A0A077Z383_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077Z383, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 60 aa.

						>A0A077Z383_TRITR|A0A077Z383
MRTLDSIVAVKLEEIDEHNGVEDCDFCRQIDCDVLFALLIITVILALLVLVVSFWIKGIA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47	Very low	59.5	Low	228 Å²	228	120.1 Å²	120.1	100%	1.123	63%	0.631	S	S	*	*				0	70.4	0	-61.7	169.6	-175.8	0	0	108.7
2	R	60.4	Low	59.4	Low	220 Å²	220	119.3 Å²	119.3	83%	0.83	63%	0.627	S	S	*	*			trans	-134.4	-5.6	179.5	-80.8	-171.6	161.4	97.8	2.8	112.7
3	T	61.7	Low	59.4	Low	98 Å²	98	122.2 Å²	122.2	60%	0.601	64%	0.635	S	S	*	*	H	α-helix	trans	-85.2	-26.6	-176.1	43.3	0	0	0	0	112.4	I7	T3-I7 VanDerWaalsContact O-CD1 3.32Å; T3-I7 WeakPolarHBondContact O-CD1 3.27Å; T3-I7 VanDerWaalsContact O-CG1 3.25Å; T3-I7 WeakPolarHBondContact O-CG1 3.17Å; T3-I7 PolarHBondContact O-N 3.48Å
4	L	61	Low	59.3	Low	123 Å²	123	123.6 Å²	123.6	64%	0.644	64%	0.637	S	S	*	*	H	α-helix	trans	-70.5	-40.4	176.1	-79	92.1	0	0	0	112.2	S6 I7 V8	L4-S6 VanDerWaalsContact C-N 3.29Å; L4-S6 PolarHBondContact O-N 2.94Å; L4-I7 PolarHBondContact O-N 3.22Å; L4-V8 WeakPolarHBondContact O-CG2 3.44Å; L4-V8 PolarHBondContact O-N 2.91Å
5	D	60.9	Low	59.1	Low	118 Å²	118	121.1 Å²	121.1	63%	0.631	62%	0.624	S	S	*	*	H	α-helix	trans	-61.6	-37.3	178.5	-63.7	-72.9	0	0	0	112.4	A9	D5-A9 VanDerWaalsContact O-CB 3.29Å; D5-A9 WeakPolarHBondContact O-CB 3.38Å; D5-A9 PolarHBondContact O-N 3.41Å
6	S	60.8	Low	58.8	Low	72 Å²	72	121.9 Å²	121.9	50%	0.503	63%	0.63	S	S	.	*	H	α-helix	trans	-68.4	-38.1	175.9	165.8	0	0	0	0	112.5	L4 V10	L4-S6 VanDerWaalsContact C-N 3.29Å; L4-S6 PolarHBondContact O-N 2.94Å; S6-V10 VanDerWaalsContact O-CG2 3.24Å; S6-V10 WeakPolarHBondContact O-CG2 3.46Å; S6-V10 PolarHBondContact O-N 3.13Å
7	I	61.9	Low	58.6	Low	107 Å²	107	125.9 Å²	125.9	55%	0.549	65%	0.645	S	S	.	*	H	α-helix	trans	-71.6	-37.3	179.3	-62.9	162	0	0	0	110.3	T3 L4 K11	T3-I7 VanDerWaalsContact O-CD1 3.32Å; T3-I7 WeakPolarHBondContact O-CD1 3.27Å; T3-I7 VanDerWaalsContact O-CG1 3.25Å; T3-I7 WeakPolarHBondContact O-CG1 3.17Å; T3-I7 PolarHBondContact O-N 3.48Å; L4-I7 PolarHBondContact O-N 3.22Å; I7-K11 VanDerWaalsContact O-CB 3.3Å; I7-K11 WeakPolarHBondContact O-CB 3.45Å; I7-K11 VanDerWaalsContact O-CG 3.24Å; I7-K11 WeakPolarHBondContact O-CG 3.13Å; I7-K11 PolarHBondContact O-N 2.9Å
8	V	61.4	Low	58.3	Low	82 Å²	82	126 Å²	126	50%	0.497	64%	0.642	S	S	.	*	H	α-helix	trans	-69.2	-40.6	175.8	175.6	0	0	0	0	111.1	L4 K11 L12	L4-V8 WeakPolarHBondContact O-CG2 3.44Å; L4-V8 PolarHBondContact O-N 2.91Å; V8-K11 PolarHBondContact O-N 3.41Å; V8-L12 HydrophobicContact CG1-CD1 3.66Å; V8-L12 WeakPolarHBondContact O-CD1 3.07Å; V8-L12 PolarHBondContact O-N 3.06Å
9	A	59.4	Low	58	Low	58 Å²	58	124.6 Å²	124.6	48%	0.479	64%	0.636	S	S	.	*	H	α-helix	trans	-64.1	-43.1	176.3	0	0	0	0	0	112.7	D5 L12 E13	D5-A9 VanDerWaalsContact O-CB 3.29Å; D5-A9 WeakPolarHBondContact O-CB 3.38Å; D5-A9 PolarHBondContact O-N 3.41Å; A9-L12 PolarHBondContact O-N 3.03Å; A9-E13 PolarHBondContact O-N 3.28Å; A9-E13 VanDerWaalsContact O-N 3.12Å
10	V	60.1	Low	57.6	Low	88 Å²	88	121.8 Å²	121.8	53%	0.533	64%	0.64	S	S	.	*	H	α-helix	trans	-67.8	-37.9	176.9	174	0	0	0	0	111.3	S6 L12 E13 E14	S6-V10 VanDerWaalsContact O-CG2 3.24Å; S6-V10 WeakPolarHBondContact O-CG2 3.46Å; S6-V10 PolarHBondContact O-N 3.13Å; V10-L12 VanDerWaalsContact C-N 3.34Å; V10-E13 PolarHBondContact O-N 3.47Å; V10-E14 PolarHBondContact O-N 3.22Å
