A0A077Z3R8_TRITR Loading...

Ubiquitin-like protein NEDD8

AlphaFold DB , UniProt , Accession A0A077Z3R8, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 107 aa.

						>A0A077Z3R8_TRITR|A0A077Z3R8
MLIKVKTLTGKEVELDIDASDKVERIKEKVEAKEGIPPPQQRLIYAGKQMSDEKTAADYKITGGAVLHLVLALRGASFHVSKRFKSAKLNSYKLLVIDSNFLGFYLH
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	89.7	Confident	87.7	Confident	60 Å²	60	63.7 Å²	63.7	30%	0.296	34%	0.338	S	S	.	.				0	137.3	0	64.5	172.6	175.3	0	0	108.5	D16 I17 A19 A56 I61	M1-D16 PolarHBondContact N-OD2 3.35Å; M1-I17 WeakPolarHBondContact CA-O 3.48Å; M1-I17 HydrophobicContact CE-CD1 3.84Å; M1-I17 HydrophobicContact CE-CG1 3.92Å; M1-I17 HydrophobicContact CG-CG1 4.01Å; M1-I17 WeakPolarHBondContact CG-O 3.32Å; M1-I17 PolarHBondContact N-O 3.37Å; M1-I17 PolarHBondContact O-N 3.12Å; M1-I17 VanDerWaalsContact O-O 3.04Å; M1-A19 HydrophobicContact CE-CB 4.04Å; M1-A56 HydrophobicContact CE-CB 3.76Å; M1-I61 HydrophobicContact CE-CB 4.3Å; M1-I61 HydrophobicContact CE-CG2 4.25Å; M1-I61 WeakPolarHBondContact CE-O 3.33Å
2	L	91.3	Very high	87.9	Confident	81 Å²	81	67.3 Å²	67.3	42%	0.424	35%	0.352	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.5	128.7	-173	-158.9	73	0	0	0	111.1	E14 D16 G63 G64	L2-E14 HydrophobicContact CD1-CB 4.27Å; L2-E14 HydrophobicContact CD2-CB 4.45Å; L2-E14 WeakPolarHBondContact CD2-OE1 3.36Å; L2-E14 HydrophobicContact CG-CB 4.41Å; L2-D16 HydrophobicContact CD1-CB 4.31Å; L2-G63 CarbonylContact O-C 3.58Å; L2-G63 WeakPolarHBondContact O-CA 3.41Å; L2-G64 PolarHBondContact O-N 3.44Å
3	I	92.8	Very high	88	Confident	0 Å²	0	63.5 Å²	63.5	0%	0	33%	0.333	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.3	160.6	173.6	60.7	153.6	0	0	0	110.4	V5 E14 L15 I17 I26 I61 A65 L67	I3-V5 HydrophobicContact CD1-CG2 4.16Å; I3-E14 WeakPolarHBondContact O-CA 3.49Å; I3-L15 HydrophobicContact CD1-CB 4.38Å; I3-L15 HydrophobicContact CG1-CB 3.99Å; I3-L15 WeakPolarHBondContact CG1-O 3.42Å; I3-L15 PolarHBondContact N-O 3.04Å; I3-L15 PolarHBondContact O-N 3.27Å; I3-I17 HydrophobicContact CD1-CD1 3.7Å; I3-I17 HydrophobicContact CD1-CG1 4.26Å; I3-I17 HydrophobicContact CD1-CG2 4.13Å; I3-I17 HydrophobicContact CG1-CD1 3.99Å; I3-I17 HydrophobicContact CG1-CG1 4.06Å; I3-I17 HydrophobicContact CG1-CG2 4.21Å; I3-I17 HydrophobicContact CG2-CD1 3.81Å; I3-I17 HydrophobicContact CG2-CG1 4.02Å; I3-I26 HydrophobicContact CD1-CG2 4.27Å; I3-I61 HydrophobicContact CG2-CG2 3.64Å; I3-A65 HydrophobicContact CG2-CB 4.32Å; I3-L67 HydrophobicContact CB-CD1 4.15Å; I3-L67 HydrophobicContact CD1-CD1 3.67Å; I3-L67 HydrophobicContact CD1-CD2 4.23Å
4	K	92.9	Very high	88.4	Confident	77 Å²	77	67.1 Å²	67.1	34%	0.335	35%	0.347	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.1	128.8	174.2	-64.5	-177.4	-179.9	-175.3	0	109.6	V13 E14 A65 V66 L67	K4-V13 CarbonylContact C-O 3.52Å; K4-E14 HydrophobicContact CG-CG 4.39Å; K4-A65 PolarHBondContact N-O 3.09Å; K4-V66 HydrophobicContact CB-CG2 4.22Å; K4-V66 HydrophobicContact CD-CG2 4.49Å; K4-V66 CarbonylContact O-C 3.6Å; K4-V66 VanDerWaalsContact O-CA 3.31Å; K4-V66 WeakPolarHBondContact O-CA 3.48Å; K4-L67 PolarHBondContact O-N 2.9Å
5	V	92.3	Very high	88.6	Confident	2 Å²	2	63 Å²	63	1%	0.012	33%	0.326	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.1	111.5	171.3	-179.5	0	0	0	0	108.3	I3 E12 V13 L15 V30 L43 L67 L69	I3-V5 HydrophobicContact CD1-CG2 4.16Å; V5-E12 WeakPolarHBondContact O-CA 3.41Å; V5-V13 PolarHBondContact N-O 3.44Å; V5-V13 PolarHBondContact O-N 3.17Å; V5-L15 HydrophobicContact CB-CD1 4.45Å; V5-L15 HydrophobicContact CG2-CD1 3.52Å; V5-L15 HydrophobicContact CG2-CG 4.19Å; V5-V30 HydrophobicContact CG2-CG2 4.31Å; V5-L43 HydrophobicContact CG1-CD2 4.3Å; V5-L67 CarbonylContact C-O 3.51Å; V5-L67 WeakPolarHBondContact CA-O 3.08Å; V5-L67 HydrophobicContact CG2-CB 4.45Å; V5-L69 HydrophobicContact CG1-CB 3.61Å; V5-L69 HydrophobicContact CG1-CD2 4.38Å
