A0A077Z3J0_TRITR Loading...

40S ribosomal protein S27

AlphaFold DB , UniProt , Accession A0A077Z3J0, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 84 aa.

						>A0A077Z3J0_TRITR|A0A077Z3J0
MPLAKDLLHPSAEEEKRKHKLKHLVPHPKSYFMDVKCGMCYKITTVFSHAQTVIVCVGCSTVLCRPRGGLAKLTEGCSFRKKQY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	54.8	Low	84.1	Confident	227 Å²	227	121.1 Å²	121.1	100%	1.118	66%	0.662	S	S	*	*				0	127.7	0	-57.5	-64.3	-159.5	0	0	107.3	L3	M1-L3 PolarHBondContact O-N 2.86Å
2	P	73.6	Confident	84.8	Confident	110 Å²	110	116.4 Å²	116.4	71%	0.714	65%	0.652	S	S	*	*	P	Polyproline II helix	trans	-59	140.9	166.3	26.9	-29.7	0	0	0	108
3	L	82.7	Confident	85.5	Confident	161 Å²	161	118.1 Å²	118.1	84%	0.843	65%	0.651	S	S	*	*	P	Polyproline II helix	trans	-49.9	151.4	170.1	-77.4	136.1	0	0	0	109.9	M1 K5	M1-L3 PolarHBondContact O-N 2.86Å; L3-K5 PolarHBondContact O-N 3.2Å
4	A	84.5	Confident	85.9	Confident	107 Å²	107	116.1 Å²	116.1	88%	0.884	64%	0.635	S	S	*	*	P	Polyproline II helix	trans	-50.6	127.5	175.9	0	0	0	0	0	110
5	K	84.1	Confident	86.4	Confident	149 Å²	149	112.2 Å²	112.2	65%	0.648	61%	0.61	S	S	*	*	P	Polyproline II helix	trans	-99.4	134.9	179.8	-67.6	-174	177.4	-175	0	109.7	L3 L7	L3-K5 PolarHBondContact O-N 3.2Å; K5-L7 PolarHBondContact O-N 3.35Å
6	D	89.3	Confident	86.8	Confident	92 Å²	92	115.1 Å²	115.1	49%	0.492	62%	0.615	S	S	.	*	P	Polyproline II helix	trans	-73.8	117.4	169.3	-169.8	-13.3	0	0	0	109.5	L8 H9	D6-L8 PolarHBondContact OD1-N 3.21Å; D6-H9 PolarHBondContact OD1-N 3.41Å; D6-H9 IonicContact OD1-ND1 3.09Å; D6-H9 WeakPolarHBondContact OD2-CB 3.4Å; D6-H9 IonicContact OD2-CG 3.64Å; D6-H9 IonicContact OD2-ND1 3.68Å; D6-H9 PolarHBondContact OD2-ND1 3.36Å; D6-H9 VanDerWaalsContact OD2-ND1 3.09Å
7	L	88.8	Confident	87.3	Confident	141 Å²	141	120.9 Å²	120.9	74%	0.738	63%	0.627	S	S	*	*	S	Bend	trans	-91.7	-23.3	178.4	-63.3	179	0	0	0	112.8	K5	K5-L7 PolarHBondContact O-N 3.35Å
8	L	91.8	Very high	87.6	Confident	126 Å²	126	118.5 Å²	118.5	66%	0.66	61%	0.611	S	S	*	*	S	Bend	trans	-84.5	-31.5	-176.4	-68.2	171.5	0	0	0	111.2	D6 P10 L24	D6-L8 PolarHBondContact OD1-N 3.21Å; L8-P10 VanDerWaalsContact C-CD 3.44Å; L8-P10 WeakPolarHBondContact O-CD 3.25Å; L8-L24 WeakPolarHBondContact O-CD2 3.48Å
9	H	91.5	Very high	88.1	Confident	142 Å²	142	117.6 Å²	117.6	66%	0.657	60%	0.603	S	S	*	*	S	Bend	trans	-127.1	65.9	-180	-42	95.1	0	0	0	111.1	D6	D6-H9 PolarHBondContact OD1-N 3.41Å; D6-H9 IonicContact OD1-ND1 3.09Å; D6-H9 WeakPolarHBondContact OD2-CB 3.4Å; D6-H9 IonicContact OD2-CG 3.64Å; D6-H9 IonicContact OD2-ND1 3.68Å; D6-H9 PolarHBondContact OD2-ND1 3.36Å; D6-H9 VanDerWaalsContact OD2-ND1 3.09Å
10	P	91.6	Very high	88.4	Confident	23 Å²	23	116.6 Å²	116.6	15%	0.149	59%	0.594	C	S	.	*			trans	-60	149.4	175.4	28	-35.4	0	0	0	110.8	L8 E15	L8-P10 VanDerWaalsContact C-CD 3.44Å; L8-P10 WeakPolarHBondContact O-CD 3.25Å; P10-E15 HydrophobicContact CB-CG 3.97Å; P10-E15 HydrophobicContact CG-CG 3.57Å
11	S	92.5	Very high	88.8	Confident	54 Å²	54	116.9 Å²	116.9	38%	0.378	60%	0.597	S	S	.	*			trans	-64.9	149.6	174.5	64.8	0	0	0	0	111.1	E13 E14 E15	S11-E13 PolarHBondContact O-N 3.44Å; S11-E13 VanDerWaalsContact O-N 3.13Å; S11-E14 PolarHBondContact N-OE2 2.92Å; S11-E14 VanDerWaalsContact N-OE2 3.1Å; S11-E14 PolarHBondContact O-N 2.9Å; S11-E14 WeakPolarHBondContact OG-CB 3.41Å; S11-E14 WeakPolarHBondContact OG-CG 3.08Å; S11-E14 PolarHBondContact OG-N 3.02Å; S11-E14 PolarHBondContact OG-OE2 2.8Å; S11-E15 PolarHBondContact O-N 3.39Å
12	A	93.1	Very high	90.7	Very high	65 Å²	65	113.7 Å²	113.7	54%	0.537	58%	0.576	S	S	.	*	H	α-helix	trans	-59.3	-28.4	179.5	0	0	0	0	0	112.8	K16	A12-K16 WeakPolarHBondContact O-CB 2.96Å; A12-K16 WeakPolarHBondContact O-CD 3.49Å; A12-K16 WeakPolarHBondContact O-CG 3.38Å; A12-K16 PolarHBondContact O-N 2.78Å; A12-K16 VanDerWaalsContact O-N 3.17Å
13	E	93.5	Very high	91.7	Very high	138 Å²	138	109.4 Å²	109.4	65%	0.645	55%	0.547	S	S	*	.	H	α-helix	trans	-71.3	-42.8	175.2	-63.3	-173.1	-178.8	0	0	112.1	S11 K16 R17	S11-E13 PolarHBondContact O-N 3.44Å; S11-E13 VanDerWaalsContact O-N 3.13Å; E13-K16 PolarHBondContact O-N 2.84Å; E13-R17 WeakPolarHBondContact O-CG 3.21Å; E13-R17 PolarHBondContact O-N 3.47Å
