O-N 2.96Å; R19-D23 PolarHBondContact N-O 3.38Å; D23-R25 WeakPolarHBondContact OD1-CB 3.32Å; D23-R25 WeakPolarHBondContact OD1-CD 3.21Å; D23-R25 WeakPolarHBondContact OD1-CG 3.5Å; D23-R25 IonicContact OD1-CZ 3.49Å; D23-R25 PolarHBondContact OD1-N 2.7Å; D23-R25 VanDerWaalsContact OD1-N 3.09Å; D23-R25 IonicContact OD1-NE 3.81Å; D23-R25 PolarHBondContact OD1-NE 3.49Å; D23-R25 IonicContact OD2-CZ 2.87Å; D23-R25 IonicContact OD2-NE 2.79Å; D23-R25 PolarHBondContact OD2-NE 3.39Å; D23-R25 IonicContact OD2-NH2 3.59Å; D23-R25 PolarHBondContact OD2-NH2 2.92Å
24	D	80.7	Confident	83.3	Confident	43 Å²	43	94 Å²	94	23%	0.23	47%	0.472	C	S	.	.			trans	-108.6	19.3	-175.3	72.9	-2.5	0	0	0	114	Y26 E27 R29 Y31	D24-Y26 PolarHBondContact O-N 2.94Å; D24-E27 HydrophobicContact CB-CB 4.24Å; D24-E27 HydrophobicContact CB-CG 4.08Å; D24-E27 WeakPolarHBondContact O-CB 3.25Å; D24-E27 PolarHBondContact O-N 2.73Å; D24-R29 VanDerWaalsContact OD2-CD 3.28Å; D24-R29 WeakPolarHBondContact OD2-CD 3.33Å; D24-R29 IonicContact OD2-CZ 2.97Å; D24-R29 IonicContact OD2-NE 2.73Å; D24-R29 IonicContact OD2-NH1 3.06Å; D24-R29 PolarHBondContact OD2-NH1 3.3Å; D24-Y31 PolarHBondContact O-OH 3.23Å; D24-Y31 WeakPolarHBondContact OD1-CE1 3.3Å
25	R	78.4	Confident	83.4	Confident	60 Å²	60	93 Å²	93	23%	0.226	48%	0.477	C	S	.	.	T	Hydrogen-bonded Turn	trans	-57	-23.3	-177.2	-71.7	178.1	-62.3	173	-1.8	115	D23 V45 D88	D23-R25 WeakPolarHBondContact OD1-CB 3.32Å; D23-R25 WeakPolarHBondContact OD1-CD 3.21Å; D23-R25 WeakPolarHBondContact OD1-CG 3.5Å; D23-R25 IonicContact OD1-CZ 3.49Å; D23-R25 PolarHBondContact OD1-N 2.7Å; D23-R25 VanDerWaalsContact OD1-N 3.09Å; D23-R25 IonicContact OD1-NE 3.81Å; D23-R25 PolarHBondContact OD1-NE 3.49Å; D23-R25 IonicContact OD2-CZ 2.87Å; D23-R25 IonicContact OD2-NE 2.79Å; D23-R25 PolarHBondContact OD2-NE 3.39Å; D23-R25 IonicContact OD2-NH2 3.59Å; D23-R25 PolarHBondContact OD2-NH2 2.92Å; R25-V45 HydrophobicContact CG-CG2 3.69Å; R25-D88 PolarHBondContact NH1-O 3.38Å
26	Y	81.3	Confident	83.4	Confident	96 Å²	96	90 Å²	90	38%	0.376	46%	0.463	S	S	.	.	T	Hydrogen-bonded Turn	trans	-101.3	0.6	179.7	-52.7	-76.6	0	0	0	113.7	K14 H15 D18 D24	K14-Y26 PolarHBondContact NZ-OH 2.97Å; H15-Y26 AromaticContact CD2-CD2 3.68Å; H15-Y26 AromaticContact CD2-CE2 3.95Å; H15-Y26 AromaticContact CD2-CG 3.76Å; H15-Y26 AromaticContact CE1-CD1 3.87Å; H15-Y26 AromaticContact CE1-CG 3.9Å; H15-Y26 AromaticContact NE2-CD1 3.56Å; H15-Y26 AromaticContact NE2-CE1 3.78Å; H15-Y26 AromaticContact NE2-CG 3.68Å; D18-Y26 VanDerWaalsContact OD2-CE2 3.22Å; D18-Y26 WeakPolarHBondContact OD2-CE2 3.42Å; D24-Y26 PolarHBondContact O-N 2.94Å
27	E	80.8	Confident	83.6	Confident	61 Å²	61	87.8 Å²	87.8	29%	0.285	45%	0.454	S	S	.	.	S	Bend	trans	-88.9	143.6	179.7	-63.5	-72.8	169	0	0	110.8	R19 D24 R29	R19-E27 WeakPolarHBondContact CD-OE1 3.2Å; R19-E27 IonicContact CZ-OE1 2.63Å; R19-E27 IonicContact NE-OE1 2.92Å; R19-E27 IonicContact NH1-OE1 2.8Å; R19-E27 PolarHBondContact NH1-OE1 2.83Å; R19-E27 IonicContact NH1-OE2 3.94Å; R19-E27 PolarHBondContact NH1-OE2 3.01Å; D24-E27 HydrophobicContact CB-CB 4.24Å; D24-E27 HydrophobicContact CB-CG 4.08Å; D24-E27 WeakPolarHBondContact O-CB 3.25Å; D24-E27 PolarHBondContact O-N 2.73Å; E27-R29 HydrophobicContact CB-CG 4Å; E27-R29 PolarHBondContact O-N 3.22Å
28	S	78.6	Confident	83.7	Confident	125 Å²	125	85 Å²	85	87%	0.874	45%	0.451	S	S	*	.			trans	-77.9	87.4	172.9	57.8	0	0	0	0	109.8
29	R	76.7	Confident	83.9	Confident	131 Å²	131	91.8 Å²	91.8	49%	0.494	48%	0.482	S	S	.	.			trans	-125.1	149.4	-178.8	-68.4	179.6	176.3	-166.6	-2.3	112.5	D24 E27	D24-R29 VanDerWaalsContact OD2-CD 3.28Å; D24-R29 WeakPolarHBondContact OD2-CD 3.33Å; D24-R29 IonicContact OD2-CZ 2.97Å; D24-R29 IonicContact OD2-NE 2.73Å; D24-R29 IonicContact OD2-NH1 3.06Å; D24-R29 PolarHBondContact OD2-NH1 3.3Å; E27-R29 HydrophobicContact CB-CG 4Å; E27-R29 PolarHBondContact O-N 3.22Å
30	I	77.3	Confident	84.2	Confident	148 Å²	148	87.6 Å²	87.6	76%	0.759	48%	0.475	S	S	*	.			trans	-84.9	114.3	163.1	-60.1	175	0	0	0	106.1	L56	I30-L56 HydrophobicContact CD1-CD1 4.38Å
31	Y	81	Confident	84.4	Confident	111 Å²	111	82.5 Å²	82.5	44%	0.435	45%	0.449	S	S	.	.	P	Polyproline II helix	trans	-76.5	135.1	177.7	-65.3	-82	0	0	0	110.4	D24	D24-Y31 PolarHBondContact O-OH 3.23Å; D24-Y31 WeakPolarHBondContact OD1-CE1 3.3Å