6	K	91	Very high	88.8	Confident	80 Å²	80	65.1 Å²	65.1	35%	0.348	34%	0.338	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.6	118.1	176.9	-169.6	168	-174.2	168.9	0	109.9	K11 E12 V66 L67 H68 L69	K6-K11 WeakPolarHBondContact CA-O 3.24Å; K6-E12 HydrophobicContact CB-CG 4.41Å; K6-E12 HydrophobicContact CD-CG 4.43Å; K6-E12 HydrophobicContact CG-CG 4.22Å; K6-V66 HydrophobicContact CB-CG1 4Å; K6-L67 PolarHBondContact N-O 2.71Å; K6-H68 CarbonylContact O-C 3.57Å; K6-H68 WeakPolarHBondContact O-CA 3.39Å; K6-L69 PolarHBondContact O-N 2.83Å
7	T	85.4	Confident	88.9	Confident	14 Å²	14	61.4 Å²	61.4	9%	0.086	32%	0.319	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.1	165.4	175.7	63.1	0	0	0	0	111.3	T9 G10 K11 E34 L69	T7-T9 PolarHBondContact O-N 3.4Å; T7-T9 PolarHBondContact OG1-OG1 3.44Å; T7-G10 PolarHBondContact O-N 3.03Å; T7-K11 PolarHBondContact N-O 3.2Å; T7-K11 WeakPolarHBondContact OG1-CB 3.44Å; T7-K11 PolarHBondContact OG1-N 3.08Å; T7-K11 PolarHBondContact OG1-O 3.42Å; T7-E34 WeakPolarHBondContact CG2-OE2 3.48Å; T7-L69 HydrophobicContact CG2-CD2 4.23Å
8	L	81.9	Confident	89.1	Confident	129 Å²	129	62.6 Å²	62.6	68%	0.675	33%	0.326	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.8	-24.6	173.7	-69.6	176.8	0	0	0	113.5	G10 V70	L8-G10 PolarHBondContact O-N 3.01Å; L8-V70 HydrophobicContact CD1-CG1 4.29Å; L8-V70 HydrophobicContact CD2-CG2 4.09Å
9	T	79	Confident	89.1	Confident	108 Å²	108	61.3 Å²	61.3	66%	0.663	33%	0.325	S	S	*	.	T	Hydrogen-bonded Turn	trans	-80.1	-3.1	176.9	61.6	0	0	0	0	112.8	T7 K11	T7-T9 PolarHBondContact O-N 3.4Å; T7-T9 PolarHBondContact OG1-OG1 3.44Å; T9-K11 VanDerWaalsContact C-N 3.34Å
10	G	82.3	Confident	89.2	Confident	39 Å²	39	62.8 Å²	62.8	40%	0.402	34%	0.341	S	S	.	.	S	Bend	trans	86.7	-2.5	-177.6	0	0	0	0	0	114.4	T7 L8	T7-G10 PolarHBondContact O-N 3.03Å; L8-G10 PolarHBondContact O-N 3.01Å
11	K	86.1	Confident	89.3	Confident	111 Å²	111	60.5 Å²	60.5	48%	0.483	33%	0.328	S	S	.	.			trans	-68.7	130.4	174	-175.9	-171.9	177.8	-164.1	0	110.3	K6 T7 T9 V13 E34	K6-K11 WeakPolarHBondContact CA-O 3.24Å; T7-K11 PolarHBondContact N-O 3.2Å; T7-K11 WeakPolarHBondContact OG1-CB 3.44Å; T7-K11 PolarHBondContact OG1-N 3.08Å; T7-K11 PolarHBondContact OG1-O 3.42Å; T9-K11 VanDerWaalsContact C-N 3.34Å; K11-V13 HydrophobicContact CD-CG2 4.36Å; K11-V13 HydrophobicContact CG-CG2 4.38Å; K11-E34 IonicContact NZ-OE1 2.71Å; K11-E34 PolarHBondContact NZ-OE1 3.11Å
12	E	90.6	Very high	89.5	Confident	106 Å²	106	63 Å²	63	50%	0.495	34%	0.338	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.6	125.8	175	-62.3	179.2	101.2	0	0	109.6	V5 K6	V5-E12 WeakPolarHBondContact O-CA 3.41Å; K6-E12 HydrophobicContact CB-CG 4.41Å; K6-E12 HydrophobicContact CD-CG 4.43Å; K6-E12 HydrophobicContact CG-CG 4.22Å
13	V	89.3	Confident	89.5	Confident	19 Å²	19	59.2 Å²	59.2	12%	0.115	32%	0.318	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.1	126.5	178.1	-177.8	0	0	0	0	109.1	K4 V5 K11 L15 K33 E34	K4-V13 CarbonylContact C-O 3.52Å; V5-V13 PolarHBondContact N-O 3.44Å; V5-V13 PolarHBondContact O-N 3.17Å; K11-V13 HydrophobicContact CD-CG2 4.36Å; K11-V13 HydrophobicContact CG-CG2 4.38Å; V13-L15 HydrophobicContact CG1-CD2 4.33Å; V13-K33 HydrophobicContact CG1-CB 4.07Å; V13-K33 HydrophobicContact CG1-CG 4.16Å; V13-E34 HydrophobicContact CG2-CG 4.44Å; V13-E34 WeakPolarHBondContact CG2-OE1 3.4Å
14	E	92.4	Very high	89.5	Confident	113 Å²	113	64.4 Å²	64.4	53%	0.528	34%	0.342	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.6	127	176	-63.9	-176.8	110.6	0	0	110.5	L2 I3 K4	L2-E14 HydrophobicContact CD1-CB 4.27Å; L2-E14 HydrophobicContact CD2-CB 4.45Å; L2-E14 WeakPolarHBondContact CD2-OE1 3.36Å; L2-E14 HydrophobicContact CG-CB 4.41Å; I3-E14 WeakPolarHBondContact O-CA 3.49Å; K4-E14 HydrophobicContact CG-CG 4.39Å