11	K	59.2	Low	57.4	Low	127 Å²	127	122.3 Å²	122.3	55%	0.552	65%	0.647	S	S	*	*	H	α-helix	trans	-63.9	-37.3	172.9	-81.5	-83.2	-170.5	-173.3	0	112.2	I7 V8 I15	I7-K11 VanDerWaalsContact O-CB 3.3Å; I7-K11 WeakPolarHBondContact O-CB 3.45Å; I7-K11 VanDerWaalsContact O-CG 3.24Å; I7-K11 WeakPolarHBondContact O-CG 3.13Å; I7-K11 PolarHBondContact O-N 2.9Å; V8-K11 PolarHBondContact O-N 3.41Å; K11-I15 WeakPolarHBondContact O-CB 3.3Å; K11-I15 WeakPolarHBondContact O-CD1 3.24Å; K11-I15 WeakPolarHBondContact O-CG1 3.24Å; K11-I15 PolarHBondContact O-N 3.26Å
12	L	59.2	Low	57.6	Low	110 Å²	110	117.5 Å²	117.5	58%	0.576	62%	0.622	S	S	*	*	H	α-helix	trans	-69.1	-36.7	177.9	-101.8	91.9	0	0	0	112.2	V8 A9 V10 I15 D16	V8-L12 HydrophobicContact CG1-CD1 3.66Å; V8-L12 WeakPolarHBondContact O-CD1 3.07Å; V8-L12 PolarHBondContact O-N 3.06Å; A9-L12 PolarHBondContact O-N 3.03Å; V10-L12 VanDerWaalsContact C-N 3.34Å; L12-I15 PolarHBondContact O-N 3.41Å; L12-D16 PolarHBondContact O-N 2.92Å
13	E	59.5	Low	57.3	Low	158 Å²	158	113.9 Å²	113.9	74%	0.738	62%	0.619	S	S	*	*	H	α-helix	trans	-71.4	-35.2	-178.8	-155.3	158.4	99	0	0	112.2	A9 V10 I15	A9-E13 PolarHBondContact O-N 3.28Å; A9-E13 VanDerWaalsContact O-N 3.12Å; V10-E13 PolarHBondContact O-N 3.47Å; E13-I15 VanDerWaalsContact C-N 3.3Å; E13-I15 PolarHBondContact O-N 3.12Å
14	E	57.7	Low	57.2	Low	141 Å²	141	113 Å²	113	66%	0.659	62%	0.616	S	S	*	*	H	α-helix	trans	-69.3	-25.4	169.8	-86.5	-176.4	143	0	0	113.4	V10	V10-E14 PolarHBondContact O-N 3.22Å
15	I	56.4	Low	57.2	Low	87 Å²	87	113.8 Å²	113.8	45%	0.446	62%	0.621	S	S	.	*	H	α-helix	trans	-82.5	-32.4	-179.5	-71.5	166.5	0	0	0	111	K11 L12 E13 N19	K11-I15 WeakPolarHBondContact O-CB 3.3Å; K11-I15 WeakPolarHBondContact O-CD1 3.24Å; K11-I15 WeakPolarHBondContact O-CG1 3.24Å; K11-I15 PolarHBondContact O-N 3.26Å; L12-I15 PolarHBondContact O-N 3.41Å; E13-I15 VanDerWaalsContact C-N 3.3Å; E13-I15 PolarHBondContact O-N 3.12Å; I15-N19 WeakPolarHBondContact CG2-ND2 3.48Å; I15-N19 VanDerWaalsContact O-CB 3.27Å; I15-N19 WeakPolarHBondContact O-CB 3.25Å; I15-N19 PolarHBondContact O-N 2.8Å; I15-N19 PolarHBondContact O-ND2 2.94Å; I15-N19 PolarHBondContact O-OD1 2.91Å
16	D	54.5	Low	57.1	Low	134 Å²	134	115.1 Å²	115.1	72%	0.717	62%	0.622	S	S	*	*	H	α-helix	trans	-73.7	-29.7	-179.1	-155.3	61.9	0	0	0	112.9	L12 H18	L12-D16 PolarHBondContact O-N 2.92Å; D16-H18 PolarHBondContact O-N 3.49Å
17	E	54.6	Low	57	Low	190 Å²	190	115 Å²	115	89%	0.888	62%	0.62	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.5	-16.9	-180	-158.5	172.3	113.6	0	0	113.7
18	H	53.4	Low	57.1	Low	127 Å²	127	118 Å²	118	59%	0.588	62%	0.624	S	S	*	*	T	Hydrogen-bonded Turn	trans	-105.6	-8.5	178.4	-143.9	-89.6	0	0	0	114.1	D16 G20 E22	D16-H18 PolarHBondContact O-N 3.49Å; H18-G20 PolarHBondContact O-N 3.09Å; H18-E22 IonicContact CE1-OE2 3.22Å; H18-E22 PolarHBondContact CE1-OE2 3Å; H18-E22 IonicContact ND1-OE2 2.91Å; H18-E22 PolarHBondContact ND1-OE2 3.39Å
19	N	52.5	Low	57.5	Low	99 Å²	99	120.4 Å²	120.4	53%	0.529	63%	0.63	S	S	.	*	T	Hydrogen-bonded Turn	trans	-83.5	39.9	-169	-89.1	-8.2	0	0	0	115.1	I15	I15-N19 WeakPolarHBondContact CG2-ND2 3.48Å; I15-N19 VanDerWaalsContact O-CB 3.27Å; I15-N19 WeakPolarHBondContact O-CB 3.25Å; I15-N19 PolarHBondContact O-N 2.8Å; I15-N19 PolarHBondContact O-ND2 2.94Å; I15-N19 PolarHBondContact O-OD1 2.91Å
