A0A077Z3F0_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077Z3F0, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 140 aa.

						>A0A077Z3F0_TRITR|A0A077Z3F0
MARVSGLVYQDNLLTAATNQPQFNGARSNEAGLRANMDNGFVAPTVSSKAASKYSSASVTSLKPLSSKEMNAGSSASGEGTTTGIATFARQIQRVLEDDGLLYQYIGEENSPFYEYTHLLEEYIQFKGLIALVPSNHKPN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	28.6	Very low	42.6	Very low	237 Å²	237	152.8 Å²	152.8	100%	1.167	83%	0.83	S	S	*	*				0	121.6	0	-68.8	-173.4	179.7	0	0	108.4
2	A	37.6	Very low	43	Very low	96 Å²	96	152.4 Å²	152.4	79%	0.793	83%	0.827	S	S	*	*			trans	-148.8	113.5	164.6	0	0	0	0	0	106.9
3	R	35.4	Very low	43.5	Very low	234 Å²	234	153.2 Å²	153.2	88%	0.883	83%	0.829	S	S	*	*			trans	-96.7	118.3	177.6	-57.1	179.6	-178.9	-173.1	-0.4	105.9
4	V	40.7	Very low	43.9	Very low	143 Å²	143	154.4 Å²	154.4	87%	0.867	83%	0.833	S	S	*	*			trans	-97.3	107.7	178.8	-178.5	0	0	0	0	107.7
5	S	44.8	Very low	43.6	Very low	114 Å²	114	153.6 Å²	153.6	80%	0.797	84%	0.836	S	S	*	*	P	Polyproline II helix	trans	-65.3	136	174.4	-61.1	0	0	0	0	110.3
6	G	42.2	Very low	43.7	Very low	71 Å²	71	148.8 Å²	148.8	73%	0.732	82%	0.823	S	S	*	*	P	Polyproline II helix	trans	-61.1	155.3	-170.4	0	0	0	0	0	115.5
7	L	52.4	Low	43.5	Very low	144 Å²	144	145.1 Å²	145.1	75%	0.754	82%	0.816	S	S	*	*	P	Polyproline II helix	trans	-74.5	121.5	174	-61.3	170.3	0	0	0	109.1	Y9	L7-Y9 PolarHBondContact O-N 2.88Å
8	V	45.7	Very low	43.6	Very low	134 Å²	134	144.6 Å²	144.6	81%	0.812	82%	0.818	S	S	*	*			trans	-79.6	109.7	172.1	179.3	0	0	0	0	107.6	Q10	V8-Q10 PolarHBondContact O-N 3.18Å
9	Y	47.9	Very low	43.5	Very low	191 Å²	191	144.8 Å²	144.8	75%	0.749	82%	0.817	S	S	*	*			trans	-72.8	118.2	174.9	-68.1	-88.6	0	0	0	109.1	L7	L7-Y9 PolarHBondContact O-N 2.88Å
10	Q	40.5	Very low	43.4	Very low	174 Å²	174	147 Å²	147	81%	0.813	82%	0.82	S	S	*	*			trans	-85.8	111.6	173.7	-74.7	-176.4	-3.4	0	0	109.5	V8 N12	V8-Q10 PolarHBondContact O-N 3.18Å; Q10-N12 PolarHBondContact O-N 2.8Å
11	D	52.4	Low	43.5	Very low	143 Å²	143	144.8 Å²	144.8	77%	0.765	81%	0.812	S	S	*	*	G	3₁₀ helix	trans	-69.4	10	-176.4	-71.8	-34.3	0	0	0	115.6	L13	D11-L13 PolarHBondContact O-N 3.2Å
12	N	47.7	Very low	44	Very low	148 Å²	148	141.8 Å²	141.8	79%	0.791	80%	0.795	S	S	*	*	G	3₁₀ helix	trans	-93.5	9.9	-167.8	-77.1	10.2	0	0	0	115.8	Q10	Q10-N12 PolarHBondContact O-N 2.8Å
13	L	49.7	Very low	44.3	Very low	163 Å²	163	146.4 Å²	146.4	85%	0.853	80%	0.797	S	S	*	*	G	3₁₀ helix	trans	-88.8	-2.8	-178.9	-83.1	165.9	0	0	0	115.3	D11 T15	D11-L13 PolarHBondContact O-N 3.2Å; L13-T15 PolarHBondContact O-N 2.95Å
14	L	48.6	Very low	44.7	Very low	169 Å²	169	142.3 Å²	142.3	89%	0.885	79%	0.793	S	S	*	*			trans	-92.8	14.5	-173.4	-93.6	139.2	0	0	0	116
15	T	40.2	Very low	44.9	Very low	143 Å²	143	138.6 Å²	138.6	88%	0.877	78%	0.784	S	S	*	*			trans	-118.1	68.6	173.1	-42.3	0	0	0	0	111.3	L13	L13-T15 PolarHBondContact O-N 2.95Å
16	A	44.4	Very low	45.1	Very low	77 Å²	77	137.7 Å²	137.7	64%	0.636	78%	0.783	S	S	*	*			trans	-118	113.9	166.8	0	0	0	0	0	110.1
17	A	41.2	Very low	45.4	Very low	85 Å²	85	146.4 Å²	146.4	70%	0.702	79%	0.794	S	S	*	*			trans	-41.2	139.6	-169.7	0	0	0	0	0	118.2	N19	A17-N19 PolarHBondContact O-N 3.13Å
18	T	44	Very low	45.3	Very low	137 Å²	137	143 Å²	143	84%	0.84	78%	0.782	S	S	*	*			trans	-60.7	101.4	166.9	52.7	0	0	0	0	111.8
19	N	41.7	Very low	45.8	Very low	149 Å²	149	143 Å²	143	80%	0.797	78%	0.777	S	S	*	*			trans	-118.9	100.7	161.2	-79.9	-38.8	0	0	0	107.8	A17	A17-N19 PolarHBondContact O-N 3.13Å
20	Q	41.8	Very low	46.2	Very low	188 Å²	188	141.1 Å²	141.1	88%	0.879	78%	0.776	S	S	*	*			trans	-67.4	128.5	177.7	-74	-138.5	-8	0	0	110.9	Q22	Q20-Q22 PolarHBondContact O-N 3.47Å
21	P	45.4	Very low	47	Very low	100 Å²	100	136 Å²	136	65%	0.649	76%	0.763	S	S	*	*			trans	-73.5	120.7	172.8	26.5	-29.3	0	0	0	110.7	F23	P21-F23 PolarHBondContact O-N 3Å
22	Q	40.8	Very low	47.1	Very low	174 Å²	174	131.1 Å²	131.1	81%	0.813	75%	0.747	S	S	*	*			trans	-72.2	106.5	175.1	-158.4	177.5	11.1	0	0	109	Q20 N24	Q20-Q22 PolarHBondContact O-N 3.47Å; Q22-N24 PolarHBondContact O-N 3.18Å
23	F	43.4	Very low	47.7	Very low	193 Å²	193	128.7 Å²	128.7	85%	0.846	73%	0.733	S	S	*	*			trans	-67.6	88.1	178.5	-84.6	-92.4	0	0	0	111.5	P21 G25	P21-F23 PolarHBondContact O-N 3Å; F23-G25 VanDerWaalsContact C-N 3.32Å; F23-G25 PolarHBondContact O-N 3.02Å
24	N	43.5	Very low	48.1	Very low	149 Å²	149	129.1 Å²	129.1	80%	0.797	72%	0.724	S	S	*	*			trans	-96.5	57.1	162.8	-88.7	-12.8	0	0	0	110	Q22	Q22-N24 PolarHBondContact O-N 3.18Å
25	G	43.9	Very low	48.4	Very low	65 Å²	65	123.4 Å²	123.4	67%	0.67	70%	0.701	S	S	*	*			trans	-80.3	115.1	171.3	0	0	0	0	0	109.7	F23 R27	F23-G25 VanDerWaalsContact C-N 3.32Å; F23-G25 PolarHBondContact O-N 3.02Å; G25-R27 PolarHBondContact O-N 3.04Å
26	A	49.3	Very low	49.1	Very low	95 Å²	95	122.6 Å²	122.6	79%	0.785	69%	0.691	S	S	*	*			trans	-36.1	125.5	-178.7	0	0	0	0	0	113.6	S28	A26-S28 PolarHBondContact O-N 2.75Å
27	R	48.2	Very low	49.8	Very low	253 Å²	253	125.9 Å²	125.9	96%	0.955	70%	0.695	S	S	*	*			trans	-57.7	85.9	164.1	-74.9	175	157.5	-177.7	-6.6	108.5	G25 N29	G25-R27 PolarHBondContact O-N 3.04Å; R27-N29 PolarHBondContact O-N 3.29Å
28	S	51.9	Low	50.8	Low	73 Å²	73	128.5 Å²	128.5	51%	0.51	70%	0.697	S	S	.	*			trans	-59.5	105.3	172.8	162.2	0	0	0	0	107.3	A26 E30 L33	A26-S28 PolarHBondContact O-N 2.75Å; S28-E30 PolarHBondContact O-N 2.97Å; S28-L33 WeakPolarHBondContact OG-CD1 3.42Å; S28-L33 WeakPolarHBondContact OG-CG 3.44Å