15	L	91.5	Very high	89.5	Confident	6 Å²	6	67.2 Å²	67.2	3%	0.031	35%	0.351	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.2	132.1	176.7	-64.7	179.6	0	0	0	109.9	I3 V5 V13 I17 K29 V30 K33	I3-L15 HydrophobicContact CD1-CB 4.38Å; I3-L15 HydrophobicContact CG1-CB 3.99Å; I3-L15 WeakPolarHBondContact CG1-O 3.42Å; I3-L15 PolarHBondContact N-O 3.04Å; I3-L15 PolarHBondContact O-N 3.27Å; V5-L15 HydrophobicContact CB-CD1 4.45Å; V5-L15 HydrophobicContact CG2-CD1 3.52Å; V5-L15 HydrophobicContact CG2-CG 4.19Å; V13-L15 HydrophobicContact CG1-CD2 4.33Å; L15-I17 HydrophobicContact CB-CG2 4.33Å; L15-K29 HydrophobicContact CD1-CB 4.47Å; L15-K29 HydrophobicContact CD2-CB 4.29Å; L15-V30 HydrophobicContact CD1-CB 4.45Å; L15-V30 HydrophobicContact CD1-CG2 3.42Å; L15-V30 VanDerWaalsContact CD1-CG2 3.42Å; L15-K33 HydrophobicContact CD2-CG 3.65Å
16	D	91.8	Very high	89.4	Confident	97 Å²	97	67.2 Å²	67.2	52%	0.519	35%	0.35	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.8	120.3	168.9	-175.2	-112.3	0	0	0	109.6	M1 L2 K29	M1-D16 PolarHBondContact N-OD2 3.35Å; L2-D16 HydrophobicContact CD1-CB 4.31Å; D16-K29 WeakPolarHBondContact O-CD 3.46Å; D16-K29 VanDerWaalsContact O-CE 3.31Å; D16-K29 WeakPolarHBondContact O-CE 3.33Å; D16-K29 PolarHBondContact O-NZ 3.5Å
17	I	90.9	Very high	89.4	Confident	2 Å²	2	64.5 Å²	64.5	1%	0.01	34%	0.339	C	S	.	.			trans	-130.9	156.8	-179.1	67.9	166.5	0	0	0	109.7	M1 I3 L15 I26 K29 A56 I61	M1-I17 WeakPolarHBondContact CA-O 3.48Å; M1-I17 HydrophobicContact CE-CD1 3.84Å; M1-I17 HydrophobicContact CE-CG1 3.92Å; M1-I17 HydrophobicContact CG-CG1 4.01Å; M1-I17 WeakPolarHBondContact CG-O 3.32Å; M1-I17 PolarHBondContact N-O 3.37Å; M1-I17 PolarHBondContact O-N 3.12Å; M1-I17 VanDerWaalsContact O-O 3.04Å; I3-I17 HydrophobicContact CD1-CD1 3.7Å; I3-I17 HydrophobicContact CD1-CG1 4.26Å; I3-I17 HydrophobicContact CD1-CG2 4.13Å; I3-I17 HydrophobicContact CG1-CD1 3.99Å; I3-I17 HydrophobicContact CG1-CG1 4.06Å; I3-I17 HydrophobicContact CG1-CG2 4.21Å; I3-I17 HydrophobicContact CG2-CD1 3.81Å; I3-I17 HydrophobicContact CG2-CG1 4.02Å; L15-I17 HydrophobicContact CB-CG2 4.33Å; I17-I26 HydrophobicContact CB-CG1 4.47Å; I17-I26 HydrophobicContact CD1-CD1 3.71Å; I17-I26 HydrophobicContact CD1-CG1 4.25Å; I17-I26 HydrophobicContact CG2-CG1 4.03Å; I17-I26 HydrophobicContact CG2-CG2 4.36Å; I17-K29 HydrophobicContact CG2-CD 4.08Å; I17-A56 HydrophobicContact CD1-CB 3.94Å; I17-I61 HydrophobicContact CD1-CG2 4.35Å
18	D	91.8	Very high	89.7	Confident	82 Å²	82	68.7 Å²	68.7	44%	0.439	36%	0.357	S	S	.	.			trans	-94.7	154.3	169.6	-160.9	-96	0	0	0	111.7	S20 D21	D18-S20 PolarHBondContact O-N 3.3Å; D18-S20 WeakPolarHBondContact OD1-CB 3.45Å; D18-S20 PolarHBondContact OD1-N 2.88Å; D18-S20 PolarHBondContact OD1-OG 3.1Å; D18-D21 HydrophobicContact CB-CB 4.4Å; D18-D21 WeakPolarHBondContact CB-OD2 3.23Å; D18-D21 PolarHBondContact N-OD2 3.1Å; D18-D21 WeakPolarHBondContact O-CB 3.42Å; D18-D21 PolarHBondContact O-N 2.82Å
19	A	89.6	Confident	90.1	Very high	38 Å²	38	65.8 Å²	65.8	31%	0.314	34%	0.339	S	S	.	.	T	Hydrogen-bonded Turn	trans	-63.1	-28	173.7	0	0	0	0	0	111.6	M1 D21 A57	M1-A19 HydrophobicContact CE-CB 4.04Å; A19-D21 VanDerWaalsContact C-N 3.32Å; A19-A57 HydrophobicContact CB-CB 4.25Å; A19-A57 WeakPolarHBondContact O-CB 3.47Å; A19-A57 PolarHBondContact O-N 2.78Å
20	S	91.3	Very high	90.5	Very high	92 Å²	92	60.8 Å²	60.8	64%	0.643	31%	0.308	S	S	*	.	T	Hydrogen-bonded Turn	trans	-79.5	-13.5	176.4	-40.9	0	0	0	0	112.9	D18	D18-S20 PolarHBondContact O-N 3.3Å; D18-S20 WeakPolarHBondContact OD1-CB 3.45Å; D18-S20 PolarHBondContact OD1-N 2.88Å; D18-S20 PolarHBondContact OD1-OG 3.1Å