14	E	91.5	Very high	92.2	Very high	90 Å²	90	106.3 Å²	106.3	42%	0.421	53%	0.531	S	S	.	.	H	α-helix	trans	-64.2	-42.8	176.4	-74.8	169.7	143.4	0	0	111.4	S11 R17 K18	S11-E14 PolarHBondContact N-OE2 2.92Å; S11-E14 VanDerWaalsContact N-OE2 3.1Å; S11-E14 PolarHBondContact O-N 2.9Å; S11-E14 WeakPolarHBondContact OG-CB 3.41Å; S11-E14 WeakPolarHBondContact OG-CG 3.08Å; S11-E14 PolarHBondContact OG-N 3.02Å; S11-E14 PolarHBondContact OG-OE2 2.8Å; E14-R17 PolarHBondContact O-N 3.48Å; E14-K18 WeakPolarHBondContact O-CG 3.3Å; E14-K18 PolarHBondContact O-N 3.37Å
15	E	92.8	Very high	92.7	Very high	58 Å²	58	106.3 Å²	106.3	27%	0.271	52%	0.519	S	S	.	.	H	α-helix	trans	-61.9	-44.5	175	-76.4	-150.2	123.9	0	0	112.5	P10 S11 R17 K18 H23 L24	P10-E15 HydrophobicContact CB-CG 3.97Å; P10-E15 HydrophobicContact CG-CG 3.57Å; S11-E15 PolarHBondContact O-N 3.39Å; E15-R17 PolarHBondContact O-N 2.93Å; E15-K18 WeakPolarHBondContact O-CB 3.34Å; E15-K18 PolarHBondContact O-N 3.08Å; E15-K18 VanDerWaalsContact O-N 3.09Å; E15-H23 PolarHBondContact O-CE1 2.81Å; E15-H23 PolarHBondContact O-NE2 3.44Å; E15-H23 VanDerWaalsContact O-NE2 3.16Å; E15-L24 WeakPolarHBondContact OE1-CB 3.2Å; E15-L24 PolarHBondContact OE1-N 3.37Å
16	K	93.4	Very high	93.2	Very high	159 Å²	159	103.1 Å²	103.1	69%	0.691	51%	0.514	S	S	*	.	H	α-helix	trans	-60.7	-33.4	179.4	-76.8	170.6	-174.7	174.7	0	113.1	A12 E13	A12-K16 WeakPolarHBondContact O-CB 2.96Å; A12-K16 WeakPolarHBondContact O-CD 3.49Å; A12-K16 WeakPolarHBondContact O-CG 3.38Å; A12-K16 PolarHBondContact O-N 2.78Å; A12-K16 VanDerWaalsContact O-N 3.17Å; E13-K16 PolarHBondContact O-N 2.84Å
17	R	94	Very high	93.4	Very high	214 Å²	214	103.7 Å²	103.7	81%	0.808	51%	0.513	S	S	*	.	H	α-helix	trans	-72.3	-26.2	177.7	-72.1	179	-174.8	-157.1	4.3	112.8	E13 E14 E15	E13-R17 WeakPolarHBondContact O-CG 3.21Å; E13-R17 PolarHBondContact O-N 3.47Å; E14-R17 PolarHBondContact O-N 3.48Å; E15-R17 PolarHBondContact O-N 2.93Å
18	K	94.2	Very high	93.7	Very high	77 Å²	77	100.9 Å²	100.9	34%	0.335	50%	0.504	S	S	.	.	S	Bend	trans	-66.3	155.9	-179.5	-68.9	172.4	-167.6	179.3	0	111.4	E14 E15 K22 H23 K29	E14-K18 WeakPolarHBondContact O-CG 3.3Å; E14-K18 PolarHBondContact O-N 3.37Å; E15-K18 WeakPolarHBondContact O-CB 3.34Å; E15-K18 PolarHBondContact O-N 3.08Å; E15-K18 VanDerWaalsContact O-N 3.09Å; K18-K22 WeakPolarHBondContact CD-O 3.39Å; K18-H23 PolarHBondContact O-NE2 2.67Å; K18-K29 PolarHBondContact O-NZ 3.34Å
19	H	95.9	Very high	93.8	Very high	101 Å²	101	100.3 Å²	100.3	47%	0.468	50%	0.496	S	S	.	.			trans	-69	146.2	169.1	179.1	-100	0	0	0	109.3	L21 K22 H23	H19-L21 PolarHBondContact ND1-N 2.88Å; H19-L21 PolarHBondContact O-N 3.05Å; H19-K22 HydrophobicContact CB-CB 4.46Å; H19-K22 HydrophobicContact CB-CD 4.41Å; H19-K22 HydrophobicContact CB-CG 4.32Å; H19-K22 WeakPolarHBondContact O-CA 3.18Å; H19-K22 PolarHBondContact O-N 3.25Å; H19-H23 PolarHBondContact O-CD2 3.4Å
20	K	95.3	Very high	93.9	Very high	98 Å²	98	95 Å²	95	43%	0.426	48%	0.475	S	S	.	.	T	Hydrogen-bonded Turn	trans	-52.1	-29.9	-174.1	65.6	179.5	179.6	179	0	115.2	K29	K20-K29 HydrophobicContact CB-CG 4.25Å
21	L	96.2	Very high	94.1	Very high	123 Å²	123	95.8 Å²	95.8	64%	0.644	48%	0.475	S	S	*	.	T	Hydrogen-bonded Turn	trans	-85.7	-10.9	177.5	-60.8	177.8	0	0	0	114.2	H19	H19-L21 PolarHBondContact ND1-N 2.88Å; H19-L21 PolarHBondContact O-N 3.05Å
22	K	95.2	Very high	94.3	Very high	160 Å²	160	98.3 Å²	98.3	70%	0.696	48%	0.479	S	S	*	.	S	Bend	trans	-107.8	9.7	-177.3	-62.5	-172.5	175.9	-175.5	0	112.7	K18 H19	K18-K22 WeakPolarHBondContact CD-O 3.39Å; H19-K22 HydrophobicContact CB-CB 4.46Å; H19-K22 HydrophobicContact CB-CD 4.41Å; H19-K22 HydrophobicContact CB-CG 4.32Å; H19-K22 WeakPolarHBondContact O-CA 3.18Å; H19-K22 PolarHBondContact O-N 3.25Å
23	H	93.9	Very high	94.4	Very high	20 Å²	20	95.5 Å²	95.5	9%	0.093	46%	0.455	C	S	.	.	S	Bend	trans	-68.4	163.7	172	-72	-149.3	0	0	0	109.7	E15 K18 H19 V25 H27	E15-H23 PolarHBondContact O-CE1 2.81Å; E15-H23 PolarHBondContact O-NE2 3.44Å; E15-H23 VanDerWaalsContact O-NE2 3.16Å; K18-H23 PolarHBondContact O-NE2 2.67Å; H19-H23 PolarHBondContact O-CD2 3.4Å; H23-V25 VanDerWaalsContact CB-O 3.26Å; H23-V25 WeakPolarHBondContact CB-O 3.42Å; H23-V25 PolarHBondContact O-N 2.92Å; H23-H27 AromaticContact CE1-CE1 3.18Å; H23-H27 PolarHBondContact CE1-CE1 2.8Å; H23-H27 AromaticContact CE1-ND1 3.83Å; H23-H27 AromaticContact ND1-CE1 3.03Å; H23-H27 PolarHBondContact ND1-CE1 2.78Å; H23-H27 AromaticContact ND1-ND1 3.42Å; H23-H27 PolarHBondContact ND1-ND1 3.14Å; H23-H27 AromaticContact ND1-NE2 3.81Å