29	N	55.6	Low	51.6	Low	133 Å²	133	127.5 Å²	127.5	71%	0.711	69%	0.687	S	S	*	*			trans	-57.4	112	176.9	-169.1	10.7	0	0	0	107.9	R27 A31 G32	R27-N29 PolarHBondContact O-N 3.29Å; N29-A31 PolarHBondContact O-N 3.37Å; N29-G32 PolarHBondContact O-N 2.79Å
30	E	56.1	Low	52.1	Low	152 Å²	152	122.5 Å²	122.5	71%	0.71	67%	0.671	S	S	*	*	H	α-helix	trans	-54.1	-28.2	-169	-166.8	175.9	174.2	0	0	112.9	S28 G32 L33	S28-E30 PolarHBondContact O-N 2.97Å; E30-G32 VanDerWaalsContact C-N 3.31Å; E30-G32 PolarHBondContact O-N 3.27Å; E30-L33 PolarHBondContact O-N 3.38Å
31	A	56.3	Low	52.9	Low	67 Å²	67	123 Å²	123	55%	0.554	67%	0.67	S	S	*	*	H	α-helix	trans	-61.3	-33.9	174	0	0	0	0	0	113.8	N29 A35	N29-A31 PolarHBondContact O-N 3.37Å; A31-A35 PolarHBondContact O-N 3.28Å
32	G	56.3	Low	53.2	Low	41 Å²	41	123 Å²	123	42%	0.423	67%	0.668	S	S	.	*	H	α-helix	trans	-72.5	-30.6	-179.6	0	0	0	0	0	113.3	N29 E30 N36	N29-G32 PolarHBondContact O-N 2.79Å; E30-G32 VanDerWaalsContact C-N 3.31Å; E30-G32 PolarHBondContact O-N 3.27Å; G32-N36 PolarHBondContact O-N 3.26Å
33	L	59.4	Low	53.9	Low	96 Å²	96	117.7 Å²	117.7	50%	0.503	65%	0.654	S	S	.	*	H	α-helix	trans	-69.4	-37.9	177.8	-64.6	177.2	0	0	0	111.5	S28 E30 N36 M37	S28-L33 WeakPolarHBondContact OG-CD1 3.42Å; S28-L33 WeakPolarHBondContact OG-CG 3.44Å; E30-L33 PolarHBondContact O-N 3.38Å; L33-N36 PolarHBondContact O-N 3.38Å; L33-M37 PolarHBondContact O-N 2.79Å
34	R	58.5	Low	54.2	Low	173 Å²	173	113.5 Å²	113.5	65%	0.653	65%	0.646	S	S	*	*	H	α-helix	trans	-65.1	-46.4	178.4	-61.5	-178.8	76.1	162.9	3.5	111.3	N36 M37 D38	R34-N36 VanDerWaalsContact C-N 3.25Å; R34-N36 PolarHBondContact O-N 3.44Å; R34-M37 PolarHBondContact O-N 3.24Å; R34-D38 PolarHBondContact O-N 3.22Å
35	A	55.4	Low	54.3	Low	49 Å²	49	112.9 Å²	112.9	41%	0.405	65%	0.648	S	S	.	*	H	α-helix	trans	-63.5	-29.2	178.4	0	0	0	0	0	113.6	A31 N39	A31-A35 PolarHBondContact O-N 3.28Å; A35-N39 PolarHBondContact O-ND2 3.03Å
36	N	55	Low	54.6	Low	126 Å²	126	113.6 Å²	113.6	67%	0.674	64%	0.639	S	S	*	*	H	α-helix	trans	-78.8	-27.6	177.5	-94.9	23.9	0	0	0	113.6	G32 L33 R34	G32-N36 PolarHBondContact O-N 3.26Å; L33-N36 PolarHBondContact O-N 3.38Å; R34-N36 VanDerWaalsContact C-N 3.25Å; R34-N36 PolarHBondContact O-N 3.44Å
37	M	57.2	Low	54.2	Low	145 Å²	145	112.7 Å²	112.7	71%	0.714	63%	0.627	S	S	*	*	H	α-helix	trans	-75.1	-39.7	175.5	-68.9	-169.7	-61.3	0	0	111.8	L33 R34 N39 G40	L33-M37 PolarHBondContact O-N 2.79Å; R34-M37 PolarHBondContact O-N 3.24Å; M37-N39 VanDerWaalsContact C-N 3.3Å; M37-N39 PolarHBondContact O-N 2.99Å; M37-G40 PolarHBondContact O-N 2.84Å
38	D	63.2	Low	54.4	Low	140 Å²	140	106 Å²	106	75%	0.749	62%	0.619	S	S	*	*	H	α-helix	trans	-69.6	-26.4	-177	-69.4	-24.2	0	0	0	113.1	R34	R34-D38 PolarHBondContact O-N 3.22Å
39	N	61	Low	54.3	Low	116 Å²	116	111.8 Å²	111.8	62%	0.62	64%	0.635	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.3	1.1	-179	-71.4	-46.2	0	0	0	114.3	A35 M37 V42	A35-N39 PolarHBondContact O-ND2 3.03Å; M37-N39 VanDerWaalsContact C-N 3.3Å; M37-N39 PolarHBondContact O-N 2.99Å; N39-V42 WeakPolarHBondContact O-CG2 3.41Å
40	G	52.4	Low	54	Low	45 Å²	45	107.9 Å²	107.9	46%	0.464	62%	0.621	S	S	.	*			trans	60.4	174.7	-174.9	0	0	0	0	0	112.4	M37 V42	M37-G40 PolarHBondContact O-N 2.84Å; G40-V42 VanDerWaalsContact C-N 3.32Å; G40-V42 PolarHBondContact O-N 3.35Å
41	F	58.2	Low	53.6	Low	197 Å²	197	102.4 Å²	102.4	86%	0.864	60%	0.602	S	S	*	*			trans	-67.1	89.3	179	-176	-96.1	0	0	0	110.4	A43	F41-A43 HydrophobicContact CE1-CB 4.28Å; F41-A43 PolarHBondContact O-N 3.37Å
42	V	51.9	Low	53.1	Low	102 Å²	102	103.9 Å²	103.9	62%	0.618	61%	0.608	S	S	*	*			trans	-81.1	103.6	169.6	-175.9	0	0	0	0	107	N39 G40	N39-V42 WeakPolarHBondContact O-CG2 3.41Å; G40-V42 VanDerWaalsContact C-N 3.32Å; G40-V42 PolarHBondContact O-N 3.35Å
43	A	54.3	Low	52.7	Low	62 Å²	62	111.2 Å²	111.2	51%	0.512	63%	0.628	S	S	.	*			trans	-52.6	130.7	171.7	0	0	0	0	0	108.5	F41 T45	F41-A43 HydrophobicContact CE1-CB 4.28Å; F41-A43 PolarHBondContact O-N 3.37Å; A43-T45 PolarHBondContact O-N 2.73Å
44	P	50.3	Low	52.1	Low	104 Å²	104	115 Å²	115	68%	0.675	64%	0.637	S	S	*	*			trans	-57.8	119.9	-171	20.6	-31	0	0	0	109.7	V46	P44-V46 PolarHBondContact O-N 2.88Å
45	T	46.6	Very low	51.3	Low	136 Å²	136	111.4 Å²	111.4	83%	0.834	64%	0.638	S	S	*	*			trans	-65.1	83.5	172.4	-46.3	0	0	0	0	108.1	A43 S47	A43-T45 PolarHBondContact O-N 2.73Å; T45-S47 PolarHBondContact O-N 2.98Å
46	V	49.2	Very low	50.9	Low	80 Å²	80	114 Å²	114	49%	0.485	65%	0.654	S	S	.	*			trans	-70.3	97.5	175.7	-73.8	0	0	0	0	107.8	P44 S48 A51	P44-V46 PolarHBondContact O-N 2.88Å; V46-S48 PolarHBondContact O-N 2.79Å; V46-A51 HydrophobicContact CB-CB 4.41Å; V46-A51 HydrophobicContact CG2-CB 4.42Å
47	S	41.6	Very low	50.6	Low	76 Å²	76	111.2 Å²	111.2	53%	0.531	65%	0.648	S	S	.	*			trans	-44.1	126.2	161.4	159.6	0	0	0	0	108.1	T45 K49 A50 A51	T45-S47 PolarHBondContact O-N 2.98Å; S47-K49 PolarHBondContact O-N 2.67Å; S47-A50 PolarHBondContact O-N 2.74Å; S47-A51 PolarHBondContact O-N 3.38Å
48	S	52.5	Low	49.9	Very low	112 Å²	112	107.6 Å²	107.6	78%	0.783	64%	0.637	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.6	-13.6	-173	44.1	0	0	0	0	113.6	V46	V46-S48 PolarHBondContact O-N 2.79Å