32	V	75.5	Confident	84.6	Confident	144 Å²	144	75.8 Å²	75.8	87%	0.873	42%	0.416	S	S	*	.	P	Polyproline II helix	trans	-70.1	131.3	170.8	-178.6	0	0	0	0	108
33	Q	76	Confident	84.9	Confident	68 Å²	68	77 Å²	77	32%	0.318	41%	0.411	S	S	.	.	P	Polyproline II helix	trans	-67.5	134.6	-179.1	-67	162.6	5.6	0	0	109.4	N42 L56 Y81	Q33-N42 VanDerWaalsContact CA-OD1 3.25Å; Q33-N42 WeakPolarHBondContact CA-OD1 3.09Å; Q33-L56 PolarHBondContact NE2-O 3.46Å; Q33-L56 VanDerWaalsContact NE2-O 3.16Å; Q33-Y81 VanDerWaalsContact OE1-CD2 3.25Å
34	A	79.6	Confident	85.2	Confident	41 Å²	41	76.5 Å²	76.5	34%	0.339	41%	0.408	S	S	.	.			trans	-62.1	-179.9	161.9	0	0	0	0	0	109.2	G36 N42	A34-G36 PolarHBondContact O-N 2.87Å; A34-N42 PolarHBondContact N-OD1 2.8Å
35	P	89.1	Confident	85.6	Confident	89 Å²	89	76.5 Å²	76.5	58%	0.578	41%	0.41	S	S	*	.			trans	-50.4	-29.1	175	-26.7	35.9	0	0	0	112.8	T37 Y81	P35-T37 HydrophobicContact CB-CG2 4.2Å; P35-T37 PolarHBondContact O-N 2.52Å; P35-Y81 WeakPolarHBondContact O-CE1 3.31Å
36	G	90.6	Very high	86.2	Confident	3 Å²	3	74.1 Å²	74.1	3%	0.031	40%	0.402	C	S	.	.			trans	66.5	26.2	171.8	0	0	0	0	0	112.1	A34 S40 Y81 W82	A34-G36 PolarHBondContact O-N 2.87Å; G36-S40 CarbonylContact C-O 3.59Å; G36-S40 VanDerWaalsContact CA-O 3.3Å; G36-S40 WeakPolarHBondContact CA-O 3.17Å; G36-S40 PolarHBondContact N-O 3.41Å; G36-Y81 CarbonylContact O-C 3.59Å; G36-Y81 WeakPolarHBondContact O-CA 3.43Å; G36-W82 PolarHBondContact O-N 3.46Å
37	T	94.3	Very high	86.6	Confident	57 Å²	57	73.4 Å²	73.4	35%	0.35	41%	0.411	S	S	.	.			trans	-83.7	171.4	173.8	75	0	0	0	0	110.1	P35 E39 S40 P41 W82	P35-T37 HydrophobicContact CB-CG2 4.2Å; P35-T37 PolarHBondContact O-N 2.52Å; T37-E39 VanDerWaalsContact CB-OE2 3.32Å; T37-E39 WeakPolarHBondContact CB-OE2 3.28Å; T37-E39 PolarHBondContact O-N 3.49Å; T37-E39 PolarHBondContact OG1-N 3.02Å; T37-E39 PolarHBondContact OG1-OE2 3.09Å; T37-S40 PolarHBondContact N-O 3.25Å; T37-S40 VanDerWaalsContact N-O 3.13Å; T37-S40 CarbonylContact O-C 3.57Å; T37-S40 PolarHBondContact O-N 2.79Å; T37-S40 PolarHBondContact OG1-N 2.95Å; T37-S40 VanDerWaalsContact OG1-N 3.07Å; T37-P41 WeakPolarHBondContact O-CA 3.3Å; T37-P41 VanDerWaalsContact O-N 3.09Å; T37-W82 WeakPolarHBondContact O-CB 3.47Å
38	T	92.4	Very high	87.1	Confident	75 Å²	75	74.7 Å²	74.7	46%	0.46	42%	0.423	S	S	.	.	S	Bend	trans	-60.9	-36.9	176.1	-46.4	0	0	0	0	111.6	W82	T38-W82 HydrophobicContact CG2-CD2 4.49Å; T38-W82 HydrophobicContact CG2-CZ2 4.45Å; T38-W82 PolarHBondContact OG1-NE1 3.49Å; T38-W82 VanDerWaalsContact OG1-NE1 3.11Å
39	E	93.9	Very high	87.9	Confident	163 Å²	163	72.7 Å²	72.7	76%	0.762	41%	0.409	S	S	*	.	S	Bend	trans	-80	-26.6	178.5	-47.6	80.7	-171.3	0	0	112.8	T37	T37-E39 VanDerWaalsContact CB-OE2 3.32Å; T37-E39 WeakPolarHBondContact CB-OE2 3.28Å; T37-E39 PolarHBondContact O-N 3.49Å; T37-E39 PolarHBondContact OG1-N 3.02Å; T37-E39 PolarHBondContact OG1-OE2 3.09Å
40	S	92.9	Very high	88.8	Confident	52 Å²	52	71.2 Å²	71.2	36%	0.364	41%	0.408	S	S	.	.	S	Bend	trans	-131.4	70.2	-179.8	-163.5	0	0	0	0	110.7	G36 T37	G36-S40 CarbonylContact C-O 3.59Å; G36-S40 VanDerWaalsContact CA-O 3.3Å; G36-S40 WeakPolarHBondContact CA-O 3.17Å; G36-S40 PolarHBondContact N-O 3.41Å; T37-S40 PolarHBondContact N-O 3.25Å; T37-S40 VanDerWaalsContact N-O 3.13Å; T37-S40 CarbonylContact O-C 3.57Å; T37-S40 PolarHBondContact O-N 2.79Å; T37-S40 PolarHBondContact OG1-N 2.95Å; T37-S40 VanDerWaalsContact OG1-N 3.07Å
41	P	94.5	Very high	89.6	Confident	13 Å²	13	68.6 Å²	68.6	8%	0.084	39%	0.388	C	S	.	.			trans	-71.7	161.5	-178	31.3	-36.6	0	0	0	111.5	T37 V43 W82 Q84	T37-P41 WeakPolarHBondContact O-CA 3.3Å; T37-P41 VanDerWaalsContact O-N 3.09Å; P41-V43 PolarHBondContact O-N 3.49Å; P41-W82 HydrophobicContact CB-CB 3.89Å; P41-Q84 HydrophobicContact CB-CB 4.16Å; P41-Q84 HydrophobicContact CG-CB 3.85Å