20	G	50.4	Low	58	Low	69 Å²	69	121.5 Å²	121.5	71%	0.711	63%	0.628	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.3	-42	171.9	0	0	0	0	0	113.9	H18	H18-G20 PolarHBondContact O-N 3.09Å
21	V	52.7	Low	58.7	Low	132 Å²	132	122.6 Å²	122.6	80%	0.8	63%	0.63	S	S	*	*	S	Bend	trans	-165.8	61.2	-171.3	-164.9	0	0	0	0	111.3
22	E	52.1	Low	59.6	Low	128 Å²	128	120.2 Å²	120.2	60%	0.598	63%	0.629	S	S	*	*			trans	-133.8	93.2	170.1	-68.5	-170	130.1	0	0	110.3	H18 C24	H18-E22 IonicContact CE1-OE2 3.22Å; H18-E22 PolarHBondContact CE1-OE2 3Å; H18-E22 IonicContact ND1-OE2 2.91Å; H18-E22 PolarHBondContact ND1-OE2 3.39Å; E22-C24 PolarHBondContact O-N 3.27Å
23	D	54.9	Low	60.9	Low	143 Å²	143	120.4 Å²	120.4	77%	0.765	63%	0.63	S	S	*	*			trans	-49.9	103.4	158.9	-68.6	-60.2	0	0	0	107.7	D25	D23-D25 PolarHBondContact O-N 3.07Å; D23-D25 VanDerWaalsContact O-N 3.13Å
24	C	59	Low	62.3	Low	80 Å²	80	116.5 Å²	116.5	54%	0.541	62%	0.617	S	S	.	*			trans	-48.7	124.6	172.3	-80.4	0	0	0	0	108.6	E22 F26 C27 R28	E22-C24 PolarHBondContact O-N 3.27Å; C24-F26 PolarHBondContact O-N 3.4Å; C24-C27 HydrophobicContact CB-CB 4.19Å; C24-C27 WeakPolarHBondContact O-CA 3.18Å; C24-C27 WeakPolarHBondContact O-CB 3.29Å; C24-C27 PolarHBondContact O-N 3.08Å; C24-R28 PolarHBondContact O-N 3.44Å; C24-R28 VanDerWaalsContact O-N 3.09Å
25	D	60.8	Low	63.7	Low	139 Å²	139	114.9 Å²	114.9	74%	0.743	61%	0.612	S	S	*	*	H	α-helix	trans	-49.8	-30.4	175.2	-94.8	-43.4	0	0	0	111.6	D23 R28 Q29	D23-D25 PolarHBondContact O-N 3.07Å; D23-D25 VanDerWaalsContact O-N 3.13Å; D25-R28 PolarHBondContact O-N 3.38Å; D25-Q29 WeakPolarHBondContact O-CB 3.27Å; D25-Q29 PolarHBondContact O-N 2.88Å
26	F	58.2	Low	65.2	Low	147 Å²	147	117 Å²	117	65%	0.645	62%	0.618	S	S	*	*	H	α-helix	trans	-68.5	-40.5	174.9	-155.9	-102.3	0	0	0	113.8	C24 Q29 I30	C24-F26 PolarHBondContact O-N 3.4Å; F26-Q29 PolarHBondContact O-N 3.39Å; F26-I30 HydrophobicContact CD1-CD1 3.52Å; F26-I30 HydrophobicContact CD1-CG1 4.41Å; F26-I30 HydrophobicContact CE1-CD1 3.53Å; F26-I30 HydrophobicContact CE1-CG1 4.36Å; F26-I30 WeakPolarHBondContact O-CD1 3.33Å; F26-I30 WeakPolarHBondContact O-CG1 3.32Å; F26-I30 PolarHBondContact O-N 2.92Å
27	C	60.1	Low	67	Low	70 Å²	70	112.4 Å²	112.4	47%	0.473	60%	0.6	S	S	.	*	H	α-helix	trans	-64.8	-43.4	173.2	-81.4	0	0	0	0	110.5	C24 Q29 I30 D31	C24-C27 HydrophobicContact CB-CB 4.19Å; C24-C27 WeakPolarHBondContact O-CA 3.18Å; C24-C27 WeakPolarHBondContact O-CB 3.29Å; C24-C27 PolarHBondContact O-N 3.08Å; C27-Q29 VanDerWaalsContact C-N 3.3Å; C27-Q29 PolarHBondContact O-N 3.17Å; C27-I30 PolarHBondContact O-N 3.37Å; C27-D31 PolarHBondContact O-N 2.98Å
28	R	62.8	Low	68.8	Low	168 Å²	168	108 Å²	108	63%	0.634	58%	0.581	S	S	*	*	H	α-helix	trans	-63.5	-35.6	176.9	-167.9	171.7	175.9	172.2	-1.3	112.4	C24 D25 C32	C24-R28 PolarHBondContact O-N 3.44Å; C24-R28 VanDerWaalsContact O-N 3.09Å; D25-R28 PolarHBondContact O-N 3.38Å; R28-C32 WeakPolarHBondContact O-CB 3.48Å; R28-C32 PolarHBondContact O-N 3.01Å; R28-C32 VanDerWaalsContact O-N 3.08Å; R28-C32 PolarHBondContact O-SG 3.17Å; R28-C32 VanDerWaalsContact O-SG 3.4Å
29	Q	70.3	Confident	70.6	Confident	133 Å²	133	106.6 Å²	106.6	62%	0.621	58%	0.578	S	S	*	*	H	α-helix	trans	-67.6	-41.8	173.7	-172.5	176	-16.2	0	0	112	D25 F26 C27 C32 D33	D25-Q29 WeakPolarHBondContact O-CB 3.27Å; D25-Q29 PolarHBondContact O-N 2.88Å; F26-Q29 PolarHBondContact O-N 3.39Å; C27-Q29 VanDerWaalsContact C-N 3.3Å; C27-Q29 PolarHBondContact O-N 3.17Å; Q29-C32 PolarHBondContact O-N 3.2Å; Q29-D33 PolarHBondContact O-N 3.31Å