24	L	93.7	Very high	94.4	Very high	96 Å²	96	90.7 Å²	90.7	50%	0.503	43%	0.434	S	S	.	.	S	Bend	trans	-59	-44.6	173	-177.1	66.5	0	0	0	109.9	L8 E15	L8-L24 WeakPolarHBondContact O-CD2 3.48Å; E15-L24 WeakPolarHBondContact OE1-CB 3.2Å; E15-L24 PolarHBondContact OE1-N 3.37Å
25	V	94.5	Very high	94.5	Very high	107 Å²	107	86.4 Å²	86.4	65%	0.648	41%	0.414	S	S	*	.	S	Bend	trans	-117.6	117.6	168.2	-178.5	0	0	0	0	109	H23 H27	H23-V25 VanDerWaalsContact CB-O 3.26Å; H23-V25 WeakPolarHBondContact CB-O 3.42Å; H23-V25 PolarHBondContact O-N 2.92Å; V25-H27 PolarHBondContact O-N 2.83Å
26	P	95.4	Very high	94.6	Very high	82 Å²	82	87.6 Å²	87.6	53%	0.532	42%	0.418	S	S	.	.			trans	-63.5	133.2	178.7	-23.3	33.9	0	0	0	112.5
27	H	93.4	Very high	94.6	Very high	104 Å²	104	80.1 Å²	80.1	48%	0.481	39%	0.386	S	S	.	.			trans	-149.8	154.7	177.6	67.9	0.6	0	0	0	111.2	H23 V25	H23-H27 AromaticContact CE1-CE1 3.18Å; H23-H27 PolarHBondContact CE1-CE1 2.8Å; H23-H27 AromaticContact CE1-ND1 3.83Å; H23-H27 AromaticContact ND1-CE1 3.03Å; H23-H27 PolarHBondContact ND1-CE1 2.78Å; H23-H27 AromaticContact ND1-ND1 3.42Å; H23-H27 PolarHBondContact ND1-ND1 3.14Å; H23-H27 AromaticContact ND1-NE2 3.81Å; V25-H27 PolarHBondContact O-N 2.83Å
28	P	94.4	Very high	94.4	Very high	82 Å²	82	71.7 Å²	71.7	53%	0.532	37%	0.365	S	S	.	.			trans	-71.1	144.3	179.3	28.9	-34.4	0	0	0	112.3	S30	P28-S30 VanDerWaalsContact C-N 3.31Å
29	K	93.5	Very high	94.1	Very high	113 Å²	113	75.1 Å²	75.1	49%	0.491	38%	0.384	S	S	.	.	S	Bend	trans	-83.7	-7.7	168.1	-65.8	-169.9	-179.7	-168.5	0	112.9	K18 K20	K18-K29 PolarHBondContact O-NZ 3.34Å; K20-K29 HydrophobicContact CB-CG 4.25Å
30	S	94.9	Very high	93.8	Very high	31 Å²	31	72.2 Å²	72.2	22%	0.217	38%	0.375	C	S	.	.			trans	-81.5	150.5	179.5	56.3	0	0	0	0	111.8	P28 F47 Y84	P28-S30 VanDerWaalsContact C-N 3.31Å; S30-F47 VanDerWaalsContact CB-CZ 3.42Å; S30-Y84 PolarHBondContact O-OH 3.47Å
31	Y	95.4	Very high	93.5	Very high	39 Å²	39	75.1 Å²	75.1	15%	0.153	38%	0.384	C	S	.	.			trans	-139.3	164	176.7	54.3	-90.2	0	0	0	111.2	M33 S48 K81	Y31-M33 HydrophobicContact CD2-CB 4.34Å; Y31-M33 HydrophobicContact CE2-CB 4.25Å; Y31-M33 HydrophobicContact CE2-CG 4.47Å; Y31-M33 HydrophobicContact CE2-SD 4Å; Y31-S48 PolarHBondContact N-OG 2.89Å; Y31-S48 WeakPolarHBondContact O-CB 3.17Å; Y31-S48 PolarHBondContact O-N 3.1Å; Y31-S48 PolarHBondContact O-OG 3.34Å; Y31-K81 HydrophobicContact CD1-CD 4.41Å; Y31-K81 HydrophobicContact CD2-CB 4.34Å; Y31-K81 HydrophobicContact CD2-CD 4Å; Y31-K81 HydrophobicContact CD2-CG 3.82Å; Y31-K81 HydrophobicContact CE1-CD 4.31Å; Y31-K81 HydrophobicContact CE2-CD 3.9Å; Y31-K81 HydrophobicContact CE2-CG 3.7Å; Y31-K81 HydrophobicContact CG-CD 4.27Å; Y31-K81 VanDerWaalsContact CZ-CE 3.47Å
32	F	95.9	Very high	93.3	Very high	107 Å²	107	74.6 Å²	74.6	47%	0.469	38%	0.377	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.2	147.4	165.4	-69.1	-84.6	0	0	0	109.7	V46 F47 K82	F32-V46 WeakPolarHBondContact CA-O 3.46Å; F32-F47 HydrophobicContact CD1-CB 4.2Å; F32-F47 HydrophobicContact CD1-CD2 4.14Å; F32-F47 HydrophobicContact CE1-CB 3.99Å; F32-F47 AromaticContact CE1-CD2 3.84Å; F32-F47 HydrophobicContact CE1-CD2 3.84Å; F32-F47 HydrophobicContact CE1-CG 4.33Å; F32-F47 HydrophobicContact CE2-CD2 4.34Å; F32-F47 AromaticContact CZ-CD2 3.95Å; F32-F47 HydrophobicContact CZ-CD2 3.95Å; F32-K82 PolarHBondContact O-N 2.96Å
33	M	95	Very high	93.2	Very high	7 Å²	7	72.2 Å²	72.2	3%	0.034	37%	0.371	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.3	139.8	178.8	53.8	-170.2	168.8	0	0	110.2	Y31 V35 V46 L73 F79 R80	Y31-M33 HydrophobicContact CD2-CB 4.34Å; Y31-M33 HydrophobicContact CE2-CB 4.25Å; Y31-M33 HydrophobicContact CE2-CG 4.47Å; Y31-M33 HydrophobicContact CE2-SD 4Å; M33-V35 HydrophobicContact CG-CG2 4.02Å; M33-V35 PolarHBondContact O-N 3.39Å; M33-V35 HydrophobicContact SD-CG2 4.49Å; M33-V46 HydrophobicContact CE-CB 4.43Å; M33-V46 HydrophobicContact CE-CG1 3.81Å; M33-V46 HydrophobicContact CG-CB 4.27Å; M33-V46 WeakPolarHBondContact CG-O 3.36Å; M33-V46 PolarHBondContact N-O 3.47Å; M33-V46 PolarHBondContact O-N 3.47Å; M33-L73 HydrophobicContact CE-CD2 4.42Å; M33-F79 HydrophobicContact CB-CB 4.49Å; M33-F79 HydrophobicContact CB-CD2 4.14Å; M33-F79 HydrophobicContact SD-CB 4.32Å; M33-F79 HydrophobicContact SD-CD2 3.83Å; M33-F79 HydrophobicContact SD-CE2 4.46Å; M33-F79 HydrophobicContact SD-CG 4.19Å; M33-R80 CarbonylContact C-O 3.58Å; M33-R80 WeakPolarHBondContact CA-O 3.45Å; M33-R80 WeakPolarHBondContact CB-O 3.47Å