49	K	48.6	Very low	49.4	Very low	195 Å²	195	106.8 Å²	106.8	85%	0.848	64%	0.637	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.6	-24.5	172.3	-151.9	171.6	-174.6	178.9	0	113.7	S47	S47-K49 PolarHBondContact O-N 2.67Å
50	A	50.8	Low	49	Very low	52 Å²	52	107.2 Å²	107.2	43%	0.43	64%	0.644	S	S	.	*	T	Hydrogen-bonded Turn	trans	-96.2	-20.5	173.9	0	0	0	0	0	113.1	S47 S52 K53	S47-A50 PolarHBondContact O-N 2.74Å; A50-S52 PolarHBondContact O-N 2.96Å; A50-S52 VanDerWaalsContact O-N 3.13Å; A50-K53 PolarHBondContact O-N 2.83Å
51	A	47.2	Very low	48.7	Very low	36 Å²	36	109.1 Å²	109.1	30%	0.298	65%	0.65	S	S	.	*	G	3₁₀ helix	trans	-59.2	-23.6	176.5	0	0	0	0	0	113.1	V46 S47 K53 Y54 S55	V46-A51 HydrophobicContact CB-CB 4.41Å; V46-A51 HydrophobicContact CG2-CB 4.42Å; S47-A51 PolarHBondContact O-N 3.38Å; A51-K53 PolarHBondContact O-N 2.89Å; A51-Y54 CarbonylContact O-C 3.41Å; A51-Y54 PolarHBondContact O-N 3.37Å; A51-S55 PolarHBondContact O-N 2.73Å
52	S	46.7	Very low	48.2	Very low	98 Å²	98	105.5 Å²	105.5	69%	0.685	64%	0.639	S	S	*	*	G	3₁₀ helix	trans	-64.6	-16.3	174.2	-175.5	0	0	0	0	114.2	A50	A50-S52 PolarHBondContact O-N 2.96Å; A50-S52 VanDerWaalsContact O-N 3.13Å
53	K	47.7	Very low	48.4	Very low	195 Å²	195	109.9 Å²	109.9	85%	0.848	65%	0.65	S	S	*	*	G	3₁₀ helix	trans	-87.4	-13.4	172	-72.1	-167.5	179	-174.5	0	113.5	A50 A51 S55	A50-K53 PolarHBondContact O-N 2.83Å; A51-K53 PolarHBondContact O-N 2.89Å; K53-S55 VanDerWaalsContact C-N 3.35Å
54	Y	46.9	Very low	48.5	Very low	177 Å²	177	112.8 Å²	112.8	69%	0.694	66%	0.663	S	S	*	*	G	3₁₀ helix	trans	-103.7	31.8	169.5	-60	-84.9	0	0	0	110.6	A51 S56	A51-Y54 CarbonylContact O-C 3.41Å; A51-Y54 PolarHBondContact O-N 3.37Å; Y54-S56 PolarHBondContact O-N 3.5Å
55	S	40.2	Very low	48.8	Very low	96 Å²	96	114.5 Å²	114.5	67%	0.671	67%	0.666	S	S	*	*	S	Bend	trans	-57.1	98.6	150.7	176.8	0	0	0	0	104.8	A51 K53 A57	A51-S55 PolarHBondContact O-N 2.73Å; K53-S55 VanDerWaalsContact C-N 3.35Å; S55-A57 PolarHBondContact O-N 2.9Å
56	S	47.1	Very low	49.3	Very low	104 Å²	104	111.9 Å²	111.9	73%	0.727	65%	0.653	S	S	*	*			trans	-34.3	109.5	174.3	-51.5	0	0	0	0	106.7	Y54 S58	Y54-S56 PolarHBondContact O-N 3.5Å; S56-S58 VanDerWaalsContact C-N 3.26Å; S56-S58 PolarHBondContact O-N 3.33Å
57	A	48.4	Very low	49.9	Very low	68 Å²	68	113.1 Å²	113.1	56%	0.562	67%	0.666	S	S	*	*			trans	-53.8	106.6	175.7	0	0	0	0	0	103.9	S55 V59	S55-A57 PolarHBondContact O-N 2.9Å; A57-V59 PolarHBondContact O-N 3.31Å
58	S	42.9	Very low	50.6	Low	69 Å²	69	118.6 Å²	118.6	48%	0.483	68%	0.68	S	S	.	*			trans	-52.5	117	-179.6	-179.3	0	0	0	0	104.3	S56 T60 S61	S56-S58 VanDerWaalsContact C-N 3.26Å; S56-S58 PolarHBondContact O-N 3.33Å; S58-T60 PolarHBondContact O-N 3.28Å; S58-T60 PolarHBondContact OG-OG1 3.23Å; S58-S61 PolarHBondContact O-N 3.35Å; S58-S61 PolarHBondContact O-OG 3.39Å
59	V	52.4	Low	50.8	Low	122 Å²	122	119.3 Å²	119.3	74%	0.739	67%	0.671	S	S	*	*	G	3₁₀ helix	trans	-56	-10.4	-175.1	-85.1	0	0	0	0	112.3	A57 S61 L62	A57-V59 PolarHBondContact O-N 3.31Å; V59-S61 PolarHBondContact O-N 3.16Å; V59-L62 HydrophobicContact CG1-CD1 4.47Å
60	T	52.4	Low	51	Low	126 Å²	126	118.1 Å²	118.1	77%	0.773	67%	0.671	S	S	*	*	G	3₁₀ helix	trans	-69.9	-7.7	167	46.8	0	0	0	0	115.6	S58	S58-T60 PolarHBondContact O-N 3.28Å; S58-T60 PolarHBondContact OG-OG1 3.23Å
61	S	46.9	Very low	51.1	Low	84 Å²	84	122.1 Å²	122.1	59%	0.587	69%	0.685	S	S	*	*	G	3₁₀ helix	trans	-111.5	-2.1	-179.1	53.3	0	0	0	0	114.6	S58 V59 K63	S58-S61 PolarHBondContact O-N 3.35Å; S58-S61 PolarHBondContact O-OG 3.39Å; V59-S61 PolarHBondContact O-N 3.16Å; S61-K63 VanDerWaalsContact C-N 3.34Å; S61-K63 PolarHBondContact O-N 2.95Å
62	L	47.9	Very low	51	Low	122 Å²	122	124.7 Å²	124.7	64%	0.639	71%	0.706	S	S	*	*			trans	-75.2	90.5	169.4	-61.2	179.5	0	0	0	108.3	V59	V59-L62 HydrophobicContact CG1-CD1 4.47Å
63	K	55.3	Low	50.8	Low	193 Å²	193	123.1 Å²	123.1	84%	0.839	71%	0.705	S	S	*	*	P	Polyproline II helix	trans	-56.2	130	163.8	-93.4	-179.1	178.4	174.2	0	107.5	S61 L65	S61-K63 VanDerWaalsContact C-N 3.34Å; S61-K63 PolarHBondContact O-N 2.95Å; K63-L65 PolarHBondContact O-N 3Å
64	P	57.3	Low	50.8	Low	123 Å²	123	119.9 Å²	119.9	80%	0.799	71%	0.707	S	S	*	*	P	Polyproline II helix	trans	-54.6	132.5	179.6	18.1	-29	0	0	0	110.2	S66	P64-S66 PolarHBondContact O-N 2.84Å
65	L	56.4	Low	50.7	Low	140 Å²	140	117.4 Å²	117.4	73%	0.733	72%	0.716	S	S	*	*	P	Polyproline II helix	trans	-56.4	127.8	173.9	-70.9	159.8	0	0	0	107.9	K63 E69	K63-L65 PolarHBondContact O-N 3Å; L65-E69 WeakPolarHBondContact CD2-OE2 3.11Å
66	S	58	Low	50.9	Low	81 Å²	81	117.9 Å²	117.9	57%	0.566	73%	0.725	S	S	*	*	P	Polyproline II helix	trans	-64.4	140	-178.5	170.6	0	0	0	0	108.7	P64 K68 E69	P64-S66 PolarHBondContact O-N 2.84Å; S66-K68 PolarHBondContact O-N 3.49Å; S66-E69 PolarHBondContact O-N 2.73Å
67	S	60.9	Low	50.4	Low	107 Å²	107	118.6 Å²	118.6	75%	0.748	73%	0.73	S	S	*	*	T	Hydrogen-bonded Turn	trans	-49.7	-15.4	-174.9	-38.3	0	0	0	0	114.9	E69	S67-E69 VanDerWaalsContact C-N 3.32Å; S67-E69 PolarHBondContact O-N 3.38Å
68	K	56.7	Low	50.1	Low	191 Å²	191	119.1 Å²	119.1	83%	0.83	74%	0.742	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.6	-25.1	176.8	-165.7	167.7	-176.5	176.4	0	114	S66	S66-K68 PolarHBondContact O-N 3.49Å