30	I	69.8	Low	72.6	Confident	82 Å²	82	105.4 Å²	105.4	42%	0.421	57%	0.571	S	S	.	*	H	α-helix	trans	-64.2	-44.4	176.2	-72.2	161.4	0	0	0	111.2	F26 C27 C32 D33 V34	F26-I30 HydrophobicContact CD1-CD1 3.52Å; F26-I30 HydrophobicContact CD1-CG1 4.41Å; F26-I30 HydrophobicContact CE1-CD1 3.53Å; F26-I30 HydrophobicContact CE1-CG1 4.36Å; F26-I30 WeakPolarHBondContact O-CD1 3.33Å; F26-I30 WeakPolarHBondContact O-CG1 3.32Å; F26-I30 PolarHBondContact O-N 2.92Å; C27-I30 PolarHBondContact O-N 3.37Å; I30-C32 VanDerWaalsContact C-N 3.32Å; I30-C32 PolarHBondContact O-N 2.99Å; I30-D33 PolarHBondContact O-N 3.35Å; I30-V34 HydrophobicContact CG2-CG2 4.37Å; I30-V34 WeakPolarHBondContact O-CG2 3.19Å; I30-V34 PolarHBondContact O-N 3.38Å
31	D	75.7	Confident	74.8	Confident	111 Å²	111	106.5 Å²	106.5	59%	0.594	56%	0.559	S	S	*	*	H	α-helix	trans	-61.6	-40.7	176.7	-80	-48.7	0	0	0	111.5	C27 L35	C27-D31 PolarHBondContact O-N 2.98Å; D31-L35 WeakPolarHBondContact O-CB 3.47Å; D31-L35 PolarHBondContact O-N 2.9Å
32	C	77.7	Confident	76.8	Confident	77 Å²	77	103.9 Å²	103.9	52%	0.52	54%	0.544	S	S	.	.	H	α-helix	trans	-64.2	-39.1	174.4	-77.6	0	0	0	0	113	R28 Q29 I30 F36	R28-C32 WeakPolarHBondContact O-CB 3.48Å; R28-C32 PolarHBondContact O-N 3.01Å; R28-C32 VanDerWaalsContact O-N 3.08Å; R28-C32 PolarHBondContact O-SG 3.17Å; R28-C32 VanDerWaalsContact O-SG 3.4Å; Q29-C32 PolarHBondContact O-N 3.2Å; I30-C32 VanDerWaalsContact C-N 3.32Å; I30-C32 PolarHBondContact O-N 2.99Å; C32-F36 VanDerWaalsContact O-CB 3.27Å; C32-F36 WeakPolarHBondContact O-CB 3.32Å; C32-F36 PolarHBondContact O-N 2.96Å
33	D	86.3	Confident	78.9	Confident	113 Å²	113	101.8 Å²	101.8	60%	0.604	54%	0.539	S	S	*	.	H	α-helix	trans	-65.8	-48.5	177.5	-161.1	-49.7	0	0	0	110.9	Q29 I30 L35 F36 A37	Q29-D33 PolarHBondContact O-N 3.31Å; I30-D33 PolarHBondContact O-N 3.35Å; D33-L35 PolarHBondContact O-N 3.44Å; D33-F36 PolarHBondContact O-N 3.47Å; D33-A37 WeakPolarHBondContact O-CB 3.41Å; D33-A37 PolarHBondContact O-N 2.89Å
34	V	88.1	Confident	80.9	Confident	77 Å²	77	99.6 Å²	99.6	47%	0.467	53%	0.527	S	S	.	.	H	α-helix	trans	-61.8	-44.3	177.3	174.7	0	0	0	0	111.3	I30 F36 A37 L38	I30-V34 HydrophobicContact CG2-CG2 4.37Å; I30-V34 WeakPolarHBondContact O-CG2 3.19Å; I30-V34 PolarHBondContact O-N 3.38Å; V34-F36 VanDerWaalsContact C-N 3.33Å; V34-F36 PolarHBondContact O-N 2.96Å; V34-A37 PolarHBondContact O-N 2.95Å; V34-L38 HydrophobicContact CG1-CD1 4.15Å; V34-L38 HydrophobicContact CG1-CG 4.49Å; V34-L38 WeakPolarHBondContact O-CB 3.46Å; V34-L38 WeakPolarHBondContact O-CG 3.31Å; V34-L38 PolarHBondContact O-N 2.9Å
35	L	87.9	Confident	82.7	Confident	106 Å²	106	100.6 Å²	100.6	56%	0.555	53%	0.526	S	S	*	.	H	α-helix	trans	-62.6	-41.2	177.6	-173.4	70.4	0	0	0	111.4	D31 D33 L38 L39	D31-L35 WeakPolarHBondContact O-CB 3.47Å; D31-L35 PolarHBondContact O-N 2.9Å; D33-L35 PolarHBondContact O-N 3.44Å; L35-L38 PolarHBondContact O-N 3.33Å; L35-L39 WeakPolarHBondContact O-CG 3.35Å; L35-L39 PolarHBondContact O-N 2.87Å