34	D	94.5	Very high	93.2	Very high	37 Å²	37	72.3 Å²	72.3	20%	0.198	37%	0.373	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.7	111.3	169.4	-73.3	-30.9	0	0	0	107.7	I43 T45 F79 R80 K82	D34-I43 HydrophobicContact CB-CG2 3.63Å; D34-T45 WeakPolarHBondContact OD1-CG2 3.37Å; D34-F79 CarbonylContact O-C 3.56Å; D34-F79 VanDerWaalsContact O-CA 3.25Å; D34-F79 WeakPolarHBondContact O-CA 3.33Å; D34-R80 PolarHBondContact N-O 3.39Å; D34-R80 PolarHBondContact O-N 2.82Å; D34-K82 VanDerWaalsContact OD1-CD 3.3Å; D34-K82 WeakPolarHBondContact OD1-CD 3.4Å; D34-K82 WeakPolarHBondContact OD1-CE 3.34Å; D34-K82 IonicContact OD1-NZ 2.78Å; D34-K82 PolarHBondContact OD1-NZ 3.29Å; D34-K82 WeakPolarHBondContact OD2-CE 3.45Å; D34-K82 WeakPolarHBondContact OD2-CG 3.26Å; D34-K82 IonicContact OD2-NZ 3.37Å; D34-K82 PolarHBondContact OD2-NZ 3.24Å
35	V	93.9	Very high	93.2	Very high	0 Å²	0	72 Å²	72	0%	0	38%	0.375	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.6	123.3	178.4	-179.4	0	0	0	0	108.5	M33 I43 T44 V46 L63 L73 C77 S78 F79	M33-V35 HydrophobicContact CG-CG2 4.02Å; M33-V35 PolarHBondContact O-N 3.39Å; M33-V35 HydrophobicContact SD-CG2 4.49Å; V35-I43 WeakPolarHBondContact O-CA 3.48Å; V35-T44 PolarHBondContact N-O 2.88Å; V35-T44 PolarHBondContact O-N 3.44Å; V35-T44 PolarHBondContact O-OG1 2.95Å; V35-V46 HydrophobicContact CB-CG2 4.01Å; V35-V46 HydrophobicContact CG2-CB 3.73Å; V35-V46 HydrophobicContact CG2-CG1 4.4Å; V35-V46 HydrophobicContact CG2-CG2 3.67Å; V35-L63 HydrophobicContact CG1-CB 4.38Å; V35-L63 HydrophobicContact CG1-CD2 4.36Å; V35-L73 HydrophobicContact CG1-CD2 3.91Å; V35-L73 HydrophobicContact CG2-CD2 3.71Å; V35-C77 HydrophobicContact CG1-CB 4.01Å; V35-S78 CarbonylContact C-O 3.47Å; V35-S78 WeakPolarHBondContact CA-O 3.45Å; V35-F79 HydrophobicContact CG2-CB 4.12Å
36	K	94.1	Very high	93.1	Very high	83 Å²	83	67 Å²	67	36%	0.361	34%	0.344	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.6	121.9	175.4	179.4	178.4	178.7	-177	0	109.1	I43 C77 S78	K36-I43 HydrophobicContact CB-CG1 4.33Å; K36-I43 HydrophobicContact CG-CG1 4.47Å; K36-C77 WeakPolarHBondContact O-CA 3.38Å; K36-S78 WeakPolarHBondContact CB-OG 3.4Å; K36-S78 PolarHBondContact N-O 2.83Å; K36-S78 PolarHBondContact O-N 2.88Å
37	C	93	Very high	93.1	Very high	2 Å²	2	66.4 Å²	66.4	1%	0.014	33%	0.333	C	S	.	.	P	Polyproline II helix	trans	-67.4	135.1	176.2	-176.5	0	0	0	0	110.9	M39 C40 Y41 K42 C56 C59 T61 L63	C37-M39 VanDerWaalsContact C-N 3.31Å; C37-M39 PolarHBondContact O-N 3.18Å; C37-C40 VanDerWaalsContact SG-SG 3.67Å; C37-Y41 WeakPolarHBondContact O-CA 3.32Å; C37-Y41 PolarHBondContact O-N 2.9Å; C37-K42 PolarHBondContact N-O 3.03Å; C37-C56 HydrophobicContact CB-CB 4.47Å; C37-C59 PolarHBondContact SG-SG 2.9Å; C37-T61 PolarHBondContact SG-OG1 3.17Å; C37-T61 VanDerWaalsContact SG-OG1 3.37Å; C37-L63 HydrophobicContact CB-CD2 3.85Å
38	G	89.2	Confident	93.2	Very high	36 Å²	36	61.5 Å²	61.5	37%	0.371	31%	0.311	S	S	.	.	T	Hydrogen-bonded Turn	trans	-66.4	-27.7	178.4	0	0	0	0	0	114.5
39	M	88.7	Confident	93.3	Very high	149 Å²	149	60.8 Å²	60.8	73%	0.734	30%	0.3	S	S	*	.	T	Hydrogen-bonded Turn	trans	-90.8	-51.1	-174.8	-61.1	-57.6	-68	0	0	113.2	C37 T61	C37-M39 VanDerWaalsContact C-N 3.31Å; C37-M39 PolarHBondContact O-N 3.18Å; M39-T61 HydrophobicContact CG-CG2 4.48Å
40	C	89.3	Confident	93.4	Very high	40 Å²	40	55.7 Å²	55.7	27%	0.27	28%	0.279	S	S	.	.	T	Hydrogen-bonded Turn	trans	-104	-0.2	-172.5	66.5	0	0	0	0	114.3	C37 K42 C56 C59	C37-C40 VanDerWaalsContact SG-SG 3.67Å; C40-K42 PolarHBondContact O-N 3.18Å; C40-C56 PolarHBondContact SG-SG 3.32Å; C40-C59 HydrophobicContact CB-CB 4.17Å; C40-C59 PolarHBondContact SG-SG 3.39Å