69	E	55.6	Low	49.8	Very low	126 Å²	126	125.2 Å²	125.2	59%	0.589	76%	0.763	S	S	*	*	S	Bend	trans	-87.7	-19	-174.8	-67.5	166.4	143.6	0	0	113.2	L65 S66 S67 N71	L65-E69 WeakPolarHBondContact CD2-OE2 3.11Å; S66-E69 PolarHBondContact O-N 2.73Å; S67-E69 VanDerWaalsContact C-N 3.32Å; S67-E69 PolarHBondContact O-N 3.38Å; E69-N71 VanDerWaalsContact C-N 3.34Å; E69-N71 PolarHBondContact O-N 2.88Å
70	M	53.8	Low	49.1	Very low	171 Å²	171	121.4 Å²	121.4	84%	0.842	75%	0.748	S	S	*	*	S	Bend	trans	-77.9	-9	-175.6	-90.9	176.7	55.4	0	0	115.4
71	N	52.2	Low	48.9	Very low	136 Å²	136	121.4 Å²	121.4	73%	0.727	75%	0.748	S	S	*	*			trans	-105.3	38	-174.1	-161	14.2	0	0	0	113.6	E69	E69-N71 VanDerWaalsContact C-N 3.34Å; E69-N71 PolarHBondContact O-N 2.88Å
72	A	46.1	Very low	48.9	Very low	89 Å²	89	122.9 Å²	122.9	74%	0.736	75%	0.754	S	S	*	*	S	Bend	trans	-124.3	86.8	174.1	0	0	0	0	0	110.6
73	G	41.6	Very low	48.7	Very low	65 Å²	65	122 Å²	122	67%	0.67	75%	0.754	S	S	*	*			trans	93.6	109	145.4	0	0	0	0	0	117.1
74	S	48.5	Very low	48.1	Very low	127 Å²	127	114.9 Å²	114.9	89%	0.888	74%	0.735	S	S	*	*			trans	-171.7	77.3	134	-79.9	0	0	0	0	109.3	A76	S74-A76 PolarHBondContact O-N 3.42Å
75	S	43.9	Very low	47.9	Very low	126 Å²	126	114.6 Å²	114.6	88%	0.881	73%	0.726	S	S	*	*			trans	-87.6	96.3	172.1	-43	0	0	0	0	108.7	S77	S75-S77 PolarHBondContact O-N 2.99Å
76	A	45.2	Very low	47.7	Very low	105 Å²	105	110.6 Å²	110.6	87%	0.868	71%	0.713	S	S	*	*			trans	-74	111	170.8	0	0	0	0	0	109.3	S74	S74-A76 PolarHBondContact O-N 3.42Å
77	S	36.7	Very low	47.9	Very low	120 Å²	120	110 Å²	110	84%	0.839	71%	0.706	S	S	*	*			trans	-69.1	124.9	170.3	161.3	0	0	0	0	109.6	S75	S75-S77 PolarHBondContact O-N 2.99Å
78	G	40.7	Very low	47.6	Very low	78 Å²	78	109.5 Å²	109.5	80%	0.804	69%	0.691	S	S	*	*			trans	-151.9	73.3	-178.4	0	0	0	0	0	110.7
79	E	36.4	Very low	47.9	Very low	197 Å²	197	103 Å²	103	92%	0.921	67%	0.672	S	S	*	*			trans	-78.3	119.3	170.7	-159	167.3	-161.2	0	0	108.2
80	G	38.4	Very low	48.3	Very low	42 Å²	42	105 Å²	105	43%	0.433	67%	0.674	S	S	.	*			trans	139	62.1	176.5	0	0	0	0	0	115.2	T82 T83 G84	G80-T82 PolarHBondContact O-N 3.17Å; G80-T83 PolarHBondContact O-N 3.03Å; G80-G84 PolarHBondContact O-N 3.28Å
81	T	49.1	Very low	48.7	Very low	126 Å²	126	102.3 Å²	102.3	77%	0.773	66%	0.66	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.1	-6.2	-171.2	7.5	0	0	0	0	117	I85	T81-I85 VanDerWaalsContact O-CD1 3.23Å; T81-I85 WeakPolarHBondContact O-CD1 3.31Å; T81-I85 WeakPolarHBondContact O-CG1 3.27Å
82	T	47.1	Very low	49.2	Very low	116 Å²	116	99.1 Å²	99.1	71%	0.712	64%	0.642	S	S	*	*	T	Hydrogen-bonded Turn	trans	-108.5	-38	178.2	42.3	0	0	0	0	113.4	G80 G84 I85 A86	G80-T82 PolarHBondContact O-N 3.17Å; T82-G84 VanDerWaalsContact C-N 3.31Å; T82-G84 PolarHBondContact O-N 3.39Å; T82-I85 PolarHBondContact O-N 3.37Å; T82-A86 PolarHBondContact O-N 2.92Å
83	T	42.5	Very low	49.9	Very low	103 Å²	103	99.6 Å²	99.6	63%	0.632	63%	0.629	S	S	*	*	H	α-helix	trans	-68	-34.2	176	-48.5	0	0	0	0	111.4	G80 T87	G80-T83 PolarHBondContact O-N 3.03Å; T83-T87 WeakPolarHBondContact O-CB 3.48Å; T83-T87 PolarHBondContact O-N 3.48Å; T83-T87 VanDerWaalsContact O-N 3.13Å; T83-T87 PolarHBondContact O-OG1 3.27Å
84	G	43.3	Very low	50.9	Low	44 Å²	44	104.2 Å²	104.2	45%	0.454	63%	0.626	S	S	.	*	H	α-helix	trans	-61.5	-44.6	175.3	0	0	0	0	0	113.6	G80 T82 T87 F88	G80-G84 PolarHBondContact O-N 3.28Å; T82-G84 VanDerWaalsContact C-N 3.31Å; T82-G84 PolarHBondContact O-N 3.39Å; G84-T87 PolarHBondContact O-N 3.33Å; G84-F88 VanDerWaalsContact O-CB 3.3Å; G84-F88 WeakPolarHBondContact O-CB 3.35Å; G84-F88 PolarHBondContact O-N 3.3Å
85	I	53.5	Low	51.6	Low	116 Å²	116	101.7 Å²	101.7	60%	0.595	61%	0.605	S	S	*	*	H	α-helix	trans	-67.5	-45	-177.6	-59.8	174.3	0	0	0	110.9	T81 T82 T87 F88 A89	T81-I85 VanDerWaalsContact O-CD1 3.23Å; T81-I85 WeakPolarHBondContact O-CD1 3.31Å; T81-I85 WeakPolarHBondContact O-CG1 3.27Å; T82-I85 PolarHBondContact O-N 3.37Å; I85-T87 VanDerWaalsContact C-N 3.26Å; I85-T87 PolarHBondContact O-N 2.9Å; I85-F88 PolarHBondContact O-N 2.97Å; I85-A89 WeakPolarHBondContact O-CB 3.35Å; I85-A89 PolarHBondContact O-N 3.2Å
86	A	52.3	Low	52.3	Low	56 Å²	56	98.1 Å²	98.1	46%	0.463	58%	0.576	S	S	.	*	H	α-helix	trans	-63.5	-34.8	177.4	0	0	0	0	0	112.1	T82 R90	T82-A86 PolarHBondContact O-N 2.92Å; A86-R90 WeakPolarHBondContact O-CG 3.41Å; A86-R90 PolarHBondContact O-N 3.42Å
87	T	61.1	Low	53	Low	69 Å²	69	97.8 Å²	97.8	42%	0.423	56%	0.557	S	S	.	*	H	α-helix	trans	-71.8	-41.5	176.6	-54.4	0	0	0	0	110.9	T83 G84 I85 R90 Q91	T83-T87 WeakPolarHBondContact O-CB 3.48Å; T83-T87 PolarHBondContact O-N 3.48Å; T83-T87 VanDerWaalsContact O-N 3.13Å; T83-T87 PolarHBondContact O-OG1 3.27Å; G84-T87 PolarHBondContact O-N 3.33Å; I85-T87 VanDerWaalsContact C-N 3.26Å; I85-T87 PolarHBondContact O-N 2.9Å; T87-R90 PolarHBondContact O-N 2.96Å; T87-Q91 WeakPolarHBondContact O-CG 3.48Å; T87-Q91 PolarHBondContact O-N 3.33Å