36	F	88.1	Confident	84.4	Confident	131 Å²	131	96.6 Å²	96.6	58%	0.575	51%	0.512	S	S	*	.	H	α-helix	trans	-65.1	-43.6	176.7	-175.8	-106.9	0	0	0	111.8	C32 D33 V34 L38 L39 I40	C32-F36 VanDerWaalsContact O-CB 3.27Å; C32-F36 WeakPolarHBondContact O-CB 3.32Å; C32-F36 PolarHBondContact O-N 2.96Å; D33-F36 PolarHBondContact O-N 3.47Å; V34-F36 VanDerWaalsContact C-N 3.33Å; V34-F36 PolarHBondContact O-N 2.96Å; F36-L38 VanDerWaalsContact C-N 3.35Å; F36-L38 PolarHBondContact O-N 3.28Å; F36-L39 PolarHBondContact O-N 3.46Å; F36-I40 HydrophobicContact CD1-CD1 3.72Å; F36-I40 HydrophobicContact CE1-CD1 3.22Å; F36-I40 HydrophobicContact CE1-CG1 4.29Å; F36-I40 HydrophobicContact CE2-CD1 4.26Å; F36-I40 HydrophobicContact CG-CD1 4.44Å; F36-I40 HydrophobicContact CZ-CD1 3.54Å; F36-I40 HydrophobicContact CZ-CG1 4.31Å; F36-I40 WeakPolarHBondContact O-CG1 3.36Å; F36-I40 PolarHBondContact O-N 3.22Å
37	A	91.9	Very high	86.2	Confident	39 Å²	39	94.6 Å²	94.6	32%	0.322	51%	0.508	S	S	.	.	H	α-helix	trans	-59.4	-45.3	174.2	0	0	0	0	0	111.4	D33 V34 I40 I41	D33-A37 WeakPolarHBondContact O-CB 3.41Å; D33-A37 PolarHBondContact O-N 2.89Å; V34-A37 PolarHBondContact O-N 2.95Å; A37-I40 PolarHBondContact O-N 2.73Å; A37-I41 WeakPolarHBondContact O-CD1 3.39Å; A37-I41 WeakPolarHBondContact O-CG1 3.32Å; A37-I41 PolarHBondContact O-N 3.39Å
38	L	91.6	Very high	87.9	Confident	96 Å²	96	96.1 Å²	96.1	50%	0.503	51%	0.511	S	S	.	.	H	α-helix	trans	-61.2	-44.6	175.7	-74.6	173.1	0	0	0	111.9	V34 L35 F36 I40 I41 T42	V34-L38 HydrophobicContact CG1-CD1 4.15Å; V34-L38 HydrophobicContact CG1-CG 4.49Å; V34-L38 WeakPolarHBondContact O-CB 3.46Å; V34-L38 WeakPolarHBondContact O-CG 3.31Å; V34-L38 PolarHBondContact O-N 2.9Å; L35-L38 PolarHBondContact O-N 3.33Å; F36-L38 VanDerWaalsContact C-N 3.35Å; F36-L38 PolarHBondContact O-N 3.28Å; L38-I40 PolarHBondContact O-N 3.34Å; L38-I41 PolarHBondContact O-N 2.91Å; L38-T42 VanDerWaalsContact O-CG2 3.31Å; L38-T42 WeakPolarHBondContact O-CG2 3.28Å; L38-T42 PolarHBondContact O-N 3.31Å; L38-T42 PolarHBondContact O-OG1 3.22Å
39	L	92.7	Very high	89.4	Confident	98 Å²	98	92.7 Å²	92.7	51%	0.513	51%	0.509	S	S	.	.	H	α-helix	trans	-58.6	-47.2	176	-78.5	174.9	0	0	0	111.3	L35 F36 I41 T42 V43	L35-L39 WeakPolarHBondContact O-CG 3.35Å; L35-L39 PolarHBondContact O-N 2.87Å; F36-L39 PolarHBondContact O-N 3.46Å; L39-I41 PolarHBondContact O-N 2.96Å; L39-T42 PolarHBondContact O-N 3.49Å; L39-T42 PolarHBondContact O-OG1 3.01Å; L39-V43 WeakPolarHBondContact O-CG2 3.2Å; L39-V43 PolarHBondContact O-N 3.38Å
40	I	94	Very high	90.5	Very high	75 Å²	75	90.8 Å²	90.8	39%	0.385	50%	0.502	S	S	.	.	H	α-helix	trans	-61.1	-46.2	177.6	-70.3	173.9	0	0	0	111.1	F36 A37 L38 T42 V43 I44	F36-I40 HydrophobicContact CD1-CD1 3.72Å; F36-I40 HydrophobicContact CE1-CD1 3.22Å; F36-I40 HydrophobicContact CE1-CG1 4.29Å; F36-I40 HydrophobicContact CE2-CD1 4.26Å; F36-I40 HydrophobicContact CG-CD1 4.44Å; F36-I40 HydrophobicContact CZ-CD1 3.54Å; F36-I40 HydrophobicContact CZ-CG1 4.31Å; F36-I40 WeakPolarHBondContact O-CG1 3.36Å; F36-I40 PolarHBondContact O-N 3.22Å; A37-I40 PolarHBondContact O-N 2.73Å; L38-I40 PolarHBondContact O-N 3.34Å; I40-T42 VanDerWaalsContact C-N 3.31Å; I40-T42 PolarHBondContact O-N 3.49Å; I40-V43 PolarHBondContact O-N 3.29Å; I40-I44 HydrophobicContact CG2-CD1 3.55Å; I40-I44 HydrophobicContact CG2-CG1 4.19Å; I40-I44 VanDerWaalsContact O-CG1 3.28Å; I40-I44 WeakPolarHBondContact O-CG1 3.48Å; I40-I44 PolarHBondContact O-N 3.46Å