41	Y	89	Confident	93.3	Very high	159 Å²	159	62.7 Å²	62.7	62%	0.624	31%	0.309	S	S	*	.			trans	57.7	4.3	-178.8	-60.6	-90.5	0	0	0	115.8	C37	C37-Y41 WeakPolarHBondContact O-CA 3.32Å; C37-Y41 PolarHBondContact O-N 2.9Å
42	K	92.7	Very high	93.3	Very high	112 Å²	112	65.5 Å²	65.5	49%	0.487	33%	0.33	S	S	.	.			trans	-67.7	143.6	173.7	-65.9	-166.2	-176.1	-175.3	0	110.6	C37 C40	C37-K42 PolarHBondContact N-O 3.03Å; C40-K42 PolarHBondContact O-N 3.18Å
43	I	92.8	Very high	93.2	Very high	111 Å²	111	64.1 Å²	64.1	57%	0.569	33%	0.33	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-103.5	130	180	-59.3	172.8	0	0	0	108.5	D34 V35 K36	D34-I43 HydrophobicContact CB-CG2 3.63Å; V35-I43 WeakPolarHBondContact O-CA 3.48Å; K36-I43 HydrophobicContact CB-CG1 4.33Å; K36-I43 HydrophobicContact CG-CG1 4.47Å
44	T	93.3	Very high	93.1	Very high	22 Å²	22	65.5 Å²	65.5	14%	0.135	34%	0.337	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.9	137.7	175.5	56.7	0	0	0	0	110.1	V35 V46 V57 L63	V35-T44 PolarHBondContact N-O 2.88Å; V35-T44 PolarHBondContact O-N 3.44Å; V35-T44 PolarHBondContact O-OG1 2.95Å; T44-V46 PolarHBondContact O-N 3.45Å; T44-V57 HydrophobicContact CG2-CG2 4.44Å; T44-L63 HydrophobicContact CG2-CD1 4.09Å; T44-L63 WeakPolarHBondContact OG1-CD1 3.33Å
45	T	93.7	Very high	93.1	Very high	90 Å²	90	67 Å²	67	55%	0.552	35%	0.348	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-74.9	121.8	173.1	47.6	0	0	0	0	110.6	D34 K82	D34-T45 WeakPolarHBondContact OD1-CG2 3.37Å; T45-K82 HydrophobicContact CG2-CD 4.1Å
46	V	94	Very high	93	Very high	1 Å²	1	67.1 Å²	67.1	1%	0.006	35%	0.348	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.6	140.7	-179.2	173	0	0	0	0	110	F32 M33 V35 T44 I54	F32-V46 WeakPolarHBondContact CA-O 3.46Å; M33-V46 HydrophobicContact CE-CB 4.43Å; M33-V46 HydrophobicContact CE-CG1 3.81Å; M33-V46 HydrophobicContact CG-CB 4.27Å; M33-V46 WeakPolarHBondContact CG-O 3.36Å; M33-V46 PolarHBondContact N-O 3.47Å; M33-V46 PolarHBondContact O-N 3.47Å; V35-V46 HydrophobicContact CB-CG2 4.01Å; V35-V46 HydrophobicContact CG2-CB 3.73Å; V35-V46 HydrophobicContact CG2-CG1 4.4Å; V35-V46 HydrophobicContact CG2-CG2 3.67Å; T44-V46 PolarHBondContact O-N 3.45Å; V46-I54 HydrophobicContact CB-CD1 4.18Å; V46-I54 HydrophobicContact CG1-CD1 3.5Å; V46-I54 HydrophobicContact CG2-CD1 4.07Å; V46-I54 HydrophobicContact CG2-CG2 4.06Å
47	F	95.5	Very high	92.8	Very high	69 Å²	69	69.1 Å²	69.1	30%	0.303	37%	0.367	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.1	136.2	171.2	-176.1	-120	0	0	0	111.5	S30 F32 H49 A50	S30-F47 VanDerWaalsContact CB-CZ 3.42Å; F32-F47 HydrophobicContact CD1-CB 4.2Å; F32-F47 HydrophobicContact CD1-CD2 4.14Å; F32-F47 HydrophobicContact CE1-CB 3.99Å; F32-F47 AromaticContact CE1-CD2 3.84Å; F32-F47 HydrophobicContact CE1-CD2 3.84Å; F32-F47 HydrophobicContact CE1-CG 4.33Å; F32-F47 HydrophobicContact CE2-CD2 4.34Å; F32-F47 AromaticContact CZ-CD2 3.95Å; F32-F47 HydrophobicContact CZ-CD2 3.95Å; F47-H49 VanDerWaalsContact C-N 3.25Å; F47-H49 HydrophobicContact CD1-CB 4.09Å; F47-H49 HydrophobicContact CE1-CB 3.61Å; F47-H49 HydrophobicContact CZ-CB 4.35Å; F47-H49 PolarHBondContact O-N 3.25Å; F47-A50 WeakPolarHBondContact O-CB 3.12Å; F47-A50 PolarHBondContact O-N 3.09Å
48	S	95.5	Very high	92.6	Very high	1 Å²	1	70.9 Å²	70.9	1%	0.007	39%	0.385	C	S	.	.	T	Hydrogen-bonded Turn	trans	-53.2	-34.4	179.7	51.2	0	0	0	0	115.1	Y31 L70 A71	Y31-S48 PolarHBondContact N-OG 2.89Å; Y31-S48 WeakPolarHBondContact O-CB 3.17Å; Y31-S48 PolarHBondContact O-N 3.1Å; Y31-S48 PolarHBondContact O-OG 3.34Å; S48-L70 WeakPolarHBondContact O-CA 3.45Å; S48-A71 PolarHBondContact O-N 3.02Å
49	H	95.6	Very high	92.6	Very high	68 Å²	68	71.2 Å²	71.2	32%	0.315	38%	0.382	S	S	.	.	T	Hydrogen-bonded Turn	trans	-113.7	40.3	-179.7	-56.2	68.4	0	0	0	111.2	F47 Q51	F47-H49 VanDerWaalsContact C-N 3.25Å; F47-H49 HydrophobicContact CD1-CB 4.09Å; F47-H49 HydrophobicContact CE1-CB 3.61Å; F47-H49 HydrophobicContact CZ-CB 4.35Å; F47-H49 PolarHBondContact O-N 3.25Å; H49-Q51 PolarHBondContact O-N 3.05Å
50	A	94.7	Very high	92.7	Very high	6 Å²	6	68.7 Å²	68.7	5%	0.05	38%	0.379	C	S	.	.			trans	-54.4	125.2	179.5	0	0	0	0	0	111.8	F47 I54 A71	F47-A50 WeakPolarHBondContact O-CB 3.12Å; F47-A50 PolarHBondContact O-N 3.09Å; A50-I54 HydrophobicContact CB-CD1 3.57Å; A50-I54 HydrophobicContact CB-CG1 4.36Å; A50-A71 HydrophobicContact CB-CB 4.13Å