88	F	55.7	Low	54.1	Low	97 Å²	97	98.6 Å²	98.6	43%	0.425	55%	0.551	S	S	.	*	H	α-helix	trans	-64.1	-44.6	176.3	-178	-112.2	0	0	0	112.3	G84 I85 R90 Q91 I92 L129	G84-F88 VanDerWaalsContact O-CB 3.3Å; G84-F88 WeakPolarHBondContact O-CB 3.35Å; G84-F88 PolarHBondContact O-N 3.3Å; I85-F88 PolarHBondContact O-N 2.97Å; F88-R90 VanDerWaalsContact C-N 3.32Å; F88-R90 PolarHBondContact O-N 2.69Å; F88-Q91 WeakPolarHBondContact O-CB 3.36Å; F88-Q91 PolarHBondContact O-N 3.16Å; F88-Q91 VanDerWaalsContact O-N 3.11Å; F88-I92 HydrophobicContact CD1-CD1 3.76Å; F88-I92 HydrophobicContact CE1-CD1 3.27Å; F88-I92 HydrophobicContact CE1-CG1 4.31Å; F88-I92 HydrophobicContact CE2-CD1 4.14Å; F88-I92 HydrophobicContact CE2-CG1 4.38Å; F88-I92 HydrophobicContact CG-CD1 4.38Å; F88-I92 HydrophobicContact CZ-CD1 3.49Å; F88-I92 VanDerWaalsContact CZ-CD1 3.49Å; F88-I92 HydrophobicContact CZ-CG1 4.18Å; F88-I92 PolarHBondContact O-N 2.88Å; F88-L129 HydrophobicContact CE1-CD2 4.13Å; F88-L129 HydrophobicContact CZ-CD2 4Å
89	A	61.5	Low	54.9	Low	53 Å²	53	100 Å²	100	44%	0.438	54%	0.541	S	S	.	.	H	α-helix	trans	-59.5	-43.2	175.1	0	0	0	0	0	111.7	I85 Q91 I92 Q93	I85-A89 WeakPolarHBondContact O-CB 3.35Å; I85-A89 PolarHBondContact O-N 3.2Å; A89-Q91 VanDerWaalsContact C-N 3.33Å; A89-Q91 PolarHBondContact O-N 3.11Å; A89-I92 PolarHBondContact O-N 2.95Å; A89-Q93 WeakPolarHBondContact O-CB 3.36Å; A89-Q93 PolarHBondContact O-N 3.36Å
90	R	63.9	Low	55.5	Low	169 Å²	169	92.8 Å²	92.8	64%	0.638	52%	0.519	S	S	*	.	H	α-helix	trans	-66.5	-32	174.9	-75	-177.9	-179.9	-163.3	0.3	113.1	A86 T87 F88 R94	A86-R90 WeakPolarHBondContact O-CG 3.41Å; A86-R90 PolarHBondContact O-N 3.42Å; T87-R90 PolarHBondContact O-N 2.96Å; F88-R90 VanDerWaalsContact C-N 3.32Å; F88-R90 PolarHBondContact O-N 2.69Å; R90-R94 WeakPolarHBondContact O-CG 3.13Å; R90-R94 PolarHBondContact O-N 2.93Å; R90-R94 VanDerWaalsContact O-N 3.16Å
91	Q	62.5	Low	56.5	Low	114 Å²	114	95 Å²	95	53%	0.533	52%	0.521	S	S	.	.	H	α-helix	trans	-69.2	-44.5	174.8	-76.7	175.3	-2.9	0	0	111.2	T87 F88 A89 Q93 R94 V95	T87-Q91 WeakPolarHBondContact O-CG 3.48Å; T87-Q91 PolarHBondContact O-N 3.33Å; F88-Q91 WeakPolarHBondContact O-CB 3.36Å; F88-Q91 PolarHBondContact O-N 3.16Å; F88-Q91 VanDerWaalsContact O-N 3.11Å; A89-Q91 VanDerWaalsContact C-N 3.33Å; A89-Q91 PolarHBondContact O-N 3.11Å; Q91-Q93 VanDerWaalsContact C-N 3.33Å; Q91-Q93 PolarHBondContact O-N 3.41Å; Q91-R94 PolarHBondContact O-N 2.93Å; Q91-V95 WeakPolarHBondContact O-CG2 3.39Å; Q91-V95 PolarHBondContact O-N 3.18Å
92	I	64	Low	56.6	Low	69 Å²	69	93.7 Å²	93.7	35%	0.354	51%	0.508	S	S	.	.	H	α-helix	trans	-61.3	-44.7	175	-66.8	168.5	0	0	0	110.3	F88 A89 R94 V95 L96	F88-I92 HydrophobicContact CD1-CD1 3.76Å; F88-I92 HydrophobicContact CE1-CD1 3.27Å; F88-I92 HydrophobicContact CE1-CG1 4.31Å; F88-I92 HydrophobicContact CE2-CD1 4.14Å; F88-I92 HydrophobicContact CE2-CG1 4.38Å; F88-I92 HydrophobicContact CG-CD1 4.38Å; F88-I92 HydrophobicContact CZ-CD1 3.49Å; F88-I92 VanDerWaalsContact CZ-CD1 3.49Å; F88-I92 HydrophobicContact CZ-CG1 4.18Å; F88-I92 PolarHBondContact O-N 2.88Å; A89-I92 PolarHBondContact O-N 2.95Å; I92-R94 VanDerWaalsContact C-N 3.31Å; I92-R94 PolarHBondContact O-N 3.4Å; I92-V95 PolarHBondContact O-N 2.87Å; I92-L96 HydrophobicContact CG2-CD1 3.75Å; I92-L96 HydrophobicContact CG2-CG 4.13Å; I92-L96 WeakPolarHBondContact O-CG 3.47Å; I92-L96 PolarHBondContact O-N 2.92Å
93	Q	59	Low	56.7	Low	100 Å²	100	95.8 Å²	95.8	47%	0.467	50%	0.504	S	S	.	.	H	α-helix	trans	-58.3	-44.1	179.3	-171.8	-179.7	-13.3	0	0	111.6	A89 Q91 L96 E97	A89-Q93 WeakPolarHBondContact O-CB 3.36Å; A89-Q93 PolarHBondContact O-N 3.36Å; Q91-Q93 VanDerWaalsContact C-N 3.33Å; Q91-Q93 PolarHBondContact O-N 3.41Å; Q93-L96 PolarHBondContact O-N 3.26Å; Q93-E97 WeakPolarHBondContact CG-OE1 3.3Å; Q93-E97 PolarHBondContact NE2-OE1 3.32Å; Q93-E97 WeakPolarHBondContact O-CB 3.4Å; Q93-E97 WeakPolarHBondContact O-CG 3.44Å; Q93-E97 PolarHBondContact O-N 3.36Å
94	R	62.9	Low	56.9	Low	161 Å²	161	98.8 Å²	98.8	61%	0.608	51%	0.511	S	S	*	.	H	α-helix	trans	-63.4	-43.2	175.7	-72	-176.8	-147.4	-153.1	3.9	112.7	R90 Q91 I92 L96 E97 D98	R90-R94 WeakPolarHBondContact O-CG 3.13Å; R90-R94 PolarHBondContact O-N 2.93Å; R90-R94 VanDerWaalsContact O-N 3.16Å; Q91-R94 PolarHBondContact O-N 2.93Å; I92-R94 VanDerWaalsContact C-N 3.31Å; I92-R94 PolarHBondContact O-N 3.4Å; R94-L96 VanDerWaalsContact C-N 3.28Å; R94-L96 PolarHBondContact O-N 3.47Å; R94-E97 PolarHBondContact O-N 3.35Å; R94-D98 VanDerWaalsContact O-CB 3.31Å; R94-D98 WeakPolarHBondContact O-CB 3.39Å; R94-D98 VanDerWaalsContact O-CG 3.22Å; R94-D98 PolarHBondContact O-N 3.13Å
95	V	62.9	Low	56.7	Low	74 Å²	74	102.2 Å²	102.2	45%	0.448	51%	0.511	S	S	.	.	H	α-helix	trans	-60	-41.2	176.7	172.9	0	0	0	0	110.7	Q91 I92 D99	Q91-V95 WeakPolarHBondContact O-CG2 3.39Å; Q91-V95 PolarHBondContact O-N 3.18Å; I92-V95 PolarHBondContact O-N 2.87Å; V95-D99 VanDerWaalsContact O-CB 3.27Å; V95-D99 WeakPolarHBondContact O-CB 3.37Å; V95-D99 PolarHBondContact O-N 2.74Å
96	L	60.2	Low	55.9	Low	52 Å²	52	103.4 Å²	103.4	27%	0.272	52%	0.517	S	S	.	.	H	α-helix	trans	-72.8	-32.3	178.7	-65.1	175.2	0	0	0	113.6	I92 Q93 R94 G100 L101 L102	I92-L96 HydrophobicContact CG2-CD1 3.75Å; I92-L96 HydrophobicContact CG2-CG 4.13Å; I92-L96 WeakPolarHBondContact O-CG 3.47Å; I92-L96 PolarHBondContact O-N 2.92Å; Q93-L96 PolarHBondContact O-N 3.26Å; R94-L96 VanDerWaalsContact C-N 3.28Å; R94-L96 PolarHBondContact O-N 3.47Å; L96-G100 PolarHBondContact O-N 3.41Å; L96-L101 HydrophobicContact CD2-CB 4.09Å; L96-L101 HydrophobicContact CD2-CD1 3.88Å; L96-L101 PolarHBondContact O-N 3.35Å; L96-L102 HydrophobicContact CB-CG 4.19Å; L96-L102 PolarHBondContact O-N 2.84Å