41	I	95.6	Very high	91.7	Very high	91 Å²	91	90.7 Å²	90.7	47%	0.467	51%	0.505	S	S	.	.	H	α-helix	trans	-58.3	-44.9	178.9	-68.7	162.6	0	0	0	110.4	A37 L38 L39 V43 I44 L45	A37-I41 WeakPolarHBondContact O-CD1 3.39Å; A37-I41 WeakPolarHBondContact O-CG1 3.32Å; A37-I41 PolarHBondContact O-N 3.39Å; L38-I41 PolarHBondContact O-N 2.91Å; L39-I41 PolarHBondContact O-N 2.96Å; I41-V43 PolarHBondContact O-N 2.92Å; I41-I44 PolarHBondContact O-N 3.33Å; I41-L45 HydrophobicContact CG2-CD1 3.93Å; I41-L45 HydrophobicContact CG2-CG 4.45Å; I41-L45 WeakPolarHBondContact O-CB 3.42Å; I41-L45 WeakPolarHBondContact O-CG 3.35Å; I41-L45 PolarHBondContact O-N 2.94Å
42	T	95.6	Very high	92.5	Very high	77 Å²	77	88.7 Å²	88.7	47%	0.472	50%	0.497	S	S	.	.	H	α-helix	trans	-63.6	-40.8	178.5	60.4	0	0	0	0	112.6	L38 L39 I40 L45 A46	L38-T42 VanDerWaalsContact O-CG2 3.31Å; L38-T42 WeakPolarHBondContact O-CG2 3.28Å; L38-T42 PolarHBondContact O-N 3.31Å; L38-T42 PolarHBondContact O-OG1 3.22Å; L39-T42 PolarHBondContact O-N 3.49Å; L39-T42 PolarHBondContact O-OG1 3.01Å; I40-T42 VanDerWaalsContact C-N 3.31Å; I40-T42 PolarHBondContact O-N 3.49Å; T42-L45 PolarHBondContact O-N 3.4Å; T42-A46 WeakPolarHBondContact O-CB 3.43Å; T42-A46 PolarHBondContact O-N 3.33Å
43	V	96.5	Very high	93.2	Very high	84 Å²	84	87.6 Å²	87.6	51%	0.509	49%	0.49	S	S	.	.	H	α-helix	trans	-64.8	-45.1	176.9	172.1	0	0	0	0	111	L39 I40 I41 L45 A46 L47	L39-V43 WeakPolarHBondContact O-CG2 3.2Å; L39-V43 PolarHBondContact O-N 3.38Å; I40-V43 PolarHBondContact O-N 3.29Å; I41-V43 PolarHBondContact O-N 2.92Å; V43-L45 PolarHBondContact O-N 3.46Å; V43-A46 PolarHBondContact O-N 3.29Å; V43-L47 HydrophobicContact CG1-CD1 4.22Å; V43-L47 WeakPolarHBondContact O-CG 3.42Å; V43-L47 PolarHBondContact O-N 2.94Å
44	I	96.7	Very high	93.4	Very high	98 Å²	98	89.5 Å²	89.5	50%	0.503	49%	0.493	S	S	.	.	H	α-helix	trans	-61.4	-45.4	177.3	-67.4	171	0	0	0	110.3	I40 I41 A46 L47 L48	I40-I44 HydrophobicContact CG2-CD1 3.55Å; I40-I44 HydrophobicContact CG2-CG1 4.19Å; I40-I44 VanDerWaalsContact O-CG1 3.28Å; I40-I44 WeakPolarHBondContact O-CG1 3.48Å; I40-I44 PolarHBondContact O-N 3.46Å; I41-I44 PolarHBondContact O-N 3.33Å; I44-A46 PolarHBondContact O-N 2.94Å; I44-L47 PolarHBondContact O-N 3.42Å; I44-L48 WeakPolarHBondContact O-CB 3.37Å; I44-L48 PolarHBondContact O-N 2.93Å
45	L	96.4	Very high	93.4	Very high	100 Å²	100	94.2 Å²	94.2	52%	0.524	50%	0.503	S	S	.	.	H	α-helix	trans	-60.6	-44.8	177	-77.6	171.1	0	0	0	111.7	I41 T42 V43 L47 L48 V49	I41-L45 HydrophobicContact CG2-CD1 3.93Å; I41-L45 HydrophobicContact CG2-CG 4.45Å; I41-L45 WeakPolarHBondContact O-CB 3.42Å; I41-L45 WeakPolarHBondContact O-CG 3.35Å; I41-L45 PolarHBondContact O-N 2.94Å; T42-L45 PolarHBondContact O-N 3.4Å; V43-L45 PolarHBondContact O-N 3.46Å; L45-L47 PolarHBondContact O-N 2.93Å; L45-L48 PolarHBondContact O-N 3.48Å; L45-V49 VanDerWaalsContact O-CG2 3.28Å; L45-V49 WeakPolarHBondContact O-CG2 3.28Å; L45-V49 PolarHBondContact O-N 3.48Å
46	A	96	Very high	93.3	Very high	55 Å²	55	94.4 Å²	94.4	46%	0.455	50%	0.503	S	S	.	.	H	α-helix	trans	-61.4	-43.9	177.6	0	0	0	0	0	111.9	T42 V43 I44 L48 V49 L50	T42-A46 WeakPolarHBondContact O-CB 3.43Å; T42-A46 PolarHBondContact O-N 3.33Å; V43-A46 PolarHBondContact O-N 3.29Å; I44-A46 PolarHBondContact O-N 2.94Å; A46-L48 VanDerWaalsContact C-N 3.35Å; A46-L48 PolarHBondContact O-N 3.49Å; A46-V49 PolarHBondContact O-N 3.25Å; A46-L50 WeakPolarHBondContact O-CG 3.4Å; A46-L50 PolarHBondContact O-N 2.94Å