42	N	93.5	Very high	90.3	Very high	11 Å²	11	69 Å²	69	6%	0.059	40%	0.397	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-68	110	167.4	-66.6	-73.2	0	0	0	109.7	Q33 A34 W82 F83 Q84	Q33-N42 VanDerWaalsContact CA-OD1 3.25Å; Q33-N42 WeakPolarHBondContact CA-OD1 3.09Å; A34-N42 PolarHBondContact N-OD1 2.8Å; N42-W82 WeakPolarHBondContact CB-O 3.26Å; N42-W82 PolarHBondContact N-O 2.93Å; N42-W82 PolarHBondContact ND2-O 2.63Å; N42-F83 HydrophobicContact CB-CD1 3.49Å; N42-F83 VanDerWaalsContact CB-CD1 3.49Å; N42-F83 HydrophobicContact CB-CE1 3.71Å; N42-F83 HydrophobicContact CB-CG 4.07Å; N42-F83 HydrophobicContact CB-CZ 4.45Å; N42-F83 CarbonylContact O-C 3.57Å; N42-F83 VanDerWaalsContact O-CA 3.28Å; N42-F83 WeakPolarHBondContact O-CA 3.41Å; N42-Q84 PolarHBondContact O-N 3.48Å
43	V	91.6	Very high	91.2	Very high	87 Å²	87	63 Å²	63	53%	0.527	36%	0.36	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.7	123.2	-179.2	-180	0	0	0	0	109.8	P41 V86	P41-V43 PolarHBondContact O-N 3.49Å; V43-V86 HydrophobicContact CG1-CB 4.31Å; V43-V86 HydrophobicContact CG1-CG1 3.85Å; V43-V86 HydrophobicContact CG1-CG2 3.46Å; V43-V86 VanDerWaalsContact CG1-CG2 3.46Å
44	I	90.7	Very high	92	Very high	29 Å²	29	61.6 Å²	61.6	15%	0.149	36%	0.364	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.6	127.7	177.6	-51.9	-62.7	0	0	0	107.8	V53 L69 F83 Q84 L85 V86	I44-V53 HydrophobicContact CG1-CG2 4.19Å; I44-V53 HydrophobicContact CG2-CG2 3.98Å; I44-L69 HydrophobicContact CB-CD1 4.07Å; I44-L69 HydrophobicContact CG1-CD1 3.82Å; I44-F83 HydrophobicContact CD1-CD1 4.43Å; I44-F83 HydrophobicContact CG1-CD1 4.26Å; I44-Q84 PolarHBondContact N-O 3Å; I44-L85 HydrophobicContact CB-CD1 4.09Å; I44-L85 HydrophobicContact CG2-CD1 3.93Å; I44-L85 CarbonylContact O-C 3.26Å; I44-L85 WeakPolarHBondContact O-CA 3.47Å; I44-L85 WeakPolarHBondContact O-CD1 3.23Å; I44-V86 PolarHBondContact O-N 3.04Å
45	V	89.2	Confident	92.7	Very high	43 Å²	43	59.8 Å²	59.8	26%	0.261	35%	0.349	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.4	146.2	178.3	-66.4	0	0	0	0	111.4	R25 R51 V86 D88	R25-V45 HydrophobicContact CG-CG2 3.69Å; V45-R51 PolarHBondContact O-NH1 3.29Å; V45-V86 CarbonylContact C-O 3.56Å; V45-V86 WeakPolarHBondContact CA-O 3.35Å; V45-V86 HydrophobicContact CB-CG2 4.46Å; V45-V86 HydrophobicContact CG1-CG2 3.76Å; V45-D88 HydrophobicContact CB-CB 4.33Å
46	S	90.4	Very high	92.9	Very high	10 Å²	10	58.6 Å²	58.6	7%	0.07	34%	0.337	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-159.6	137.6	171.9	-171.5	0	0	0	0	112.9	V48 K71 V86 D88	S46-V48 PolarHBondContact O-N 3.25Å; S46-V48 VanDerWaalsContact OG-CG2 3.26Å; S46-V48 WeakPolarHBondContact OG-CG2 3.45Å; S46-V48 PolarHBondContact OG-N 2.85Å; S46-V48 PolarHBondContact OG-O 2.78Å; S46-K71 WeakPolarHBondContact O-CE 3.41Å; S46-K71 PolarHBondContact O-NZ 3.12Å; S46-V86 PolarHBondContact N-O 2.99Å; S46-D88 PolarHBondContact O-N 2.92Å
47	S	89.2	Confident	92.9	Very high	81 Å²	81	59.8 Å²	59.8	57%	0.566	35%	0.345	S	S	*	.	S	Bend	trans	-74	-10.5	172.8	-11.7	0	0	0	0	113.5	D88	S47-D88 VanDerWaalsContact CA-CG 3.49Å; S47-D88 WeakPolarHBondContact CA-OD1 3.49Å; S47-D88 VanDerWaalsContact CB-CG 3.46Å; S47-D88 VanDerWaalsContact CB-OD1 3.31Å; S47-D88 WeakPolarHBondContact CB-OD1 3.48Å; S47-D88 WeakPolarHBondContact CB-OD2 3.08Å; S47-D88 PolarHBondContact OG-OD2 3.05Å
48	V	92.2	Very high	92.7	Very high	87 Å²	87	59.6 Å²	59.6	53%	0.527	35%	0.346	S	S	.	.	S	Bend	trans	-117.2	165.1	-179.1	-67.4	0	0	0	0	111	S46 Q50 K71	S46-V48 PolarHBondContact O-N 3.25Å; S46-V48 VanDerWaalsContact OG-CG2 3.26Å; S46-V48 WeakPolarHBondContact OG-CG2 3.45Å; S46-V48 PolarHBondContact OG-N 2.85Å; S46-V48 PolarHBondContact OG-O 2.78Å; V48-Q50 WeakPolarHBondContact CG2-O 3.04Å; V48-Q50 PolarHBondContact O-N 3.03Å; V48-K71 WeakPolarHBondContact O-CE 3.28Å; V48-K71 PolarHBondContact O-NZ 3.27Å
49	S	94.9	Very high	92.3	Very high	83 Å²	83	62.4 Å²	62.4	58%	0.58	37%	0.365	S	S	*	.	S	Bend	trans	-67.3	-20.9	-175.3	55.2	0	0	0	0	114.3	K71	S49-K71 PolarHBondContact O-N 3.44Å
50	Q	96.7	Very high	92.1	Very high	101 Å²	101	61.9 Å²	61.9	47%	0.472	37%	0.368	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-140	141.5	-176.6	-58.5	-171.6	-24.3	0	0	112	V48 V68 L69 E70	V48-Q50 WeakPolarHBondContact CG2-O 3.04Å; V48-Q50 PolarHBondContact O-N 3.03Å; Q50-V68 HydrophobicContact CB-CG1 4.02Å; Q50-V68 HydrophobicContact CG-CG1 4.47Å; Q50-L69 WeakPolarHBondContact CA-O 3.43Å; Q50-E70 HydrophobicContact CG-CG 4.03Å