21	D	91.7	Very high	90.7	Very high	15 Å²	15	62.9 Å²	62.9	8%	0.08	31%	0.308	C	S	.	.			trans	-69.5	137.2	-179.9	-80.7	-40.7	0	0	0	111.3	D18 A19 R25 T55 A56	D18-D21 HydrophobicContact CB-CB 4.4Å; D18-D21 WeakPolarHBondContact CB-OD2 3.23Å; D18-D21 PolarHBondContact N-OD2 3.1Å; D18-D21 WeakPolarHBondContact O-CB 3.42Å; D18-D21 PolarHBondContact O-N 2.82Å; A19-D21 VanDerWaalsContact C-N 3.32Å; D21-R25 WeakPolarHBondContact OD1-CD 3.36Å; D21-R25 IonicContact OD1-CZ 2.74Å; D21-R25 IonicContact OD1-NE 3.53Å; D21-R25 IonicContact OD1-NH1 3.43Å; D21-R25 PolarHBondContact OD1-NH1 2.69Å; D21-T55 CarbonylContact O-C 3.55Å; D21-T55 VanDerWaalsContact O-CA 3.32Å; D21-T55 WeakPolarHBondContact O-CA 3.46Å; D21-A56 PolarHBondContact O-N 2.95Å
22	K	93.4	Very high	90.7	Very high	113 Å²	113	61.8 Å²	61.8	49%	0.491	32%	0.319	S	S	.	.	B	Isolated β-bridge	trans	-72.5	153.9	170.8	-69.1	-174.5	178.9	-176.4	0	111	E24 R25 I26 T55	K22-E24 PolarHBondContact O-N 3.03Å; K22-R25 PolarHBondContact O-N 3.16Å; K22-I26 PolarHBondContact O-N 2.89Å; K22-T55 HydrophobicContact CG-CG2 4.09Å
23	V	92.1	Very high	90.3	Very high	0 Å²	0	63 Å²	63	0%	0	32%	0.323	C	S	.	.	H	α-helix	trans	-57	-34	174.1	169.1	0	0	0	0	111.8	R25 I26 K27 L43 M50 S51 K54 Y59	V23-R25 VanDerWaalsContact C-N 3.33Å; V23-R25 PolarHBondContact O-N 2.94Å; V23-I26 WeakPolarHBondContact O-CB 3.34Å; V23-I26 PolarHBondContact O-N 3.03Å; V23-K27 WeakPolarHBondContact O-CG 3.43Å; V23-K27 PolarHBondContact O-N 3.38Å; V23-L43 HydrophobicContact CG1-CD1 4.29Å; V23-M50 HydrophobicContact CB-CB 4.48Å; V23-M50 HydrophobicContact CG1-CB 3.7Å; V23-M50 HydrophobicContact CG2-CB 3.91Å; V23-M50 HydrophobicContact CG2-CE 3.62Å; V23-S51 VanDerWaalsContact CB-O 3.25Å; V23-S51 WeakPolarHBondContact CB-O 3.45Å; V23-S51 WeakPolarHBondContact CG2-O 3.48Å; V23-K54 WeakPolarHBondContact CG2-O 3.37Å; V23-K54 PolarHBondContact N-O 3.44Å; V23-Y59 HydrophobicContact CG2-CD2 4.45Å; V23-Y59 HydrophobicContact CG2-CE2 4.16Å
24	E	92.7	Very high	89.9	Confident	109 Å²	109	64.8 Å²	64.8	51%	0.509	33%	0.33	S	S	.	.	H	α-helix	trans	-52.4	-49.3	172.2	-174.3	174.8	71.2	0	0	112.1	K22 I26 K27 E28 D52	K22-E24 PolarHBondContact O-N 3.03Å; E24-I26 VanDerWaalsContact C-N 3.32Å; E24-I26 PolarHBondContact O-N 3.49Å; E24-K27 WeakPolarHBondContact O-CA 3.12Å; E24-K27 WeakPolarHBondContact O-CB 3.4Å; E24-K27 PolarHBondContact O-N 3.46Å; E24-E28 PolarHBondContact O-N 3.2Å; E24-D52 HydrophobicContact CB-CB 4.24Å
25	R	91.9	Very high	89.3	Confident	137 Å²	137	61.7 Å²	61.7	52%	0.517	33%	0.328	S	S	.	.	H	α-helix	trans	-66.8	-31.9	178.6	-171.7	154.8	178.8	-154.5	15.7	113.3	D21 K22 V23 K27 E28 K29	D21-R25 WeakPolarHBondContact OD1-CD 3.36Å; D21-R25 IonicContact OD1-CZ 2.74Å; D21-R25 IonicContact OD1-NE 3.53Å; D21-R25 IonicContact OD1-NH1 3.43Å; D21-R25 PolarHBondContact OD1-NH1 2.69Å; K22-R25 PolarHBondContact O-N 3.16Å; V23-R25 VanDerWaalsContact C-N 3.33Å; V23-R25 PolarHBondContact O-N 2.94Å; R25-K27 VanDerWaalsContact C-N 3.32Å; R25-E28 WeakPolarHBondContact CA-OE2 3.48Å; R25-E28 PolarHBondContact O-N 3.24Å; R25-K29 WeakPolarHBondContact O-CG 3.25Å; R25-K29 PolarHBondContact O-N 2.82Å; R25-K29 VanDerWaalsContact O-N 3.12Å