51	Q	94.4	Very high	92.8	Very high	178 Å²	178	69 Å²	69	83%	0.832	38%	0.379	S	S	*	.			trans	-87.9	-16.7	177.6	-67.4	179.1	-23.3	0	0	112.8	H49 P66	H49-Q51 PolarHBondContact O-N 3.05Å; Q51-P66 WeakPolarHBondContact O-CB 3.19Å
52	T	94.3	Very high	93	Very high	98 Å²	98	63.8 Å²	63.8	60%	0.601	36%	0.364	S	S	*	.	S	Bend	trans	-104.5	157.5	178.9	55.7	0	0	0	0	110.9	I54	T52-I54 PolarHBondContact O-N 3.13Å
53	V	94.3	Very high	93	Very high	78 Å²	78	58.5 Å²	58.5	47%	0.473	34%	0.341	S	S	.	.			trans	-71.2	121.3	168.4	-178.6	0	0	0	0	107.7	V62	V53-V62 HydrophobicContact CG1-CB 4.32Å; V53-V62 HydrophobicContact CG1-CG1 3.56Å; V53-V62 HydrophobicContact CG1-CG2 3.88Å
54	I	93.2	Very high	93	Very high	36 Å²	36	53.2 Å²	53.2	19%	0.185	31%	0.314	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99	128.9	179.4	-60.3	172.2	0	0	0	109	V46 A50 T52 L63 C64	V46-I54 HydrophobicContact CB-CD1 4.18Å; V46-I54 HydrophobicContact CG1-CD1 3.5Å; V46-I54 HydrophobicContact CG2-CD1 4.07Å; V46-I54 HydrophobicContact CG2-CG2 4.06Å; A50-I54 HydrophobicContact CB-CD1 3.57Å; A50-I54 HydrophobicContact CB-CG1 4.36Å; T52-I54 PolarHBondContact O-N 3.13Å; I54-L63 HydrophobicContact CG2-CD1 4.48Å; I54-L63 PolarHBondContact O-N 3.06Å; I54-C64 PolarHBondContact N-O 3.27Å
55	V	93.4	Very high	93.1	Very high	69 Å²	69	59 Å²	59	42%	0.418	33%	0.333	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.3	142.1	-175.7	-179.4	0	0	0	0	109.6	S60	V55-S60 VanDerWaalsContact CG1-CA 3.44Å; V55-S60 WeakPolarHBondContact CG1-O 3.41Å
56	C	92.9	Very high	93.2	Very high	1 Å²	1	57.4 Å²	57.4	1%	0.007	32%	0.324	C	S	.	.			trans	-70.5	131.3	174.4	-172	0	0	0	0	111	C37 C40 G58 S60 T61 L63	C37-C56 HydrophobicContact CB-CB 4.47Å; C40-C56 PolarHBondContact SG-SG 3.32Å; C56-G58 PolarHBondContact O-N 3.2Å; C56-S60 WeakPolarHBondContact O-CA 3.43Å; C56-S60 PolarHBondContact O-N 3.38Å; C56-T61 PolarHBondContact N-O 2.83Å; C56-L63 HydrophobicContact CB-CD1 4.02Å; C56-L63 HydrophobicContact CB-CD2 4.02Å; C56-L63 HydrophobicContact CB-CG 3.97Å
57	V	89.5	Confident	93.2	Very high	126 Å²	126	64.5 Å²	64.5	76%	0.764	35%	0.351	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.9	-23.6	179.6	-173.7	0	0	0	0	112.7	T44	T44-V57 HydrophobicContact CG2-CG2 4.44Å
58	G	88.6	Confident	93.2	Very high	38 Å²	38	65.9 Å²	65.9	39%	0.392	39%	0.385	S	S	.	.	T	Hydrogen-bonded Turn	trans	-87.2	-50	-176.9	0	0	0	0	0	115	C56	C56-G58 PolarHBondContact O-N 3.2Å
59	C	89.4	Confident	93.1	Very high	44 Å²	44	67.3 Å²	67.3	30%	0.297	40%	0.4	S	S	.	.	T	Hydrogen-bonded Turn	trans	-118	6.2	-169.8	52.8	0	0	0	0	113.6	C37 C40 T61	C37-C59 PolarHBondContact SG-SG 2.9Å; C40-C59 HydrophobicContact CB-CB 4.17Å; C40-C59 PolarHBondContact SG-SG 3.39Å; C59-T61 HydrophobicContact CB-CG2 4.12Å; C59-T61 PolarHBondContact O-N 3.26Å; C59-T61 PolarHBondContact SG-OG1 3.4Å
60	S	90.4	Very high	93.1	Very high	96 Å²	96	68.5 Å²	68.5	67%	0.671	41%	0.408	S	S	*	.			trans	55.8	16.3	-178.6	-56.9	0	0	0	0	114.8	V55 C56	V55-S60 VanDerWaalsContact CG1-CA 3.44Å; V55-S60 WeakPolarHBondContact CG1-O 3.41Å; C56-S60 WeakPolarHBondContact O-CA 3.43Å; C56-S60 PolarHBondContact O-N 3.38Å
61	T	91.3	Very high	93.1	Very high	46 Å²	46	68.9 Å²	68.9	28%	0.282	41%	0.411	S	S	.	.			trans	-76.7	141.3	176.6	58.1	0	0	0	0	110.3	C37 M39 C56 C59 L63	C37-T61 PolarHBondContact SG-OG1 3.17Å; C37-T61 VanDerWaalsContact SG-OG1 3.37Å; M39-T61 HydrophobicContact CG-CG2 4.48Å; C56-T61 PolarHBondContact N-O 2.83Å; C59-T61 HydrophobicContact CB-CG2 4.12Å; C59-T61 PolarHBondContact O-N 3.26Å; C59-T61 PolarHBondContact SG-OG1 3.4Å; T61-L63 PolarHBondContact O-N 3.49Å
62	V	92.9	Very high	93.2	Very high	50 Å²	50	64.6 Å²	64.6	30%	0.303	39%	0.39	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-67.6	122.3	173.6	177.3	0	0	0	0	110.1	V53 R65 T74	V53-V62 HydrophobicContact CG1-CB 4.32Å; V53-V62 HydrophobicContact CG1-CG1 3.56Å; V53-V62 HydrophobicContact CG1-CG2 3.88Å; V62-R65 HydrophobicContact CG1-CG 4.16Å; V62-T74 WeakPolarHBondContact O-CB 3.49Å; V62-T74 PolarHBondContact O-OG1 3.17Å