51	R	94.2	Very high	91.9	Very high	92 Å²	92	61.4 Å²	61.4	35%	0.347	36%	0.36	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.8	137.8	176.8	-171.3	172.3	178.4	165.4	3.4	111	V45 L69 L85	V45-R51 PolarHBondContact O-NH1 3.29Å; R51-L69 PolarHBondContact N-O 3.39Å; R51-L69 VanDerWaalsContact N-O 3.09Å; R51-L69 PolarHBondContact O-N 3.09Å; R51-L85 HydrophobicContact CB-CD1 3.72Å; R51-L85 HydrophobicContact CB-CD2 4.19Å
52	I	95.3	Very high	91.7	Very high	120 Å²	120	65.9 Å²	65.9	62%	0.615	40%	0.398	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-78.4	129.6	170.1	-60.6	172.8	0	0	0	108.5	Y66 M67 V68	I52-Y66 HydrophobicContact CG2-CD1 3.91Å; I52-M67 WeakPolarHBondContact CA-O 3.33Å; I52-V68 HydrophobicContact CG1-CG2 4.38Å
53	V	93.3	Very high	91.6	Very high	17 Å²	17	71 Å²	71	10%	0.103	42%	0.421	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.3	136.8	174.6	173.2	0	0	0	0	109.1	I44 Y66 M67 L69 F83	I44-V53 HydrophobicContact CG1-CG2 4.19Å; I44-V53 HydrophobicContact CG2-CG2 3.98Å; V53-Y66 CarbonylContact O-C 3.59Å; V53-Y66 VanDerWaalsContact O-CA 3.32Å; V53-Y66 WeakPolarHBondContact O-CA 3.22Å; V53-M67 HydrophobicContact CB-CE 4.42Å; V53-M67 HydrophobicContact CG1-CE 4.16Å; V53-M67 PolarHBondContact N-O 2.96Å; V53-M67 PolarHBondContact O-N 3.02Å; V53-L69 HydrophobicContact CB-CD1 4.24Å; V53-L69 HydrophobicContact CB-CG 4.38Å; V53-L69 HydrophobicContact CG2-CD1 3.56Å; V53-L69 HydrophobicContact CG2-CG 3.99Å; V53-F83 HydrophobicContact CG1-CD1 4.28Å; V53-F83 HydrophobicContact CG1-CE1 4.25Å
54	G	94	Very high	91.7	Very high	39 Å²	39	68.1 Å²	68.1	40%	0.402	41%	0.406	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.3	120.8	169.7	0	0	0	0	0	110.3
55	C	94.2	Very high	91.9	Very high	3 Å²	3	70.2 Å²	70.2	2%	0.02	42%	0.415	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99	125.7	173	179.1	0	0	0	0	109.7	A64 K65 C77 F83	C55-A64 WeakPolarHBondContact O-CA 3.43Å; C55-K65 PolarHBondContact N-O 3.39Å; C55-K65 PolarHBondContact O-N 3.38Å; C55-C77 HydrophobicContact CB-CB 4.28Å; C55-C77 VanDerWaalsContact CB-SG 3.59Å; C55-F83 HydrophobicContact CB-CZ 4.01Å
56	L	92.7	Very high	92.2	Very high	64 Å²	64	76.5 Å²	76.5	34%	0.335	44%	0.435	S	S	.	.			trans	-86.9	107.4	163.7	-64.5	170.6	0	0	0	106.9	I30 Q33 S58 A64	I30-L56 HydrophobicContact CD1-CD1 4.38Å; Q33-L56 PolarHBondContact NE2-O 3.46Å; Q33-L56 VanDerWaalsContact NE2-O 3.16Å; L56-S58 VanDerWaalsContact C-N 3.28Å; L56-S58 PolarHBondContact O-N 2.97Å; L56-A64 HydrophobicContact CD2-CB 4.05Å
57	C	91.8	Very high	92.5	Very high	29 Å²	29	77 Å²	77	20%	0.196	44%	0.436	C	S	.	.	S	Bend	trans	-75	-23.1	-172.8	-61.7	0	0	0	0	112.5	E61 K65 C77 C79	C57-E61 WeakPolarHBondContact CA-OE2 3.31Å; C57-E61 WeakPolarHBondContact CB-OE2 3.17Å; C57-E61 PolarHBondContact N-OE2 3.2Å; C57-K65 VanDerWaalsContact SG-CD 3.58Å; C57-C77 VanDerWaalsContact SG-SG 3.7Å; C57-C79 HydrophobicContact CB-CB 3.6Å; C57-C79 VanDerWaalsContact SG-CB 3.54Å; C57-C79 VanDerWaalsContact SG-SG 3.67Å
58	S	88.6	Confident	92.9	Very high	53 Å²	53	76 Å²	76	37%	0.371	43%	0.426	S	S	.	.	S	Bend	trans	-137.2	147.1	174.2	171.9	0	0	0	0	109.7	L56 N60 E61	L56-S58 VanDerWaalsContact C-N 3.28Å; L56-S58 PolarHBondContact O-N 2.97Å; S58-N60 PolarHBondContact O-N 3.03Å; S58-N60 PolarHBondContact OG-N 2.93Å; S58-E61 PolarHBondContact N-OE2 3.38Å; S58-E61 WeakPolarHBondContact O-CB 3.2Å; S58-E61 PolarHBondContact O-N 3.25Å
59	P	85.3	Confident	93.2	Very high	133 Å²	133	71.8 Å²	71.8	86%	0.864	40%	0.401	S	S	*	.	T	Hydrogen-bonded Turn	trans	-55	-23.8	173.9	-25.6	34.4	0	0	0	114.2
60	N	88.7	Confident	93.3	Very high	153 Å²	153	71 Å²	71	82%	0.818	39%	0.389	S	S	*	.	T	Hydrogen-bonded Turn	trans	-98.8	2.5	-178	-63.2	-19.6	0	0	0	113.2	S58	S58-N60 PolarHBondContact O-N 3.03Å; S58-N60 PolarHBondContact OG-N 2.93Å
61	E	89	Confident	93.2	Very high	42 Å²	42	69.1 Å²	69.1	20%	0.196	38%	0.379	C	S	.	.			trans	-81.1	125.1	-179.5	-159.4	170	-158	0	0	110.2	C57 S58 H63 K65	C57-E61 WeakPolarHBondContact CA-OE2 3.31Å; C57-E61 WeakPolarHBondContact CB-OE2 3.17Å; C57-E61 PolarHBondContact N-OE2 3.2Å; S58-E61 PolarHBondContact N-OE2 3.38Å; S58-E61 WeakPolarHBondContact O-CB 3.2Å; S58-E61 PolarHBondContact O-N 3.25Å; E61-H63 VanDerWaalsContact C-N 3.27Å; E61-H63 PolarHBondContact O-N 3Å; E61-H63 IonicContact OE1-CD2 3.84Å; E61-H63 IonicContact OE1-CE1 3.83Å; E61-H63 IonicContact OE1-NE2 3.3Å; E61-H63 PolarHBondContact OE1-NE2 3.36Å; E61-K65 WeakPolarHBondContact OE1-CE 3.44Å; E61-K65 IonicContact OE1-NZ 3.69Å