97	E	60.3	Low	54.9	Low	98 Å²	98	103.6 Å²	103.6	46%	0.458	53%	0.525	S	S	.	.	H	α-helix	trans	-67.5	-47.1	171.6	-76.8	171.7	-170.4	0	0	111	Q93 R94 G100 L102	Q93-E97 WeakPolarHBondContact CG-OE1 3.3Å; Q93-E97 PolarHBondContact NE2-OE1 3.32Å; Q93-E97 WeakPolarHBondContact O-CB 3.4Å; Q93-E97 WeakPolarHBondContact O-CG 3.44Å; Q93-E97 PolarHBondContact O-N 3.36Å; R94-E97 PolarHBondContact O-N 3.35Å; E97-G100 PolarHBondContact O-N 2.74Å; E97-G100 VanDerWaalsContact O-N 3.16Å; E97-L102 HydrophobicContact CG-CD1 3.46Å; E97-L102 VanDerWaalsContact CG-CD1 3.46Å; E97-L102 HydrophobicContact CG-CG 4.45Å
98	D	58.6	Low	54	Low	136 Å²	136	108.1 Å²	108.1	73%	0.727	54%	0.541	S	S	*	.	H	α-helix	trans	-66.2	-38.6	-179.3	-72.3	-15.1	0	0	0	111.8	R94 G100	R94-D98 VanDerWaalsContact O-CB 3.31Å; R94-D98 WeakPolarHBondContact O-CB 3.39Å; R94-D98 VanDerWaalsContact O-CG 3.22Å; R94-D98 PolarHBondContact O-N 3.13Å; D98-G100 PolarHBondContact O-N 3.46Å
99	D	57	Low	53.6	Low	108 Å²	108	112.8 Å²	112.8	58%	0.578	56%	0.564	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.8	-4.9	176.8	-70.7	-20	0	0	0	112.8	V95 L101	V95-D99 VanDerWaalsContact O-CB 3.27Å; V95-D99 WeakPolarHBondContact O-CB 3.37Å; V95-D99 PolarHBondContact O-N 2.74Å; D99-L101 HydrophobicContact CB-CD1 4.03Å; D99-L101 HydrophobicContact CB-CG 3.96Å; D99-L101 PolarHBondContact O-N 3.06Å
100	G	50.9	Low	52.9	Low	46 Å²	46	117.1 Å²	117.1	47%	0.474	58%	0.58	S	S	.	*	T	Hydrogen-bonded Turn	trans	66.5	18.8	-177.6	0	0	0	0	0	114.2	L96 E97 D98 L102	L96-G100 PolarHBondContact O-N 3.41Å; E97-G100 PolarHBondContact O-N 2.74Å; E97-G100 VanDerWaalsContact O-N 3.16Å; D98-G100 PolarHBondContact O-N 3.46Å; G100-L102 VanDerWaalsContact C-N 3.35Å
101	L	57.8	Low	51.8	Low	89 Å²	89	113.1 Å²	113.1	47%	0.466	58%	0.578	S	S	.	*			trans	-82.2	-14.7	179.8	-67.2	175.6	0	0	0	112.8	L96 D99 Y103	L96-L101 HydrophobicContact CD2-CB 4.09Å; L96-L101 HydrophobicContact CD2-CD1 3.88Å; L96-L101 PolarHBondContact O-N 3.35Å; D99-L101 HydrophobicContact CB-CD1 4.03Å; D99-L101 HydrophobicContact CB-CG 3.96Å; D99-L101 PolarHBondContact O-N 3.06Å; L101-Y103 WeakPolarHBondContact O-CD2 3.47Å; L101-Y103 PolarHBondContact O-N 3.48Å
102	L	51	Low	51	Low	98 Å²	98	109.5 Å²	109.5	51%	0.513	57%	0.565	S	S	.	*	S	Bend	trans	-75.4	80.7	160.5	-70.5	-175.4	0	0	0	108.6	L96 E97 G100 Q104	L96-L102 HydrophobicContact CB-CG 4.19Å; L96-L102 PolarHBondContact O-N 2.84Å; E97-L102 HydrophobicContact CG-CD1 3.46Å; E97-L102 VanDerWaalsContact CG-CD1 3.46Å; E97-L102 HydrophobicContact CG-CG 4.45Å; G100-L102 VanDerWaalsContact C-N 3.35Å; L102-Q104 PolarHBondContact O-N 3.44Å
103	Y	50	Low	50.1	Low	159 Å²	159	113.8 Å²	113.8	62%	0.624	58%	0.581	S	S	*	*			trans	-54.7	112.5	166.8	-69.9	-79.8	0	0	0	108	L101 Y105	L101-Y103 WeakPolarHBondContact O-CD2 3.47Å; L101-Y103 PolarHBondContact O-N 3.48Å; Y103-Y105 PolarHBondContact O-N 3.09Å
104	Q	45.8	Very low	49.5	Very low	166 Å²	166	117.5 Å²	117.5	78%	0.776	59%	0.592	S	S	*	*			trans	-52.6	111.5	161.6	-174.1	163	37.8	0	0	105.1	L102 I106	L102-Q104 PolarHBondContact O-N 3.44Å; Q104-I106 HydrophobicContact CB-CG1 4.28Å; Q104-I106 HydrophobicContact CG-CG1 3.99Å; Q104-I106 WeakPolarHBondContact O-CG1 3.47Å; Q104-I106 PolarHBondContact O-N 3.19Å
105	Y	40.2	Very low	48.6	Very low	116 Å²	116	116.3 Å²	116.3	46%	0.455	59%	0.593	S	S	.	*			trans	-68.3	74.2	-179.9	-137.6	-89.8	0	0	0	107.2	Y103 G107 P112 Y116	Y103-Y105 PolarHBondContact O-N 3.09Å; Y105-G107 PolarHBondContact O-N 3.39Å; Y105-P112 WeakPolarHBondContact OH-CD 3.22Å; Y105-P112 VanDerWaalsContact OH-CG 3.25Å; Y105-P112 WeakPolarHBondContact OH-CG 3.19Å; Y105-Y116 HydrophobicContact CD2-CE2 4.49Å; Y105-Y116 HydrophobicContact CE2-CD2 4.4Å; Y105-Y116 AromaticContact CE2-CE2 3.61Å; Y105-Y116 HydrophobicContact CE2-CE2 3.61Å
106	I	35.7	Very low	47.8	Very low	141 Å²	141	117.2 Å²	117.2	72%	0.723	59%	0.589	S	S	*	*			trans	-73.4	119.2	171.8	-53.9	165.8	0	0	0	103.7	Q104	Q104-I106 HydrophobicContact CB-CG1 4.28Å; Q104-I106 HydrophobicContact CG-CG1 3.99Å; Q104-I106 WeakPolarHBondContact O-CG1 3.47Å; Q104-I106 PolarHBondContact O-N 3.19Å
107	G	33	Very low	47.4	Very low	60 Å²	60	118.2 Å²	118.2	62%	0.619	60%	0.597	S	S	*	*			trans	-51.6	140.7	-157.4	0	0	0	0	0	114.6	Y105	Y105-G107 PolarHBondContact O-N 3.39Å
108	E	40.7	Very low	47	Very low	164 Å²	164	119.3 Å²	119.3	77%	0.766	60%	0.602	S	S	*	*			trans	-147.6	122	138.8	-107.5	172.8	-161.6	0	0	106.2	N110	E108-N110 PolarHBondContact O-N 3Å
109	E	48.5	Very low	46.7	Very low	196 Å²	196	117.8 Å²	117.8	92%	0.916	59%	0.593	S	S	*	*	S	Bend	trans	-67.7	69	179.9	-58.5	-178.1	176.7	0	0	109.4
110	N	45.7	Very low	46.5	Very low	143 Å²	143	117.6 Å²	117.6	77%	0.765	59%	0.592	S	S	*	*	S	Bend	trans	-158.3	57.3	175.5	-90	-49	0	0	0	111	E108 P112	E108-N110 PolarHBondContact O-N 3Å; N110-P112 VanDerWaalsContact O-CD 3.24Å; N110-P112 WeakPolarHBondContact O-CD 3.31Å
111	S	40.8	Very low	46.6	Very low	85 Å²	85	120.8 Å²	120.8	59%	0.594	60%	0.595	S	S	*	*			trans	28	82.1	153	178.6	0	0	0	0	118.6
112	P	46.9	Very low	46.4	Very low	39 Å²	39	122.9 Å²	122.9	25%	0.253	60%	0.602	S	S	.	*			trans	-102.3	29.6	157	36.6	-34.2	0	0	0	113	Y105 N110 Y114 E115 Y116	Y105-P112 WeakPolarHBondContact OH-CD 3.22Å; Y105-P112 VanDerWaalsContact OH-CG 3.25Å; Y105-P112 WeakPolarHBondContact OH-CG 3.19Å; N110-P112 VanDerWaalsContact O-CD 3.24Å; N110-P112 WeakPolarHBondContact O-CD 3.31Å; P112-Y114 PolarHBondContact O-N 2.85Å; P112-Y114 VanDerWaalsContact O-N 3.07Å; P112-E115 HydrophobicContact CB-CB 4.35Å; P112-E115 PolarHBondContact O-N 2.85Å; P112-Y116 HydrophobicContact CG-CE2 4.5Å; P112-Y116 WeakPolarHBondContact O-CD2 3.06Å; P112-Y116 PolarHBondContact O-N 2.87Å