26	I	91.2	Very high	88.7	Confident	1 Å²	1	62.5 Å²	62.5	1%	0.005	33%	0.332	C	S	.	.	H	α-helix	trans	-63.6	-42.6	171.3	-54.6	176.2	0	0	0	109.6	I3 I17 K22 V23 E24 K29 V30 L43 A56	I3-I26 HydrophobicContact CD1-CG2 4.27Å; I17-I26 HydrophobicContact CB-CG1 4.47Å; I17-I26 HydrophobicContact CD1-CD1 3.71Å; I17-I26 HydrophobicContact CD1-CG1 4.25Å; I17-I26 HydrophobicContact CG2-CG1 4.03Å; I17-I26 HydrophobicContact CG2-CG2 4.36Å; K22-I26 PolarHBondContact O-N 2.89Å; V23-I26 WeakPolarHBondContact O-CB 3.34Å; V23-I26 PolarHBondContact O-N 3.03Å; E24-I26 VanDerWaalsContact C-N 3.32Å; E24-I26 PolarHBondContact O-N 3.49Å; I26-K29 WeakPolarHBondContact O-CB 3.26Å; I26-K29 PolarHBondContact O-N 3.17Å; I26-V30 VanDerWaalsContact O-CG2 3.3Å; I26-V30 WeakPolarHBondContact O-CG2 3.36Å; I26-V30 PolarHBondContact O-N 2.59Å; I26-L43 HydrophobicContact CB-CD1 4.23Å; I26-L43 HydrophobicContact CG2-CD1 3.8Å; I26-A56 HydrophobicContact CD1-CB 4.31Å
27	K	90.5	Very high	88.3	Confident	24 Å²	24	59.3 Å²	59.3	10%	0.104	32%	0.317	C	S	.	.	H	α-helix	trans	-63.9	-40.3	177.9	-68.4	177.4	178	-178.1	0	112.7	V23 E24 R25 K29 V30 E31 P38 Q41 L43	V23-K27 WeakPolarHBondContact O-CG 3.43Å; V23-K27 PolarHBondContact O-N 3.38Å; E24-K27 WeakPolarHBondContact O-CA 3.12Å; E24-K27 WeakPolarHBondContact O-CB 3.4Å; E24-K27 PolarHBondContact O-N 3.46Å; R25-K27 VanDerWaalsContact C-N 3.32Å; K27-K29 VanDerWaalsContact C-N 3.32Å; K27-K29 PolarHBondContact O-N 3.19Å; K27-V30 CarbonylContact O-C 3.59Å; K27-V30 WeakPolarHBondContact O-CB 3.45Å; K27-V30 PolarHBondContact O-N 2.77Å; K27-E31 PolarHBondContact O-N 3.21Å; K27-P38 HydrophobicContact CB-CB 3.93Å; K27-P38 HydrophobicContact CB-CG 4.32Å; K27-P38 HydrophobicContact CD-CB 4.22Å; K27-Q41 HydrophobicContact CD-CB 4.49Å; K27-Q41 HydrophobicContact CG-CB 4.36Å; K27-Q41 PolarHBondContact O-NE2 3.39Å; K27-Q41 PolarHBondContact O-OE1 3.11Å; K27-L43 HydrophobicContact CG-CD1 3.8Å; K27-L43 HydrophobicContact CG-CG 4.43Å
28	E	90.9	Very high	88.1	Confident	101 Å²	101	60.6 Å²	60.6	47%	0.472	33%	0.325	S	S	.	.	H	α-helix	trans	-60	-42.1	173.4	-66.3	178.3	93.9	0	0	111.6	E24 R25 V30 E31 A32	E24-E28 PolarHBondContact O-N 3.2Å; R25-E28 WeakPolarHBondContact CA-OE2 3.48Å; R25-E28 PolarHBondContact O-N 3.24Å; E28-V30 VanDerWaalsContact C-N 3.34Å; E28-V30 PolarHBondContact O-N 3.23Å; E28-E31 WeakPolarHBondContact O-CB 3.45Å; E28-E31 PolarHBondContact O-N 3.24Å; E28-A32 PolarHBondContact O-N 2.96Å
29	K	90.7	Very high	87.7	Confident	69 Å²	69	61.9 Å²	61.9	30%	0.3	34%	0.339	S	S	.	.	H	α-helix	trans	-64.7	-38.3	174.8	-74.1	171.8	177.8	-95.7	0	112.3	L15 D16 I17 R25 I26 K27 E31 A32 K33	L15-K29 HydrophobicContact CD1-CB 4.47Å; L15-K29 HydrophobicContact CD2-CB 4.29Å; D16-K29 WeakPolarHBondContact O-CD 3.46Å; D16-K29 VanDerWaalsContact O-CE 3.31Å; D16-K29 WeakPolarHBondContact O-CE 3.33Å; D16-K29 PolarHBondContact O-NZ 3.5Å; I17-K29 HydrophobicContact CG2-CD 4.08Å; R25-K29 WeakPolarHBondContact O-CG 3.25Å; R25-K29 PolarHBondContact O-N 2.82Å; R25-K29 VanDerWaalsContact O-N 3.12Å; I26-K29 WeakPolarHBondContact O-CB 3.26Å; I26-K29 PolarHBondContact O-N 3.17Å; K27-K29 VanDerWaalsContact C-N 3.32Å; K27-K29 PolarHBondContact O-N 3.19Å; K29-E31 VanDerWaalsContact C-N 3.35Å; K29-A32 PolarHBondContact O-N 2.85Å; K29-K33 WeakPolarHBondContact O-CG 3.36Å; K29-K33 PolarHBondContact O-N 2.82Å
30	V	87.8	Confident	87.4	Confident	3 Å²	3	62 Å²	62	2%	0.018	33%	0.333	C	S	.	.	H	α-helix	trans	-64.2	-41.1	172.9	175.4	0	0	0	0	110.3	V5 L15 I26 K27 E28 A32 K33 E34 Q41 L43 L69	V5-V30 HydrophobicContact CG2-CG2 4.31Å; L15-V30 HydrophobicContact CD1-CB 4.45Å; L15-V30 HydrophobicContact CD1-CG2 3.42Å; L15-V30 VanDerWaalsContact CD1-CG2 3.42Å; I26-V30 VanDerWaalsContact O-CG2 3.3Å; I26-V30 WeakPolarHBondContact O-CG2 3.36Å; I26-V30 PolarHBondContact O-N 2.59Å; K27-V30 CarbonylContact O-C 3.59Å; K27-V30 WeakPolarHBondContact O-CB 3.45Å; K27-V30 PolarHBondContact O-N 2.77Å; E28-V30 VanDerWaalsContact C-N 3.34Å; E28-V30 PolarHBondContact O-N 3.23Å; V30-A32 VanDerWaalsContact C-N 3.33Å; V30-A32 PolarHBondContact O-N 3.41Å; V30-K33 PolarHBondContact O-N 2.88Å; V30-K33 VanDerWaalsContact O-N 3.1Å; V30-E34 HydrophobicContact CG1-CB 4.43Å; V30-E34 HydrophobicContact CG1-CG 4.39Å; V30-E34 PolarHBondContact O-N 2.92Å; V30-Q41 HydrophobicContact CG1-CG 4.5Å; V30-L43 HydrophobicContact CG2-CD2 4.42Å; V30-L69 HydrophobicContact CG1-CD1 4.33Å; V30-L69 HydrophobicContact CG1-CD2 3.7Å