62	A	90.4	Very high	93.1	Very high	106 Å²	106	68.3 Å²	68.3	88%	0.876	40%	0.399	S	S	*	.	S	Bend	trans	-80.2	-8	-178.8	0	0	0	0	0	113.7
63	H	91.9	Very high	93.1	Very high	119 Å²	119	68.5 Å²	68.5	55%	0.551	40%	0.395	S	S	*	.	S	Bend	trans	-129.2	131.9	-175.5	55.2	-86.2	0	0	0	111	E61	E61-H63 VanDerWaalsContact C-N 3.27Å; E61-H63 PolarHBondContact O-N 3Å; E61-H63 IonicContact OE1-CD2 3.84Å; E61-H63 IonicContact OE1-CE1 3.83Å; E61-H63 IonicContact OE1-NE2 3.3Å; E61-H63 PolarHBondContact OE1-NE2 3.36Å
64	A	93.1	Very high	93.2	Very high	26 Å²	26	70.7 Å²	70.7	22%	0.215	41%	0.407	C	S	.	.			trans	-80.9	139.7	172.5	0	0	0	0	0	110.6	C55 L56 Y66	C55-A64 WeakPolarHBondContact O-CA 3.43Å; L56-A64 HydrophobicContact CD2-CB 4.05Å; A64-Y66 HydrophobicContact CB-CE1 4.48Å; A64-Y66 HydrophobicContact CB-CE2 4.01Å; A64-Y66 WeakPolarHBondContact O-CD2 3.42Å; A64-Y66 WeakPolarHBondContact O-CE2 3.49Å
65	K	94.6	Very high	93.3	Very high	74 Å²	74	72.9 Å²	72.9	32%	0.322	41%	0.405	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.3	112.6	168.8	-62.6	-175.7	-166.3	161.6	0	108.5	C55 C57 E61 A78	C55-K65 PolarHBondContact N-O 3.39Å; C55-K65 PolarHBondContact O-N 3.38Å; C57-K65 VanDerWaalsContact SG-CD 3.58Å; E61-K65 WeakPolarHBondContact OE1-CE 3.44Å; E61-K65 IonicContact OE1-NZ 3.69Å; K65-A78 HydrophobicContact CD-CB 3.94Å
66	Y	96.3	Very high	93.5	Very high	174 Å²	174	77.5 Å²	77.5	68%	0.682	43%	0.426	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-87.1	140.7	-178.3	-67.1	-82.2	0	0	0	111.8	I52 V53 A64	I52-Y66 HydrophobicContact CG2-CD1 3.91Å; V53-Y66 CarbonylContact O-C 3.59Å; V53-Y66 VanDerWaalsContact O-CA 3.32Å; V53-Y66 WeakPolarHBondContact O-CA 3.22Å; A64-Y66 HydrophobicContact CB-CE1 4.48Å; A64-Y66 HydrophobicContact CB-CE2 4.01Å; A64-Y66 WeakPolarHBondContact O-CD2 3.42Å; A64-Y66 WeakPolarHBondContact O-CE2 3.49Å
67	M	96.8	Very high	93.6	Very high	20 Å²	20	74.9 Å²	74.9	10%	0.099	41%	0.413	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-146.9	147.9	174.2	58.3	-174.6	176.8	0	0	110.6	I52 V53 L69 K75 C77 F83	I52-M67 WeakPolarHBondContact CA-O 3.33Å; V53-M67 HydrophobicContact CB-CE 4.42Å; V53-M67 HydrophobicContact CG1-CE 4.16Å; V53-M67 PolarHBondContact N-O 2.96Å; V53-M67 PolarHBondContact O-N 3.02Å; M67-L69 HydrophobicContact CE-CD2 3.97Å; M67-L69 HydrophobicContact CG-CD2 4.21Å; M67-L69 HydrophobicContact SD-CD2 4.12Å; M67-K75 HydrophobicContact CB-CD 4.25Å; M67-K75 HydrophobicContact SD-CD 4.28Å; M67-K75 HydrophobicContact SD-CG 4.37Å; M67-C77 HydrophobicContact CE-CB 4.42Å; M67-C77 HydrophobicContact SD-CB 4.35Å; M67-F83 HydrophobicContact CE-CB 3.95Å; M67-F83 HydrophobicContact CE-CD1 3.78Å; M67-F83 HydrophobicContact CE-CD2 3.14Å; M67-F83 HydrophobicContact CE-CE1 4.04Å; M67-F83 HydrophobicContact CE-CE2 3.47Å; M67-F83 VanDerWaalsContact CE-CE2 3.47Å; M67-F83 HydrophobicContact CE-CG 3.34Å; M67-F83 HydrophobicContact CE-CZ 3.91Å; M67-F83 HydrophobicContact SD-CD2 4.38Å
68	V	97.6	Very high	93.7	Very high	60 Å²	60	77.7 Å²	77.7	36%	0.364	44%	0.439	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.2	122.3	168.3	-175.9	0	0	0	0	108.4	Q50 I52 K75	Q50-V68 HydrophobicContact CB-CG1 4.02Å; Q50-V68 HydrophobicContact CG-CG1 4.47Å; I52-V68 HydrophobicContact CG1-CG2 4.38Å; V68-K75 WeakPolarHBondContact O-CD 3.37Å; V68-K75 PolarHBondContact O-NZ 3.17Å
69	L	96.8	Very high	93.9	Very high	0 Å²	0	77.6 Å²	77.6	0%	0	44%	0.437	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.2	146.7	167.8	-55.6	-175.6	0	0	0	109.6	I44 Q50 R51 V53 M67 K75 F83 L85	I44-L69 HydrophobicContact CB-CD1 4.07Å; I44-L69 HydrophobicContact CG1-CD1 3.82Å; Q50-L69 WeakPolarHBondContact CA-O 3.43Å; R51-L69 PolarHBondContact N-O 3.39Å; R51-L69 VanDerWaalsContact N-O 3.09Å; R51-L69 PolarHBondContact O-N 3.09Å; V53-L69 HydrophobicContact CB-CD1 4.24Å; V53-L69 HydrophobicContact CB-CG 4.38Å; V53-L69 HydrophobicContact CG2-CD1 3.56Å; V53-L69 HydrophobicContact CG2-CG 3.99Å; M67-L69 HydrophobicContact CE-CD2 3.97Å; M67-L69 HydrophobicContact CG-CD2 4.21Å; M67-L69 HydrophobicContact SD-CD2 4.12Å; L69-K75 HydrophobicContact CD2-CB 3.68Å; L69-K75 HydrophobicContact CD2-CD 4.05Å; L69-K75 HydrophobicContact CD2-CG 4.39Å; L69-F83 HydrophobicContact CD1-CB 3.83Å; L69-F83 HydrophobicContact CD2-CB 3.86Å; L69-L85 HydrophobicContact CB-CB 3.93Å; L69-L85 HydrophobicContact CB-CD1 4.31Å; L69-L85 HydrophobicContact CB-CD2 4.26Å; L69-L85 HydrophobicContact CB-CG 4.42Å; L69-L85 HydrophobicContact CD1-CD1 4.47Å