113	F	43.5	Very low	46.4	Very low	159 Å²	159	123.9 Å²	123.9	70%	0.697	60%	0.6	S	S	*	*	H	α-helix	trans	-54.1	-26.1	166.9	-88.5	-80.6	0	0	0	112.1	T117	F113-T117 PolarHBondContact O-OG1 2.96Å
114	Y	47.1	Very low	46.5	Very low	178 Å²	178	119.2 Å²	119.2	70%	0.698	59%	0.585	S	S	*	*	H	α-helix	trans	-75.5	-28	175.2	-77	-82	0	0	0	114.2	P112 T117 H118	P112-Y114 PolarHBondContact O-N 2.85Å; P112-Y114 VanDerWaalsContact O-N 3.07Å; Y114-T117 PolarHBondContact O-OG1 3.42Å; Y114-H118 PolarHBondContact O-CD2 3.05Å
115	E	44.2	Very low	46.8	Very low	136 Å²	136	117.6 Å²	117.6	64%	0.636	58%	0.577	S	S	*	*	H	α-helix	trans	-79.1	-33.7	179.6	-70.5	-163.1	168.4	0	0	112	P112 T117 H118 L119	P112-E115 HydrophobicContact CB-CB 4.35Å; P112-E115 PolarHBondContact O-N 2.85Å; E115-T117 PolarHBondContact O-N 3.37Å; E115-H118 PolarHBondContact O-N 2.88Å; E115-L119 WeakPolarHBondContact O-CG 3.44Å; E115-L119 PolarHBondContact O-N 3.48Å
116	Y	46	Very low	47.4	Very low	93 Å²	93	121 Å²	121	37%	0.365	60%	0.595	S	S	.	*	H	α-helix	trans	-66.7	-36.6	177.3	-76.2	-80.8	0	0	0	113	Y105 P112 H118 L119 L120	Y105-Y116 HydrophobicContact CD2-CE2 4.49Å; Y105-Y116 HydrophobicContact CE2-CD2 4.4Å; Y105-Y116 AromaticContact CE2-CE2 3.61Å; Y105-Y116 HydrophobicContact CE2-CE2 3.61Å; P112-Y116 HydrophobicContact CG-CE2 4.5Å; P112-Y116 WeakPolarHBondContact O-CD2 3.06Å; P112-Y116 PolarHBondContact O-N 2.87Å; Y116-H118 VanDerWaalsContact C-N 3.34Å; Y116-L119 PolarHBondContact O-N 3.33Å; Y116-L120 WeakPolarHBondContact O-CB 3.36Å; Y116-L120 PolarHBondContact O-N 3.47Å
117	T	52.7	Low	48.1	Very low	72 Å²	72	120.6 Å²	120.6	44%	0.442	59%	0.588	S	S	.	*	H	α-helix	trans	-65.1	-39.4	176.3	44.2	0	0	0	0	111.8	F113 Y114 E115 E121	F113-T117 PolarHBondContact O-OG1 2.96Å; Y114-T117 PolarHBondContact O-OG1 3.42Å; E115-T117 PolarHBondContact O-N 3.37Å; T117-E121 WeakPolarHBondContact O-CB 3.18Å; T117-E121 WeakPolarHBondContact O-CG 3.25Å; T117-E121 PolarHBondContact O-N 3.43Å
118	H	52	Low	48.6	Very low	121 Å²	121	120.5 Å²	120.5	56%	0.56	59%	0.587	S	S	*	*	H	α-helix	trans	-69.1	-41.2	178	-77.5	-58.9	0	0	0	112.3	Y114 E115 Y116 E121 E122	Y114-H118 PolarHBondContact O-CD2 3.05Å; E115-H118 PolarHBondContact O-N 2.88Å; Y116-H118 VanDerWaalsContact C-N 3.34Å; H118-E121 PolarHBondContact O-N 3.38Å; H118-E122 WeakPolarHBondContact O-CB 3.41Å; H118-E122 PolarHBondContact O-N 3.07Å
119	L	51.8	Low	48.8	Very low	104 Å²	104	117.6 Å²	117.6	55%	0.545	58%	0.576	S	S	.	*	H	α-helix	trans	-68.8	-36.1	177.4	-69.4	173.5	0	0	0	112.6	E115 Y116 Y123	E115-L119 WeakPolarHBondContact O-CG 3.44Å; E115-L119 PolarHBondContact O-N 3.48Å; Y116-L119 PolarHBondContact O-N 3.33Å; L119-Y123 VanDerWaalsContact O-CB 3.22Å; L119-Y123 WeakPolarHBondContact O-CB 3.43Å; L119-Y123 PolarHBondContact O-N 3.46Å
120	L	52.8	Low	48.4	Very low	105 Å²	105	113.6 Å²	113.6	55%	0.55	56%	0.56	S	S	.	*	H	α-helix	trans	-66	-45	172.3	-100.6	144	0	0	0	111.3	Y116 Y123 I124	Y116-L120 WeakPolarHBondContact O-CB 3.36Å; Y116-L120 PolarHBondContact O-N 3.47Å; L120-Y123 PolarHBondContact O-N 3.43Å; L120-I124 HydrophobicContact CB-CD1 4.49Å; L120-I124 HydrophobicContact CD2-CD1 3.97Å; L120-I124 WeakPolarHBondContact O-CB 3.3Å; L120-I124 VanDerWaalsContact O-CD1 3.31Å; L120-I124 WeakPolarHBondContact O-CD1 3.24Å; L120-I124 WeakPolarHBondContact O-CG1 3.35Å; L120-I124 PolarHBondContact O-N 3.46Å
121	E	52.8	Low	48.2	Very low	112 Å²	112	110.9 Å²	110.9	52%	0.523	56%	0.557	S	S	.	*	H	α-helix	trans	-61.3	-44.4	175.4	-79.9	-175.7	175.7	0	0	111.9	T117 H118 I124 Q125	T117-E121 WeakPolarHBondContact O-CB 3.18Å; T117-E121 WeakPolarHBondContact O-CG 3.25Å; T117-E121 PolarHBondContact O-N 3.43Å; H118-E121 PolarHBondContact O-N 3.38Å; E121-I124 PolarHBondContact O-N 3.47Å; E121-Q125 WeakPolarHBondContact O-CB 3.36Å; E121-Q125 VanDerWaalsContact O-CG 3.3Å; E121-Q125 WeakPolarHBondContact O-CG 3.42Å; E121-Q125 PolarHBondContact O-N 3.41Å
122	E	53.7	Low	48	Very low	134 Å²	134	114 Å²	114	63%	0.626	57%	0.567	S	S	*	*	H	α-helix	trans	-63.9	-43.6	176.3	-112.8	-168.3	168.4	0	0	111.6	H118 I124 Q125 F126	H118-E122 WeakPolarHBondContact O-CB 3.41Å; H118-E122 PolarHBondContact O-N 3.07Å; E122-I124 PolarHBondContact O-N 2.76Å; E122-Q125 PolarHBondContact O-N 3.02Å; E122-F126 WeakPolarHBondContact O-CB 3.43Å; E122-F126 PolarHBondContact O-N 3.35Å
123	Y	49.5	Very low	47.7	Very low	119 Å²	119	117.9 Å²	117.9	47%	0.467	59%	0.589	S	S	.	*	H	α-helix	trans	-65.9	-39.5	178.4	-174.6	-102.5	0	0	0	112	L119 L120 F126 K127	L119-Y123 VanDerWaalsContact O-CB 3.22Å; L119-Y123 WeakPolarHBondContact O-CB 3.43Å; L119-Y123 PolarHBondContact O-N 3.46Å; L120-Y123 PolarHBondContact O-N 3.43Å; Y123-F126 PolarHBondContact O-N 2.95Å; Y123-K127 HydrophobicContact CE1-CD 4.2Å; Y123-K127 HydrophobicContact CE2-CD 3.88Å; Y123-K127 HydrophobicContact CE2-CG 4.39Å; Y123-K127 PolarHBondContact O-N 3.13Å; Y123-K127 WeakPolarHBondContact OH-CE 3.23Å; Y123-K127 PolarHBondContact OH-NZ 2.99Å