47	L	95.9	Very high	93.1	Very high	105 Å²	105	96.3 Å²	96.3	55%	0.55	51%	0.511	S	S	.	.	H	α-helix	trans	-61.7	-42.2	175.3	-72.9	174.1	0	0	0	111.9	V43 I44 L45 L50 V51	V43-L47 HydrophobicContact CG1-CD1 4.22Å; V43-L47 WeakPolarHBondContact O-CG 3.42Å; V43-L47 PolarHBondContact O-N 2.94Å; I44-L47 PolarHBondContact O-N 3.42Å; L45-L47 PolarHBondContact O-N 2.93Å; L47-L50 PolarHBondContact O-N 3.5Å; L47-V51 WeakPolarHBondContact O-CG2 3.19Å; L47-V51 PolarHBondContact O-N 2.94Å
48	L	95.6	Very high	92.3	Very high	102 Å²	102	97.7 Å²	97.7	53%	0.534	53%	0.529	S	S	.	.	H	α-helix	trans	-64.2	-44.2	179.3	-158.8	155.5	0	0	0	111	I44 L45 A46 V51 V52	I44-L48 WeakPolarHBondContact O-CB 3.37Å; I44-L48 PolarHBondContact O-N 2.93Å; L45-L48 PolarHBondContact O-N 3.48Å; A46-L48 VanDerWaalsContact C-N 3.35Å; A46-L48 PolarHBondContact O-N 3.49Å; L48-V51 PolarHBondContact O-N 3.34Å; L48-V52 HydrophobicContact CD2-CG2 3.95Å; L48-V52 WeakPolarHBondContact O-CG2 3.33Å; L48-V52 PolarHBondContact O-N 3.17Å
49	V	95.1	Very high	91.2	Very high	97 Å²	97	99.6 Å²	99.6	59%	0.588	54%	0.538	S	S	*	.	H	α-helix	trans	-61.2	-44.6	174.9	172.4	0	0	0	0	111.2	L45 A46 V52 S53	L45-V49 VanDerWaalsContact O-CG2 3.28Å; L45-V49 WeakPolarHBondContact O-CG2 3.28Å; L45-V49 PolarHBondContact O-N 3.48Å; A46-V49 PolarHBondContact O-N 3.25Å; V49-V52 PolarHBondContact O-N 2.92Å; V49-S53 WeakPolarHBondContact O-CB 3.35Å; V49-S53 PolarHBondContact O-N 2.85Å; V49-S53 PolarHBondContact O-OG 3.38Å
50	L	94	Very high	89.4	Confident	92 Å²	92	101 Å²	101	48%	0.482	57%	0.565	S	S	.	*	H	α-helix	trans	-58.2	-52	176.3	-76.8	175.2	0	0	0	110.7	A46 L47 V52 S53 F54	A46-L50 WeakPolarHBondContact O-CG 3.4Å; A46-L50 PolarHBondContact O-N 2.94Å; L47-L50 PolarHBondContact O-N 3.5Å; L50-V52 PolarHBondContact O-N 3.03Å; L50-S53 PolarHBondContact O-N 2.68Å; L50-S53 PolarHBondContact O-OG 2.9Å; L50-F54 WeakPolarHBondContact O-CD2 3.32Å; L50-F54 PolarHBondContact O-N 2.92Å
51	V	93.8	Very high	89.2	Confident	80 Å²	80	102.4 Å²	102.4	49%	0.485	57%	0.574	S	S	.	*	H	α-helix	trans	-54.4	-55.6	177.3	172	0	0	0	0	109.8	L47 L48 S53 F54 W55	L47-V51 WeakPolarHBondContact O-CG2 3.19Å; L47-V51 PolarHBondContact O-N 2.94Å; L48-V51 PolarHBondContact O-N 3.34Å; V51-S53 VanDerWaalsContact C-N 3.27Å; V51-S53 PolarHBondContact O-N 3.23Å; V51-F54 WeakPolarHBondContact O-CB 3.43Å; V51-F54 PolarHBondContact O-N 3.36Å; V51-W55 VanDerWaalsContact CG1-CD1 3.43Å; V51-W55 PolarHBondContact O-N 3.44Å
52	V	93.1	Very high	88.9	Confident	69 Å²	69	102.9 Å²	102.9	42%	0.418	58%	0.579	S	S	.	*	H	α-helix	trans	-55.1	-42.1	179.3	171.5	0	0	0	0	112.1	L48 V49 L50 F54 W55 I56	L48-V52 HydrophobicContact CD2-CG2 3.95Å; L48-V52 WeakPolarHBondContact O-CG2 3.33Å; L48-V52 PolarHBondContact O-N 3.17Å; V49-V52 PolarHBondContact O-N 2.92Å; L50-V52 PolarHBondContact O-N 3.03Å; V52-F54 PolarHBondContact O-N 2.96Å; V52-W55 PolarHBondContact O-N 3.37Å; V52-I56 HydrophobicContact CG1-CD1 3.79Å; V52-I56 HydrophobicContact CG1-CG1 4.41Å; V52-I56 WeakPolarHBondContact O-CG1 3.21Å; V52-I56 PolarHBondContact O-N 3.47Å