63	L	93.3	Very high	93.1	Very high	0 Å²	0	61.9 Å²	61.9	0%	0	37%	0.371	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.6	-38.1	178.4	-65.2	177.1	0	0	0	112.5	V35 C37 T44 I54 C56 T61 L73 T74	V35-L63 HydrophobicContact CG1-CB 4.38Å; V35-L63 HydrophobicContact CG1-CD2 4.36Å; C37-L63 HydrophobicContact CB-CD2 3.85Å; T44-L63 HydrophobicContact CG2-CD1 4.09Å; T44-L63 WeakPolarHBondContact OG1-CD1 3.33Å; I54-L63 HydrophobicContact CG2-CD1 4.48Å; I54-L63 PolarHBondContact O-N 3.06Å; C56-L63 HydrophobicContact CB-CD1 4.02Å; C56-L63 HydrophobicContact CB-CD2 4.02Å; C56-L63 HydrophobicContact CB-CG 3.97Å; T61-L63 PolarHBondContact O-N 3.49Å; L63-L73 WeakPolarHBondContact O-CA 3.2Å; L63-T74 PolarHBondContact O-N 3.16Å; L63-T74 PolarHBondContact O-OG1 3.16Å
64	C	93.4	Very high	93.1	Very high	0 Å²	0	60.2 Å²	60.2	0%	0	36%	0.362	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-146.5	151.9	174.3	69.2	0	0	0	0	112.8	I54 A71 K72 L73	I54-C64 PolarHBondContact N-O 3.27Å; C64-A71 HydrophobicContact CB-CB 4.28Å; C64-K72 CarbonylContact C-O 3.45Å; C64-K72 WeakPolarHBondContact CA-O 3.11Å; C64-K72 WeakPolarHBondContact CB-O 3.37Å; C64-L73 HydrophobicContact CB-CD2 4.12Å
65	R	94	Very high	92.9	Very high	144 Å²	144	66.9 Å²	66.9	54%	0.543	39%	0.392	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.2	141.5	171.9	-66.4	-177.2	173.2	112.6	-7.9	110.3	V62 K72	V62-R65 HydrophobicContact CG1-CG 4.16Å; R65-K72 PolarHBondContact N-O 3.09Å; R65-K72 PolarHBondContact O-N 3.05Å
66	P	96	Very high	92.7	Very high	56 Å²	56	66.8 Å²	66.8	36%	0.364	40%	0.404	S	S	.	.			trans	-67.4	149.4	179.5	29	-35.2	0	0	0	111.9	Q51	Q51-P66 WeakPolarHBondContact O-CB 3.19Å
67	R	95.1	Very high	92.7	Very high	150 Å²	150	68 Å²	68	57%	0.566	41%	0.413	S	S	*	.			trans	-139.8	169	171.6	-73.6	-175.3	164.6	177.5	-4.5	108.1	G69 L70 K72	R67-G69 PolarHBondContact O-N 3.38Å; R67-G69 VanDerWaalsContact O-N 3.16Å; R67-L70 WeakPolarHBondContact CB-O 3.46Å; R67-K72 HydrophobicContact CG-CB 4.33Å
68	G	94.7	Very high	92.8	Very high	98 Å²	98	65.1 Å²	65.1	100%	1.01	40%	0.398	S	S	*	.	S	Bend	trans	-64.8	-13.3	173.9	0	0	0	0	0	114.8
69	G	94.2	Very high	93.1	Very high	32 Å²	32	68.1 Å²	68.1	33%	0.33	40%	0.401	S	S	.	.	S	Bend	trans	-129.9	-123.9	177.5	0	0	0	0	0	111.5	R67 A71	R67-G69 PolarHBondContact O-N 3.38Å; R67-G69 VanDerWaalsContact O-N 3.16Å; G69-A71 PolarHBondContact O-N 3.42Å
70	L	95	Very high	93.3	Very high	93 Å²	93	75.4 Å²	75.4	49%	0.487	42%	0.422	S	S	.	.	S	Bend	trans	-63.4	132.9	174.4	-67.5	170.9	0	0	0	110.9	S48 R67	S48-L70 WeakPolarHBondContact O-CA 3.45Å; R67-L70 WeakPolarHBondContact CB-O 3.46Å
71	A	95.6	Very high	93.5	Very high	13 Å²	13	76.5 Å²	76.5	11%	0.107	42%	0.415	C	S	.	.			trans	-61.7	142.8	177.6	0	0	0	0	0	110.9	S48 A50 C64 G69 L73	S48-A71 PolarHBondContact O-N 3.02Å; A50-A71 HydrophobicContact CB-CB 4.13Å; C64-A71 HydrophobicContact CB-CB 4.28Å; G69-A71 PolarHBondContact O-N 3.42Å; A71-L73 PolarHBondContact O-N 2.94Å
72	K	95	Very high	93.6	Very high	89 Å²	89	78.5 Å²	78.5	39%	0.387	42%	0.419	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.7	114.2	177.1	-167.9	-170.8	-176.8	-178.8	0	109	C64 R65 R67	C64-K72 CarbonylContact C-O 3.45Å; C64-K72 WeakPolarHBondContact CA-O 3.11Å; C64-K72 WeakPolarHBondContact CB-O 3.37Å; R65-K72 PolarHBondContact N-O 3.09Å; R65-K72 PolarHBondContact O-N 3.05Å; R67-K72 HydrophobicContact CG-CB 4.33Å
73	L	94	Very high	93.2	Very high	40 Å²	40	85.3 Å²	85.3	21%	0.209	45%	0.448	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-70	147.3	170	-69.1	168.6	0	0	0	110.7	M33 V35 L63 C64 A71 F79	M33-L73 HydrophobicContact CE-CD2 4.42Å; V35-L73 HydrophobicContact CG1-CD2 3.91Å; V35-L73 HydrophobicContact CG2-CD2 3.71Å; L63-L73 WeakPolarHBondContact O-CA 3.2Å; C64-L73 HydrophobicContact CB-CD2 4.12Å; A71-L73 PolarHBondContact O-N 2.94Å; L73-F79 HydrophobicContact CD1-CB 3.95Å; L73-F79 HydrophobicContact CD1-CD1 3.38Å; L73-F79 HydrophobicContact CD1-CE1 4.08Å; L73-F79 HydrophobicContact CD1-CG 3.8Å
74	T	92.3	Very high	92.1	Very high	44 Å²	44	95.7 Å²	95.7	27%	0.27	49%	0.488	S	S	.	.	P	Polyproline II helix	trans	-70.1	143.5	172.1	-58.9	0	0	0	0	109.8	V62 L63 C77	V62-T74 WeakPolarHBondContact O-CB 3.49Å; V62-T74 PolarHBondContact O-OG1 3.17Å; L63-T74 PolarHBondContact O-N 3.16Å; L63-T74 PolarHBondContact O-OG1 3.16Å; T74-C77 WeakPolarHBondContact O-CB 3.47Å; T74-C77 PolarHBondContact O-N 3.45Å; T74-C77 VanDerWaalsContact O-N 3.14Å