70	E	97.4	Very high	94.4	Very high	67 Å²	67	72.7 Å²	72.7	31%	0.313	41%	0.411	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.3	138.5	176.9	-64.2	176.2	-154.8	0	0	109	Q50 G72 K73	Q50-E70 HydrophobicContact CG-CG 4.03Å; E70-G72 PolarHBondContact O-N 3.46Å; E70-K73 HydrophobicContact CB-CD 4.47Å; E70-K73 PolarHBondContact O-N 3.11Å; E70-K73 IonicContact OE2-NZ 3.84Å; E70-K73 PolarHBondContact OE2-NZ 2.84Å
71	K	94.6	Very high	94.7	Very high	61 Å²	61	69.3 Å²	69.3	27%	0.265	39%	0.387	S	S	.	.	B	Isolated β-bridge	trans	-56.3	135.4	174.6	-73.8	-175.5	174	172.4	0	110.1	S46 V48 S49 K73 L85 D87	S46-K71 WeakPolarHBondContact O-CE 3.41Å; S46-K71 PolarHBondContact O-NZ 3.12Å; V48-K71 WeakPolarHBondContact O-CE 3.28Å; V48-K71 PolarHBondContact O-NZ 3.27Å; S49-K71 PolarHBondContact O-N 3.44Å; K71-K73 VanDerWaalsContact C-N 3.32Å; K71-K73 PolarHBondContact O-N 3.35Å; K71-L85 HydrophobicContact CG-CD2 3.94Å; K71-L85 HydrophobicContact CG-CG 4.12Å; K71-D87 IonicContact NZ-OD1 3.66Å; K71-D87 PolarHBondContact NZ-OD1 3.38Å; K71-D87 IonicContact NZ-OD2 2.77Å; K71-D87 PolarHBondContact NZ-OD2 3.08Å
72	G	93.4	Very high	95	Very high	75 Å²	75	70.2 Å²	70.2	77%	0.773	39%	0.389	S	S	*	.	T	Hydrogen-bonded Turn	trans	81.8	-1.5	179.4	0	0	0	0	0	115.9	E70	E70-G72 PolarHBondContact O-N 3.46Å
73	K	95.2	Very high	95.3	Very high	123 Å²	123	65.6 Å²	65.6	54%	0.535	35%	0.349	S	S	.	.	B	Isolated β-bridge	trans	-124.5	121.3	175.7	-64.4	178.6	-170.5	161.3	0	110.8	E70 K71	E70-K73 HydrophobicContact CB-CD 4.47Å; E70-K73 PolarHBondContact O-N 3.11Å; E70-K73 IonicContact OE2-NZ 3.84Å; E70-K73 PolarHBondContact OE2-NZ 2.84Å; K71-K73 VanDerWaalsContact C-N 3.32Å; K71-K73 PolarHBondContact O-N 3.35Å
74	N	95.1	Very high	95.4	Very high	64 Å²	64	63 Å²	63	34%	0.342	34%	0.337	S	S	.	.			trans	-74.3	140.9	169	-69.2	2.2	0	0	0	109.4	W82 F83 Q84	N74-W82 HydrophobicContact CB-CE3 3.97Å; N74-W82 HydrophobicContact CB-CZ3 4.27Å; N74-F83 CarbonylContact C-O 3.14Å; N74-F83 VanDerWaalsContact CA-O 3.3Å; N74-F83 WeakPolarHBondContact CA-O 3.42Å; N74-Q84 VanDerWaalsContact OD1-CB 3.3Å; N74-Q84 WeakPolarHBondContact OD1-CB 3.44Å; N74-Q84 WeakPolarHBondContact OD1-CG 3.1Å
75	K	96.9	Very high	95.5	Very high	85 Å²	85	62 Å²	62	37%	0.37	33%	0.328	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.1	139.4	-179.3	-164.7	172.9	-169.2	170.3	0	110.4	M67 V68 L69 W82 F83	M67-K75 HydrophobicContact CB-CD 4.25Å; M67-K75 HydrophobicContact SD-CD 4.28Å; M67-K75 HydrophobicContact SD-CG 4.37Å; V68-K75 WeakPolarHBondContact O-CD 3.37Å; V68-K75 PolarHBondContact O-NZ 3.17Å; L69-K75 HydrophobicContact CD2-CB 3.68Å; L69-K75 HydrophobicContact CD2-CD 4.05Å; L69-K75 HydrophobicContact CD2-CG 4.39Å; K75-W82 CarbonylContact O-C 3.57Å; K75-W82 WeakPolarHBondContact O-CA 3.47Å; K75-F83 PolarHBondContact N-O 3.5Å; K75-F83 PolarHBondContact O-N 3.43Å
76	Q	96.5	Very high	95.4	Very high	99 Å²	99	60.5 Å²	60.5	46%	0.463	33%	0.325	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.3	137.5	178.2	-157.2	-177.3	30.3	0	0	110.6	G80 Y81 W82	Q76-G80 WeakPolarHBondContact CG-O 3.33Å; Q76-G80 VanDerWaalsContact NE2-CA 3.34Å; Q76-G80 PolarHBondContact NE2-O 3.09Å; Q76-Y81 CarbonylContact C-O 3.57Å; Q76-Y81 WeakPolarHBondContact CA-O 3.5Å; Q76-W82 HydrophobicContact CB-CD2 4.04Å; Q76-W82 HydrophobicContact CB-CE3 4.11Å; Q76-W82 HydrophobicContact CB-CH2 4.28Å; Q76-W82 HydrophobicContact CB-CZ2 4.18Å; Q76-W82 HydrophobicContact CB-CZ3 4.24Å; Q76-W82 HydrophobicContact CG-CD2 4.07Å; Q76-W82 HydrophobicContact CG-CG 4.31Å; Q76-W82 HydrophobicContact CG-CZ2 4.23Å