31	E	86.4	Confident	87.3	Confident	82 Å²	82	57.8 Å²	57.8	38%	0.383	30%	0.303	S	S	.	.	H	α-helix	trans	-59.6	-44.9	176.6	179.1	-176.1	-176.7	0	0	110.7	K27 E28 K29 K33 G35 I36 P38 Q41	K27-E31 PolarHBondContact O-N 3.21Å; E28-E31 WeakPolarHBondContact O-CB 3.45Å; E28-E31 PolarHBondContact O-N 3.24Å; K29-E31 VanDerWaalsContact C-N 3.35Å; E31-K33 PolarHBondContact O-N 3.48Å; E31-G35 WeakPolarHBondContact O-CA 3.49Å; E31-G35 PolarHBondContact O-N 2.85Å; E31-I36 WeakPolarHBondContact CA-O 3.41Å; E31-I36 VanDerWaalsContact CB-O 3.23Å; E31-I36 WeakPolarHBondContact CB-O 3.4Å; E31-I36 WeakPolarHBondContact CG-O 3.38Å; E31-P38 WeakPolarHBondContact OE2-CD 3.49Å; E31-Q41 VanDerWaalsContact N-NE2 3.15Å
32	A	85.5	Confident	87.2	Confident	88 Å²	88	62.5 Å²	62.5	73%	0.727	32%	0.319	S	S	*	.	H	α-helix	trans	-62.7	-24.4	177.8	0	0	0	0	0	113.6	E28 K29 V30	E28-A32 PolarHBondContact O-N 2.96Å; K29-A32 PolarHBondContact O-N 2.85Å; V30-A32 VanDerWaalsContact C-N 3.33Å; V30-A32 PolarHBondContact O-N 3.41Å
33	K	82.7	Confident	87.1	Confident	133 Å²	133	57.2 Å²	57.2	58%	0.578	30%	0.296	S	S	*	.	H	α-helix	trans	-96.1	-45.7	-178.8	-68.8	-67.4	-169.5	172.4	0	113.6	V13 L15 K29 V30 E31	V13-K33 HydrophobicContact CG1-CB 4.07Å; V13-K33 HydrophobicContact CG1-CG 4.16Å; L15-K33 HydrophobicContact CD2-CG 3.65Å; K29-K33 WeakPolarHBondContact O-CG 3.36Å; K29-K33 PolarHBondContact O-N 2.82Å; V30-K33 PolarHBondContact O-N 2.88Å; V30-K33 VanDerWaalsContact O-N 3.1Å; E31-K33 PolarHBondContact O-N 3.48Å
34	E	81.2	Confident	87	Confident	55 Å²	55	59.5 Å²	59.5	26%	0.257	31%	0.308	S	S	.	.	H	α-helix	trans	-102.2	-14.6	-174.3	-67.3	-69.5	105.6	0	0	112.9	T7 K11 V13 V30 I36	T7-E34 WeakPolarHBondContact CG2-OE2 3.48Å; K11-E34 IonicContact NZ-OE1 2.71Å; K11-E34 PolarHBondContact NZ-OE1 3.11Å; V13-E34 HydrophobicContact CG2-CG 4.44Å; V13-E34 WeakPolarHBondContact CG2-OE1 3.4Å; V30-E34 HydrophobicContact CG1-CB 4.43Å; V30-E34 HydrophobicContact CG1-CG 4.39Å; V30-E34 PolarHBondContact O-N 2.92Å; E34-I36 VanDerWaalsContact C-N 3.31Å; E34-I36 HydrophobicContact CB-CD1 3.76Å; E34-I36 HydrophobicContact CB-CG1 4.16Å; E34-I36 PolarHBondContact O-N 2.93Å
35	G	80.1	Confident	86.9	Confident	48 Å²	48	56.4 Å²	56.4	50%	0.495	29%	0.292	S	S	.	.			trans	76.6	13.9	-179.5	0	0	0	0	0	114.7	E31	E31-G35 WeakPolarHBondContact O-CA 3.49Å; E31-G35 PolarHBondContact O-N 2.85Å
36	I	79.5	Confident	86.8	Confident	23 Å²	23	54.4 Å²	54.4	12%	0.118	31%	0.305	C	S	.	.			trans	-95.4	127.2	-177.3	-57.5	157.1	0	0	0	108.6	E31 E34 Q40 Q41 L69 L71	E31-I36 WeakPolarHBondContact CA-O 3.41Å; E31-I36 VanDerWaalsContact CB-O 3.23Å; E31-I36 WeakPolarHBondContact CB-O 3.4Å; E31-I36 WeakPolarHBondContact CG-O 3.38Å; E34-I36 VanDerWaalsContact C-N 3.31Å; E34-I36 HydrophobicContact CB-CD1 3.76Å; E34-I36 HydrophobicContact CB-CG1 4.16Å; E34-I36 PolarHBondContact O-N 2.93Å; I36-Q40 HydrophobicContact CG2-CB 3.97Å; I36-Q41 HydrophobicContact CB-CG 4.11Å; I36-Q41 HydrophobicContact CG2-CG 3.65Å; I36-Q41 PolarHBondContact O-NE2 2.84Å; I36-L69 HydrophobicContact CD1-CD2 3.92Å; I36-L71 HydrophobicContact CB-CD2 4.46Å; I36-L71 HydrophobicContact CD1-CD2 3.71Å; I36-L71 HydrophobicContact CG1-CD2 4.08Å; I36-L71 HydrophobicContact CG2-CD2 3.57Å