53	S	92.1	Very high	88.5	Confident	55 Å²	55	104.4 Å²	104.4	39%	0.385	59%	0.585	S	S	.	*	H	α-helix	trans	-65.2	-38.4	177.7	74.1	0	0	0	0	113	V49 L50 V51 I56 K57	V49-S53 WeakPolarHBondContact O-CB 3.35Å; V49-S53 PolarHBondContact O-N 2.85Å; V49-S53 PolarHBondContact O-OG 3.38Å; L50-S53 PolarHBondContact O-N 2.68Å; L50-S53 PolarHBondContact O-OG 2.9Å; V51-S53 VanDerWaalsContact C-N 3.27Å; V51-S53 PolarHBondContact O-N 3.23Å; S53-I56 PolarHBondContact O-N 3.32Å; S53-K57 WeakPolarHBondContact O-CB 3.44Å; S53-K57 PolarHBondContact O-N 3.46Å
54	F	90	Very high	88	Confident	153 Å²	153	105.6 Å²	105.6	67%	0.671	59%	0.59	S	S	*	*	H	α-helix	trans	-65.6	-40.4	173	-85.9	-73	0	0	0	111.6	L50 V51 V52 K57 G58	L50-F54 WeakPolarHBondContact O-CD2 3.32Å; L50-F54 PolarHBondContact O-N 2.92Å; V51-F54 WeakPolarHBondContact O-CB 3.43Å; V51-F54 PolarHBondContact O-N 3.36Å; V52-F54 PolarHBondContact O-N 2.96Å; F54-K57 PolarHBondContact O-N 2.99Å; F54-G58 PolarHBondContact O-N 3.24Å
55	W	89.3	Confident	87.5	Confident	175 Å²	175	106.1 Å²	106.1	66%	0.663	60%	0.595	S	S	*	*	H	α-helix	trans	-62.2	-48	174.9	-81.4	90.7	0	0	0	111.3	V51 V52 K57 G58 I59	V51-W55 VanDerWaalsContact CG1-CD1 3.43Å; V51-W55 PolarHBondContact O-N 3.44Å; V52-W55 PolarHBondContact O-N 3.37Å; W55-K57 VanDerWaalsContact C-N 3.35Å; W55-K57 PolarHBondContact O-N 2.88Å; W55-G58 PolarHBondContact O-N 2.91Å; W55-I59 HydrophobicContact CE3-CD1 4.22Å; W55-I59 WeakPolarHBondContact O-CB 3.4Å; W55-I59 WeakPolarHBondContact O-CD1 3.32Å; W55-I59 WeakPolarHBondContact O-CG1 3.31Å; W55-I59 PolarHBondContact O-N 3.26Å
56	I	85.8	Confident	86.9	Confident	111 Å²	111	106.5 Å²	106.5	57%	0.569	60%	0.6	S	S	*	*	H	α-helix	trans	-61.5	-44.3	179.1	-66.6	166.3	0	0	0	110.7	V52 S53 G58 I59 A60	V52-I56 HydrophobicContact CG1-CD1 3.79Å; V52-I56 HydrophobicContact CG1-CG1 4.41Å; V52-I56 WeakPolarHBondContact O-CG1 3.21Å; V52-I56 PolarHBondContact O-N 3.47Å; S53-I56 PolarHBondContact O-N 3.32Å; I56-G58 VanDerWaalsContact C-N 3.32Å; I56-G58 PolarHBondContact O-N 2.98Å; I56-I59 PolarHBondContact O-N 3.43Å; I56-A60 VanDerWaalsContact O-CB 3.31Å; I56-A60 WeakPolarHBondContact O-CB 3.38Å; I56-A60 PolarHBondContact O-N 3.48Å
57	K	83	Confident	86.3	Confident	170 Å²	170	110.1 Å²	110.1	74%	0.739	61%	0.611	S	S	*	*	H	α-helix	trans	-74.8	-18.9	179.9	-168.2	161.3	177.9	65.4	0	114.1	S53 F54 W55	S53-K57 WeakPolarHBondContact O-CB 3.44Å; S53-K57 PolarHBondContact O-N 3.46Å; F54-K57 PolarHBondContact O-N 2.99Å; W55-K57 VanDerWaalsContact C-N 3.35Å; W55-K57 PolarHBondContact O-N 2.88Å
58	G	76.2	Confident	85.5	Confident	68 Å²	68	110.5 Å²	110.5	70%	0.701	62%	0.615	S	S	*	*	H	α-helix	trans	-85.9	-22.7	172.4	0	0	0	0	0	113.5	F54 W55 I56	F54-G58 PolarHBondContact O-N 3.24Å; W55-G58 PolarHBondContact O-N 2.91Å; I56-G58 VanDerWaalsContact C-N 3.32Å; I56-G58 PolarHBondContact O-N 2.98Å
59	I	68	Low	84.7	Confident	136 Å²	136	111.3 Å²	111.3	70%	0.697	62%	0.622	S	S	*	*	H	α-helix	trans	-89.3	-32.7	176.5	-65.9	163.6	0	0	0	111.7	W55 I56	W55-I59 HydrophobicContact CE3-CD1 4.22Å; W55-I59 WeakPolarHBondContact O-CB 3.4Å; W55-I59 WeakPolarHBondContact O-CD1 3.32Å; W55-I59 WeakPolarHBondContact O-CG1 3.31Å; W55-I59 PolarHBondContact O-N 3.26Å; I56-I59 PolarHBondContact O-N 3.43Å
60	A	55.6	Low	83.7	Confident	129 Å²	129	112.5 Å²	112.5	100%	1.066	63%	0.625	S	S	*	*			trans	-89.1	0	177.3	0	0	0	0	0	112.6	I56	I56-A60 VanDerWaalsContact O-CB 3.31Å; I56-A60 WeakPolarHBondContact O-CB 3.38Å; I56-A60 PolarHBondContact O-N 3.48Å

Retrieved 60 of 60 residues in 28.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).