77	C	96.5	Very high	95.2	Very high	10 Å²	10	56.3 Å²	56.3	7%	0.068	31%	0.314	C	S	.	.			trans	-80.4	162.1	166.6	-172	0	0	0	0	110.5	C55 C57 M67 C79 G80 Y81 F83	C55-C77 HydrophobicContact CB-CB 4.28Å; C55-C77 VanDerWaalsContact CB-SG 3.59Å; C57-C77 VanDerWaalsContact SG-SG 3.7Å; M67-C77 HydrophobicContact CE-CB 4.42Å; M67-C77 HydrophobicContact SD-CB 4.35Å; C77-C79 PolarHBondContact O-N 3.35Å; C77-G80 PolarHBondContact O-N 3Å; C77-Y81 PolarHBondContact N-O 3.42Å; C77-F83 HydrophobicContact CB-CD2 4.47Å; C77-F83 HydrophobicContact CB-CE2 3.79Å
78	A	92.5	Very high	94.5	Very high	88 Å²	88	57 Å²	57	73%	0.727	32%	0.318	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.9	-16.8	177.7	0	0	0	0	0	114.5	K65 G80	K65-A78 HydrophobicContact CD-CB 3.94Å; A78-G80 VanDerWaalsContact C-N 3.33Å
79	C	93.8	Very high	93.2	Very high	51 Å²	51	60.3 Å²	60.3	35%	0.345	33%	0.334	S	S	.	.	T	Hydrogen-bonded Turn	trans	-82.4	-7.4	172.6	58.6	0	0	0	0	114.6	C57 C77 Y81	C57-C79 HydrophobicContact CB-CB 3.6Å; C57-C79 VanDerWaalsContact SG-CB 3.54Å; C57-C79 VanDerWaalsContact SG-SG 3.67Å; C77-C79 PolarHBondContact O-N 3.35Å; C79-Y81 WeakPolarHBondContact SG-CD2 3.48Å
80	G	94.7	Very high	90.8	Very high	29 Å²	29	63.8 Å²	63.8	30%	0.299	36%	0.357	S	S	.	.	S	Bend	trans	99	-12.3	-178.2	0	0	0	0	0	114.8	Q76 C77 A78	Q76-G80 WeakPolarHBondContact CG-O 3.33Å; Q76-G80 VanDerWaalsContact NE2-CA 3.34Å; Q76-G80 PolarHBondContact NE2-O 3.09Å; C77-G80 PolarHBondContact O-N 3Å; A78-G80 VanDerWaalsContact C-N 3.33Å
81	Y	94.7	Very high	87.9	Confident	83 Å²	83	69.2 Å²	69.2	33%	0.325	38%	0.382	S	S	.	.			trans	-69.6	137.8	176.8	-70.2	-50.9	0	0	0	112.6	Q33 P35 G36 Q76 C77 C79 F83	Q33-Y81 VanDerWaalsContact OE1-CD2 3.25Å; P35-Y81 WeakPolarHBondContact O-CE1 3.31Å; G36-Y81 CarbonylContact O-C 3.59Å; G36-Y81 WeakPolarHBondContact O-CA 3.43Å; Q76-Y81 CarbonylContact C-O 3.57Å; Q76-Y81 WeakPolarHBondContact CA-O 3.5Å; C77-Y81 PolarHBondContact N-O 3.42Å; C79-Y81 WeakPolarHBondContact SG-CD2 3.48Å; Y81-F83 WeakPolarHBondContact O-CD2 3.32Å; Y81-F83 WeakPolarHBondContact O-CE2 3.4Å
82	W	96.3	Very high	85	Confident	61 Å²	61	71.7 Å²	71.7	23%	0.231	40%	0.404	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.3	148.7	177.3	-69.2	84.5	0	0	0	111.7	G36 T37 T38 P41 N42 N74 K75 Q76	G36-W82 PolarHBondContact O-N 3.46Å; T37-W82 WeakPolarHBondContact O-CB 3.47Å; T38-W82 HydrophobicContact CG2-CD2 4.49Å; T38-W82 HydrophobicContact CG2-CZ2 4.45Å; T38-W82 PolarHBondContact OG1-NE1 3.49Å; T38-W82 VanDerWaalsContact OG1-NE1 3.11Å; P41-W82 HydrophobicContact CB-CB 3.89Å; N42-W82 WeakPolarHBondContact CB-O 3.26Å; N42-W82 PolarHBondContact N-O 2.93Å; N42-W82 PolarHBondContact ND2-O 2.63Å; N74-W82 HydrophobicContact CB-CE3 3.97Å; N74-W82 HydrophobicContact CB-CZ3 4.27Å; K75-W82 CarbonylContact O-C 3.57Å; K75-W82 WeakPolarHBondContact O-CA 3.47Å; Q76-W82 HydrophobicContact CB-CD2 4.04Å; Q76-W82 HydrophobicContact CB-CE3 4.11Å; Q76-W82 HydrophobicContact CB-CH2 4.28Å; Q76-W82 HydrophobicContact CB-CZ2 4.18Å; Q76-W82 HydrophobicContact CB-CZ3 4.24Å; Q76-W82 HydrophobicContact CG-CD2 4.07Å; Q76-W82 HydrophobicContact CG-CG 4.31Å; Q76-W82 HydrophobicContact CG-CZ2 4.23Å
83	F	96.1	Very high	82.5	Confident	8 Å²	8	80.3 Å²	80.3	4%	0.035	42%	0.421	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.6	141.4	-178.8	-62.9	-102.9	0	0	0	109.7	N42 I44 V53 C55 M67 L69 N74 K75 C77 Y81	N42-F83 HydrophobicContact CB-CD1 3.49Å; N42-F83 VanDerWaalsContact CB-CD1 3.49Å; N42-F83 HydrophobicContact CB-CE1 3.71Å; N42-F83 HydrophobicContact CB-CG 4.07Å; N42-F83 HydrophobicContact CB-CZ 4.45Å; N42-F83 CarbonylContact O-C 3.57Å; N42-F83 VanDerWaalsContact O-CA 3.28Å; N42-F83 WeakPolarHBondContact O-CA 3.41Å; I44-F83 HydrophobicContact CD1-CD1 4.43Å; I44-F83 HydrophobicContact CG1-CD1 4.26Å; V53-F83 HydrophobicContact CG1-CD1 4.28Å; V53-F83 HydrophobicContact CG1-CE1 4.25Å; C55-F83 HydrophobicContact CB-CZ 4.01Å; M67-F83 HydrophobicContact CE-CB 3.95Å; M67-F83 HydrophobicContact CE-CD1 3.78Å; M67-F83 HydrophobicContact CE-CD2 3.14Å; M67-F83 HydrophobicContact CE-CE1 4.04Å; M67-F83 HydrophobicContact CE-CE2 3.47Å; M67-F83 VanDerWaalsContact CE-CE2 3.47Å; M67-F83 HydrophobicContact CE-CG 3.34Å; M67-F83 HydrophobicContact CE-CZ 3.91Å; M67-F83 HydrophobicContact SD-CD2 4.38Å; L69-F83 HydrophobicContact CD1-CB 3.83Å; L69-F83 HydrophobicContact CD2-CB 3.86Å; N74-F83 CarbonylContact C-O 3.14Å; N74-F83 VanDerWaalsContact CA-O 3.3Å; N74-F83 WeakPolarHBondContact CA-O 3.42Å; K75-F83 PolarHBondContact N-O 3.5Å; K75-F83 PolarHBondContact O-N 3.43Å; C77-F83 HydrophobicContact CB-CD2 4.47Å; C77-F83 HydrophobicContact CB-CE2 3.79Å; Y81-F83 WeakPolarHBondContact O-CD2 3.32Å; Y81-F83 WeakPolarHBondContact O-CE2 3.4Å