37	P	83.3	Confident	86.6	Confident	31 Å²	31	58.1 Å²	58.1	20%	0.201	34%	0.343	C	S	.	.			trans	-68.8	143.7	-179.6	27.8	-35.2	0	0	0	112.2	P39 Q40 Q41	P37-P39 VanDerWaalsContact C-CD 3.4Å; P37-P39 HydrophobicContact CB-CG 4.36Å; P37-Q40 VanDerWaalsContact CD-OE1 3.3Å; P37-Q40 HydrophobicContact CG-CB 4.09Å; P37-Q40 HydrophobicContact CG-CG 3.85Å; P37-Q40 VanDerWaalsContact CG-OE1 3.27Å; P37-Q40 WeakPolarHBondContact O-CA 3.49Å; P37-Q40 WeakPolarHBondContact O-CB 3.19Å; P37-Q40 PolarHBondContact O-N 2.83Å; P37-Q41 PolarHBondContact O-N 3.22Å
38	P	85.9	Confident	86.5	Confident	28 Å²	28	62.8 Å²	62.8	18%	0.182	36%	0.363	C	S	.	.	G	3₁₀ helix	trans	-46.8	-40.9	-178.8	-29	32.7	0	0	0	116.9	K27 E31 Q40 Q41	K27-P38 HydrophobicContact CB-CB 3.93Å; K27-P38 HydrophobicContact CB-CG 4.32Å; K27-P38 HydrophobicContact CD-CB 4.22Å; E31-P38 WeakPolarHBondContact OE2-CD 3.49Å; P38-Q40 PolarHBondContact O-N 2.82Å; P38-Q41 PolarHBondContact O-N 3.41Å; P38-Q41 VanDerWaalsContact O-N 3.12Å
39	P	83.7	Confident	86.5	Confident	110 Å²	110	62.9 Å²	62.9	71%	0.714	36%	0.364	S	S	*	.	G	3₁₀ helix	trans	-66.3	-22.7	177	24.7	-36.3	0	0	0	113.8	P37	P37-P39 VanDerWaalsContact C-CD 3.4Å; P37-P39 HydrophobicContact CB-CG 4.36Å
40	Q	83.9	Confident	86.5	Confident	41 Å²	41	59.7 Å²	59.7	19%	0.192	35%	0.35	C	S	.	.	G	3₁₀ helix	trans	-88.8	-10.5	175.6	-66.2	176.6	0.5	0	0	112.2	I36 P37 P38 L71 A72 S77	I36-Q40 HydrophobicContact CG2-CB 3.97Å; P37-Q40 VanDerWaalsContact CD-OE1 3.3Å; P37-Q40 HydrophobicContact CG-CB 4.09Å; P37-Q40 HydrophobicContact CG-CG 3.85Å; P37-Q40 VanDerWaalsContact CG-OE1 3.27Å; P37-Q40 WeakPolarHBondContact O-CA 3.49Å; P37-Q40 WeakPolarHBondContact O-CB 3.19Å; P37-Q40 PolarHBondContact O-N 2.83Å; P38-Q40 PolarHBondContact O-N 2.82Å; Q40-L71 CarbonylContact O-C 3.6Å; Q40-A72 PolarHBondContact O-N 3.01Å; Q40-S77 PolarHBondContact NE2-O 2.92Å
41	Q	88	Confident	86.6	Confident	3 Å²	3	62 Å²	62	1%	0.014	37%	0.366	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.6	125.8	179.9	-61.4	180	11.3	0	0	111.7	K27 V30 E31 I36 P37 P38 L69	K27-Q41 HydrophobicContact CD-CB 4.49Å; K27-Q41 HydrophobicContact CG-CB 4.36Å; K27-Q41 PolarHBondContact O-NE2 3.39Å; K27-Q41 PolarHBondContact O-OE1 3.11Å; V30-Q41 HydrophobicContact CG1-CG 4.5Å; E31-Q41 VanDerWaalsContact N-NE2 3.15Å; I36-Q41 HydrophobicContact CB-CG 4.11Å; I36-Q41 HydrophobicContact CG2-CG 3.65Å; I36-Q41 PolarHBondContact O-NE2 2.84Å; P37-Q41 PolarHBondContact O-N 3.22Å; P38-Q41 PolarHBondContact O-N 3.41Å; P38-Q41 VanDerWaalsContact O-N 3.12Å; Q41-L69 HydrophobicContact CB-CD1 3.85Å; Q41-L69 HydrophobicContact CG-CD1 4.08Å
42	R	89.1	Confident	86.8	Confident	114 Å²	114	61.6 Å²	61.6	43%	0.43	37%	0.367	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.5	107.6	165.1	-65.7	-176.9	-178.1	-172.2	3.1	109.1	V70 A72	R42-V70 WeakPolarHBondContact CA-O 3.15Å; R42-V70 HydrophobicContact CB-CB 4.2Å; R42-V70 WeakPolarHBondContact CB-O 3.31Å; R42-V70 PolarHBondContact N-O 2.74Å; R42-V70 PolarHBondContact O-N 2.96Å; R42-A72 HydrophobicContact CG-CB 4.05Å
43	L	91.1	Very high	87	Confident	1 Å²	1	65 Å²	65	1%	0.005	37%	0.368	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.1	131.2	170.7	-66	172.4	0	0	0	108.8	V5 V23 I26 K27 V30 M50 L69	V5-L43 HydrophobicContact CG1-CD2 4.3Å; V23-L43 HydrophobicContact CG1-CD1 4.29Å; I26-L43 HydrophobicContact CB-CD1 4.23Å; I26-L43 HydrophobicContact CG2-CD1 3.8Å; K27-L43 HydrophobicContact CG-CD1 3.8Å; K27-L43 HydrophobicContact CG-CG 4.43Å; V30-L43 HydrophobicContact CG2-CD2 4.42Å; L43-M50 HydrophobicContact CB-CB 4.01Å; L43-M50 HydrophobicContact CB-CG 3.93Å; L43-M50 WeakPolarHBondContact O-CB 3.32Å; L43-M50 WeakPolarHBondContact O-CG 3.34Å; L43-M50 PolarHBondContact O-N 3.22Å; L43-L69 HydrophobicContact CD2-CB 4.35Å; L43-L69 HydrophobicContact CD2-CD1 3.87Å