75	E	90.5	Very high	92	Very high	176 Å²	176	100.5 Å²	100.5	82%	0.822	51%	0.513	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.2	139.3	176.7	-68.7	168.6	-165.5	0	0	110.7	C77	E75-C77 VanDerWaalsContact C-N 3.29Å; E75-C77 PolarHBondContact O-N 3.36Å
76	G	89.1	Confident	91.9	Very high	66 Å²	66	98.2 Å²	98.2	68%	0.68	51%	0.511	S	S	*	.	T	Hydrogen-bonded Turn	trans	81.6	-6.8	-175.2	0	0	0	0	0	115.6
77	C	91.6	Very high	91.7	Very high	27 Å²	27	100.5 Å²	100.5	18%	0.182	52%	0.52	C	S	.	.			trans	-81.3	134	170	-62.9	0	0	0	0	110.5	V35 K36 T74 E75	V35-C77 HydrophobicContact CG1-CB 4.01Å; K36-C77 WeakPolarHBondContact O-CA 3.38Å; T74-C77 WeakPolarHBondContact O-CB 3.47Å; T74-C77 PolarHBondContact O-N 3.45Å; T74-C77 VanDerWaalsContact O-N 3.14Å; E75-C77 VanDerWaalsContact C-N 3.29Å; E75-C77 PolarHBondContact O-N 3.36Å
78	S	92.8	Very high	91.5	Very high	65 Å²	65	97.6 Å²	97.6	46%	0.455	52%	0.517	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.5	150.7	171.3	46.5	0	0	0	0	109.8	V35 K36	V35-S78 CarbonylContact C-O 3.47Å; V35-S78 WeakPolarHBondContact CA-O 3.45Å; K36-S78 WeakPolarHBondContact CB-OG 3.4Å; K36-S78 PolarHBondContact N-O 2.83Å; K36-S78 PolarHBondContact O-N 2.88Å
79	F	93.9	Very high	91.3	Very high	102 Å²	102	97.6 Å²	97.6	45%	0.447	49%	0.486	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.4	147.2	178.4	77.4	-82.8	0	0	0	111.8	M33 D34 V35 L73 K81	M33-F79 HydrophobicContact CB-CB 4.49Å; M33-F79 HydrophobicContact CB-CD2 4.14Å; M33-F79 HydrophobicContact SD-CB 4.32Å; M33-F79 HydrophobicContact SD-CD2 3.83Å; M33-F79 HydrophobicContact SD-CE2 4.46Å; M33-F79 HydrophobicContact SD-CG 4.19Å; D34-F79 CarbonylContact O-C 3.56Å; D34-F79 VanDerWaalsContact O-CA 3.25Å; D34-F79 WeakPolarHBondContact O-CA 3.33Å; V35-F79 HydrophobicContact CG2-CB 4.12Å; L73-F79 HydrophobicContact CD1-CB 3.95Å; L73-F79 HydrophobicContact CD1-CD1 3.38Å; L73-F79 HydrophobicContact CD1-CE1 4.08Å; L73-F79 HydrophobicContact CD1-CG 3.8Å; F79-K81 HydrophobicContact CE2-CG 4.33Å
80	R	94.9	Very high	91.1	Very high	196 Å²	196	101.9 Å²	101.9	74%	0.74	50%	0.496	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-122	132.5	169	179.1	-179.9	173.2	180	-0.9	108.5	M33 D34 K82	M33-R80 CarbonylContact C-O 3.58Å; M33-R80 WeakPolarHBondContact CA-O 3.45Å; M33-R80 WeakPolarHBondContact CB-O 3.47Å; D34-R80 PolarHBondContact N-O 3.39Å; D34-R80 PolarHBondContact O-N 2.82Å; R80-K82 PolarHBondContact O-N 2.76Å
81	K	95	Very high	90.8	Very high	120 Å²	120	102.6 Å²	102.6	52%	0.522	50%	0.497	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-67.9	130	172	-62.5	-169.9	-176	-177.7	0	109.2	Y31 F79	Y31-K81 HydrophobicContact CD1-CD 4.41Å; Y31-K81 HydrophobicContact CD2-CB 4.34Å; Y31-K81 HydrophobicContact CD2-CD 4Å; Y31-K81 HydrophobicContact CD2-CG 3.82Å; Y31-K81 HydrophobicContact CE1-CD 4.31Å; Y31-K81 HydrophobicContact CE2-CD 3.9Å; Y31-K81 HydrophobicContact CE2-CG 3.7Å; Y31-K81 HydrophobicContact CG-CD 4.27Å; Y31-K81 VanDerWaalsContact CZ-CE 3.47Å; F79-K81 HydrophobicContact CE2-CG 4.33Å
82	K	93.2	Very high	90.4	Very high	87 Å²	87	109.5 Å²	109.5	38%	0.378	53%	0.527	S	S	.	.			trans	-76.5	131.4	169.7	-76.2	-171.4	125.1	141.3	0	108.9	F32 D34 T45 R80	F32-K82 PolarHBondContact O-N 2.96Å; D34-K82 VanDerWaalsContact OD1-CD 3.3Å; D34-K82 WeakPolarHBondContact OD1-CD 3.4Å; D34-K82 WeakPolarHBondContact OD1-CE 3.34Å; D34-K82 IonicContact OD1-NZ 2.78Å; D34-K82 PolarHBondContact OD1-NZ 3.29Å; D34-K82 WeakPolarHBondContact OD2-CE 3.45Å; D34-K82 WeakPolarHBondContact OD2-CG 3.26Å; D34-K82 IonicContact OD2-NZ 3.37Å; D34-K82 PolarHBondContact OD2-NZ 3.24Å; T45-K82 HydrophobicContact CG2-CD 4.1Å; R80-K82 PolarHBondContact O-N 2.76Å
83	Q	83.6	Confident	90	Very high	194 Å²	194	111.2 Å²	111.2	91%	0.907	54%	0.539	S	S	*	.			trans	-85.8	113.7	168.4	-167.3	165.6	4.2	0	0	106.1
84	Y	69.5	Low	89.7	Confident	217 Å²	217	117.6 Å²	117.6	85%	0.851	57%	0.569	S	S	*	*			trans	-81.6	0	164.8	32.9	-105.8	0	0	0	109.3	S30	S30-Y84 PolarHBondContact O-OH 3.47Å

Retrieved 84 of 84 residues in 29.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).