84	Q	94.8	Very high	81.8	Confident	65 Å²	65	78.2 Å²	78.2	30%	0.304	42%	0.415	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.1	129.4	178.2	-178.1	172.5	16	0	0	109.3	P41 N42 I44 N74 V86	P41-Q84 HydrophobicContact CB-CB 4.16Å; P41-Q84 HydrophobicContact CG-CB 3.85Å; N42-Q84 PolarHBondContact O-N 3.48Å; I44-Q84 PolarHBondContact N-O 3Å; N74-Q84 VanDerWaalsContact OD1-CB 3.3Å; N74-Q84 WeakPolarHBondContact OD1-CB 3.44Å; N74-Q84 WeakPolarHBondContact OD1-CG 3.1Å; Q84-V86 HydrophobicContact CG-CG1 4.1Å
85	L	94.6	Very high	81.1	Confident	4 Å²	4	78.9 Å²	78.9	2%	0.021	42%	0.419	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.2	119.9	172.6	-163.6	69	0	0	0	109.6	I44 R51 L69 K71	I44-L85 HydrophobicContact CB-CD1 4.09Å; I44-L85 HydrophobicContact CG2-CD1 3.93Å; I44-L85 CarbonylContact O-C 3.26Å; I44-L85 WeakPolarHBondContact O-CA 3.47Å; I44-L85 WeakPolarHBondContact O-CD1 3.23Å; R51-L85 HydrophobicContact CB-CD1 3.72Å; R51-L85 HydrophobicContact CB-CD2 4.19Å; L69-L85 HydrophobicContact CB-CB 3.93Å; L69-L85 HydrophobicContact CB-CD1 4.31Å; L69-L85 HydrophobicContact CB-CD2 4.26Å; L69-L85 HydrophobicContact CB-CG 4.42Å; L69-L85 HydrophobicContact CD1-CD1 4.47Å; K71-L85 HydrophobicContact CG-CD2 3.94Å; K71-L85 HydrophobicContact CG-CG 4.12Å
86	V	92.6	Very high	80.2	Confident	44 Å²	44	78.6 Å²	78.6	27%	0.267	42%	0.422	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.8	160.8	175.8	-58.2	0	0	0	0	110.3	V43 I44 V45 S46 Q84	V43-V86 HydrophobicContact CG1-CB 4.31Å; V43-V86 HydrophobicContact CG1-CG1 3.85Å; V43-V86 HydrophobicContact CG1-CG2 3.46Å; V43-V86 VanDerWaalsContact CG1-CG2 3.46Å; I44-V86 PolarHBondContact O-N 3.04Å; V45-V86 CarbonylContact C-O 3.56Å; V45-V86 WeakPolarHBondContact CA-O 3.35Å; V45-V86 HydrophobicContact CB-CG2 4.46Å; V45-V86 HydrophobicContact CG1-CG2 3.76Å; S46-V86 PolarHBondContact N-O 2.99Å; Q84-V86 HydrophobicContact CG-CG1 4.1Å
87	D	91.5	Very high	79.3	Confident	85 Å²	85	77.4 Å²	77.4	46%	0.455	42%	0.42	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-64.2	147.1	174.4	-135.8	-48.6	0	0	0	110.9	K71 N89	K71-D87 IonicContact NZ-OD1 3.66Å; K71-D87 PolarHBondContact NZ-OD1 3.38Å; K71-D87 IonicContact NZ-OD2 2.77Å; K71-D87 PolarHBondContact NZ-OD2 3.08Å; D87-N89 HydrophobicContact CB-CB 4.1Å; D87-N89 PolarHBondContact O-N 3.07Å
88	D	83.6	Confident	78.2	Confident	34 Å²	34	81.6 Å²	81.6	18%	0.182	44%	0.442	C	S	.	.			trans	-81.5	12.7	172.4	79.4	-28.3	0	0	0	112.2	R25 V45 S46 S47	R25-D88 PolarHBondContact NH1-O 3.38Å; V45-D88 HydrophobicContact CB-CB 4.33Å; S46-D88 PolarHBondContact O-N 2.92Å; S47-D88 VanDerWaalsContact CA-CG 3.49Å; S47-D88 WeakPolarHBondContact CA-OD1 3.49Å; S47-D88 VanDerWaalsContact CB-CG 3.46Å; S47-D88 VanDerWaalsContact CB-OD1 3.31Å; S47-D88 WeakPolarHBondContact CB-OD1 3.48Å; S47-D88 WeakPolarHBondContact CB-OD2 3.08Å; S47-D88 PolarHBondContact OG-OD2 3.05Å
89	N	69.1	Low	77.3	Confident	131 Å²	131	81.2 Å²	81.2	70%	0.701	42%	0.423	S	S	*	.	P	Polyproline II helix	trans	-51.7	116.1	-168.8	-152.3	29.7	0	0	0	109.5	D87	D87-N89 HydrophobicContact CB-CB 4.1Å; D87-N89 PolarHBondContact O-N 3.07Å
90	P	47	Very low	76.1	Confident	72 Å²	72	83.4 Å²	83.4	47%	0.468	43%	0.428	S	S	.	.	P	Polyproline II helix	trans	-71.3	142.6	-177.9	32.5	-32.9	0	0	0	106.7	P92	P90-P92 WeakPolarHBondContact O-CD 3.46Å
91	E	36.7	Very low	74.7	Confident	181 Å²	181	87.5 Å²	87.5	85%	0.846	44%	0.438	S	S	*	.	P	Polyproline II helix	trans	-50.9	122.1	149.3	-72.6	-170.8	159.9	0	0	106.2	F93	E91-F93 PolarHBondContact O-N 2.95Å
92	P	34.6	Very low	73	Confident	114 Å²	114	87.9 Å²	87.9	74%	0.74	45%	0.448	S	S	*	.	P	Polyproline II helix	trans	-67.4	131.1	173.5	29.8	-29.3	0	0	0	105.6	P90	P90-P92 WeakPolarHBondContact O-CD 3.46Å
93	F	39	Very low	70.9	Confident	256 Å²	256	90.4 Å²	90.4	100%	1.123	47%	0.467	S	S	*	.			trans	-51.1	0	159	-51.9	-83.2	0	0	0	110	E91	E91-F93 PolarHBondContact O-N 2.95Å

Retrieved 93 of 93 residues in 48.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).