124	I	52.9	Low	47.4	Very low	61 Å²	61	115.1 Å²	115.1	31%	0.313	59%	0.587	S	S	.	*	H	α-helix	trans	-68.1	-38.4	177	-70.4	166.3	0	0	0	110.8	L120 E121 E122 G128 L129 I130	L120-I124 HydrophobicContact CB-CD1 4.49Å; L120-I124 HydrophobicContact CD2-CD1 3.97Å; L120-I124 WeakPolarHBondContact O-CB 3.3Å; L120-I124 VanDerWaalsContact O-CD1 3.31Å; L120-I124 WeakPolarHBondContact O-CD1 3.24Å; L120-I124 WeakPolarHBondContact O-CG1 3.35Å; L120-I124 PolarHBondContact O-N 3.46Å; E121-I124 PolarHBondContact O-N 3.47Å; E122-I124 PolarHBondContact O-N 2.76Å; I124-G128 PolarHBondContact O-N 2.98Å; I124-L129 PolarHBondContact O-N 3.42Å; I124-L129 VanDerWaalsContact O-N 3.09Å; I124-I130 HydrophobicContact CG2-CD1 3.97Å; I124-I130 HydrophobicContact CG2-CG1 3.41Å; I124-I130 VanDerWaalsContact CG2-CG1 3.41Å
125	Q	53	Low	47	Very low	131 Å²	131	112 Å²	112	61%	0.612	59%	0.591	S	S	*	*	H	α-helix	trans	-68.6	-46.3	172.2	-75.5	-175.1	30.3	0	0	111.8	E121 E122 K127 G128 I130	E121-Q125 WeakPolarHBondContact O-CB 3.36Å; E121-Q125 VanDerWaalsContact O-CG 3.3Å; E121-Q125 WeakPolarHBondContact O-CG 3.42Å; E121-Q125 PolarHBondContact O-N 3.41Å; E122-Q125 PolarHBondContact O-N 3.02Å; Q125-K127 VanDerWaalsContact C-N 3.35Å; Q125-K127 PolarHBondContact O-N 3.48Å; Q125-G128 PolarHBondContact O-N 3.49Å; Q125-I130 HydrophobicContact CG-CD1 4.04Å
126	F	51.2	Low	46.8	Very low	188 Å²	188	112.8 Å²	112.8	83%	0.825	60%	0.6	S	S	*	*	H	α-helix	trans	-67.5	-33.9	-174	-164.7	-92.2	0	0	0	112.4	E122 Y123 G128	E122-F126 WeakPolarHBondContact O-CB 3.43Å; E122-F126 PolarHBondContact O-N 3.35Å; Y123-F126 PolarHBondContact O-N 2.95Å; F126-G128 VanDerWaalsContact C-N 3.35Å
127	K	51.6	Low	46.3	Very low	132 Å²	132	116.4 Å²	116.4	57%	0.574	62%	0.62	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.8	10.2	173.1	-70.9	-163.1	174.8	-177.7	0	114.3	Y123 Q125 L129	Y123-K127 HydrophobicContact CE1-CD 4.2Å; Y123-K127 HydrophobicContact CE2-CD 3.88Å; Y123-K127 HydrophobicContact CE2-CG 4.39Å; Y123-K127 PolarHBondContact O-N 3.13Å; Y123-K127 WeakPolarHBondContact OH-CE 3.23Å; Y123-K127 PolarHBondContact OH-NZ 2.99Å; Q125-K127 VanDerWaalsContact C-N 3.35Å; Q125-K127 PolarHBondContact O-N 3.48Å; K127-L129 PolarHBondContact O-N 3.01Å
128	G	42.5	Very low	45.4	Very low	58 Å²	58	122.5 Å²	122.5	60%	0.598	64%	0.64	S	S	*	*	T	Hydrogen-bonded Turn	trans	60.8	28.9	171.8	0	0	0	0	0	113.9	I124 Q125 F126 I130	I124-G128 PolarHBondContact O-N 2.98Å; Q125-G128 PolarHBondContact O-N 3.49Å; F126-G128 VanDerWaalsContact C-N 3.35Å; G128-I130 VanDerWaalsContact C-N 3.32Å; G128-I130 PolarHBondContact O-N 3.5Å
129	L	44.7	Very low	44.6	Very low	103 Å²	103	122.1 Å²	122.1	54%	0.539	65%	0.648	S	S	.	*			trans	-92	17.6	-173.4	-152.1	76.9	0	0	0	113.5	F88 I124 K127 A131	F88-L129 HydrophobicContact CE1-CD2 4.13Å; F88-L129 HydrophobicContact CZ-CD2 4Å; I124-L129 PolarHBondContact O-N 3.42Å; I124-L129 VanDerWaalsContact O-N 3.09Å; K127-L129 PolarHBondContact O-N 3.01Å; L129-A131 PolarHBondContact O-N 3.02Å
130	I	41.8	Very low	44	Very low	112 Å²	112	128.4 Å²	128.4	57%	0.574	68%	0.683	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.1	47.4	170	-41	177.7	0	0	0	110.3	I124 Q125 G128	I124-I130 HydrophobicContact CG2-CD1 3.97Å; I124-I130 HydrophobicContact CG2-CG1 3.41Å; I124-I130 VanDerWaalsContact CG2-CG1 3.41Å; Q125-I130 HydrophobicContact CG-CD1 4.04Å; G128-I130 VanDerWaalsContact C-N 3.32Å; G128-I130 PolarHBondContact O-N 3.5Å
131	A	40.5	Very low	43.6	Very low	86 Å²	86	129.6 Å²	129.6	71%	0.711	69%	0.689	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.5	-6.2	164.7	0	0	0	0	0	112.5	L129	L129-A131 PolarHBondContact O-N 3.02Å
132	L	37.6	Very low	43.1	Very low	152 Å²	152	130.5 Å²	130.5	80%	0.796	70%	0.698	S	S	*	*			trans	-145.9	66.8	-170.6	-99	104.7	0	0	0	113.8
133	V	39.4	Very low	42.5	Very low	119 Å²	119	130.3 Å²	130.3	72%	0.721	70%	0.702	S	S	*	*			trans	-134.6	99.5	146.6	-176.3	0	0	0	0	107.8	S135	V133-S135 PolarHBondContact O-N 3.41Å
134	P	37.9	Very low	42.1	Very low	101 Å²	101	130.9 Å²	130.9	66%	0.656	72%	0.716	S	S	*	*			trans	-63.1	110	172.2	24.1	-30	0	0	0	108.6	N136	P134-N136 PolarHBondContact O-N 2.86Å
135	S	39.2	Very low	41.4	Very low	113 Å²	113	135.3 Å²	135.3	79%	0.79	74%	0.741	S	S	*	*			trans	-61.9	87.3	166.5	-68.7	0	0	0	0	109	V133 H137	V133-S135 PolarHBondContact O-N 3.41Å; S135-H137 PolarHBondContact O-N 2.79Å
136	N	39.3	Very low	40.7	Very low	153 Å²	153	135.6 Å²	135.6	82%	0.818	75%	0.75	S	S	*	*			trans	-70.7	61.5	159.2	-76.7	-58.5	0	0	0	108.9	P134	P134-N136 PolarHBondContact O-N 2.86Å
137	H	34.4	Very low	39.9	Very low	168 Å²	168	131.9 Å²	131.9	78%	0.778	74%	0.744	S	S	*	*			trans	-98.8	89.8	160.9	-149.5	48.3	0	0	0	105.9	S135 P139	S135-H137 PolarHBondContact O-N 2.79Å; H137-P139 WeakPolarHBondContact O-CD 3.18Å
138	K	34.9	Very low	39	Very low	201 Å²	201	131.8 Å²	131.8	87%	0.874	76%	0.757	S	S	*	*			trans	-77.6	109.6	174.8	-165.2	-179.1	-173.9	-174.8	0	106.9
139	P	35.9	Very low	38.7	Very low	112 Å²	112	138 Å²	138	73%	0.727	77%	0.771	S	S	*	*			trans	-96.4	103.3	174.1	29	-11.8	0	0	0	107.9	H137	H137-P139 WeakPolarHBondContact O-CD 3.18Å
140	N	39	Very low	38.2	Very low	236 Å²	236	141.2 Å²	141.2	100%	1.262	79%	0.792	S	S	*	*			trans	-168.3	0	148.7	-134.6	-11.5	0	0	0	109.6

Retrieved 140 of 140 residues in 47.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).