44	I	90.8	Very high	87.5	Confident	49 Å²	49	62 Å²	62	25%	0.251	36%	0.355	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.7	127.4	179	-55.4	173.8	0	0	0	107.8	K48 H68 V70	I44-K48 WeakPolarHBondContact CA-O 3.45Å; I44-H68 HydrophobicContact CB-CB 4.27Å; I44-H68 PolarHBondContact N-O 3.02Å; I44-H68 PolarHBondContact O-N 3.19Å; I44-V70 HydrophobicContact CD1-CB 4.34Å; I44-V70 HydrophobicContact CD1-CG2 3.61Å; I44-V70 HydrophobicContact CG1-CG2 4.48Å
45	Y	91.5	Very high	88	Confident	44 Å²	44	61.4 Å²	61.4	17%	0.173	36%	0.355	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.3	135.6	177	-176.8	-113.8	0	0	0	109.5	G47 K48 M50 Y59 I61 A65 L67	Y45-G47 PolarHBondContact O-N 3.29Å; Y45-G47 VanDerWaalsContact O-N 3.11Å; Y45-K48 PolarHBondContact N-O 3.02Å; Y45-K48 PolarHBondContact O-N 3.12Å; Y45-K48 VanDerWaalsContact O-O 3.11Å; Y45-M50 VanDerWaalsContact CB-SD 3.58Å; Y45-Y59 WeakPolarHBondContact CE1-O 3.31Å; Y45-I61 HydrophobicContact CD1-CG1 4.1Å; Y45-I61 HydrophobicContact CE1-CG1 4.04Å; Y45-A65 HydrophobicContact CE2-CB 3.78Å; Y45-L67 HydrophobicContact CD2-CD1 4.27Å; Y45-L67 HydrophobicContact CD2-CG 4.11Å; Y45-L67 HydrophobicContact CG-CG 4.48Å
46	A	88.7	Confident	88.5	Confident	95 Å²	95	59.1 Å²	59.1	79%	0.785	33%	0.331	S	S	*	.	T	Hydrogen-bonded Turn	trans	50.3	35.7	-176.6	0	0	0	0	0	113.9	K48	A46-K48 PolarHBondContact O-N 3.42Å
47	G	87.4	Confident	89	Confident	78 Å²	78	60.5 Å²	60.5	80%	0.804	35%	0.346	S	S	*	.	T	Hydrogen-bonded Turn	trans	75.1	2.1	-177.4	0	0	0	0	0	115.3	Y45	Y45-G47 PolarHBondContact O-N 3.29Å; Y45-G47 VanDerWaalsContact O-N 3.11Å
48	K	88.9	Confident	89.4	Confident	122 Å²	122	63 Å²	63	53%	0.53	36%	0.358	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.6	134.4	179.2	-169.5	167.6	-179.3	174.7	0	111	I44 Y45 A46 M50 Y59	I44-K48 WeakPolarHBondContact CA-O 3.45Å; Y45-K48 PolarHBondContact N-O 3.02Å; Y45-K48 PolarHBondContact O-N 3.12Å; Y45-K48 VanDerWaalsContact O-O 3.11Å; A46-K48 PolarHBondContact O-N 3.42Å; K48-M50 PolarHBondContact O-N 3.48Å; K48-Y59 HydrophobicContact CD-CE1 4.19Å; K48-Y59 HydrophobicContact CG-CE1 4.37Å
49	Q	89.7	Confident	89.6	Confident	103 Å²	103	63 Å²	63	48%	0.481	35%	0.354	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-66.9	134.2	170.7	-171.4	-179.3	-57.6	0	0	109.7	Y59	Q49-Y59 PolarHBondContact O-OH 2.85Å
50	M	90.6	Very high	89.9	Confident	2 Å²	2	66 Å²	66	1%	0.01	36%	0.356	C	S	.	.	P	Polyproline II helix	trans	-78.9	128.2	178.6	-56.5	-67.4	-73.8	0	0	109.9	V23 L43 Y45 K48 Y59 I61	V23-M50 HydrophobicContact CB-CB 4.48Å; V23-M50 HydrophobicContact CG1-CB 3.7Å; V23-M50 HydrophobicContact CG2-CB 3.91Å; V23-M50 HydrophobicContact CG2-CE 3.62Å; L43-M50 HydrophobicContact CB-CB 4.01Å; L43-M50 HydrophobicContact CB-CG 3.93Å; L43-M50 WeakPolarHBondContact O-CB 3.32Å; L43-M50 WeakPolarHBondContact O-CG 3.34Å; L43-M50 PolarHBondContact O-N 3.22Å; Y45-M50 VanDerWaalsContact CB-SD 3.58Å; K48-M50 PolarHBondContact O-N 3.48Å; M50-Y59 WeakPolarHBondContact CA-OH 3.39Å; M50-Y59 HydrophobicContact CB-CE2 4.39Å; M50-Y59 HydrophobicContact CE-CD1 3.92Å; M50-Y59 HydrophobicContact CE-CD2 3.02Å; M50-Y59 HydrophobicContact CE-CE1 4.26Å; M50-Y59 HydrophobicContact CE-CE2 3.4Å; M50-Y59 HydrophobicContact CE-CG 3.28Å; M50-Y59 HydrophobicContact SD-CD1 3.37Å; M50-Y59 WeakPolarHBondContact SD-CD1 3.3Å; M50-Y59 HydrophobicContact SD-CD2 3.58Å; M50-Y59 VanDerWaalsContact SD-CD2 3.58Å; M50-Y59 HydrophobicContact SD-CE1 3.43Å; M50-Y59 WeakPolarHBondContact SD-CE1 3.46Å; M50-Y59 HydrophobicContact SD-CE2 3.6Å; M50-Y59 VanDerWaalsContact SD-CE2 3.6Å; M50-Y59 HydrophobicContact SD-CG 3.43Å; M50-Y59 VanDerWaalsContact SD-CZ 3.55Å; M50-I61 HydrophobicContact CE-CD1 3.67Å; M50-I61 HydrophobicContact CE-CG1 4.45Å
51	S	91.7	Very high	90.1	Very high	51 Å²	51	64.4 Å²	64.4	36%	0.357	35%	0.349	S	S	.	.	P	Polyproline II helix	trans	-90.6	136.1	174.2	-58.2	0	0	0	0	109.8	V23 E53 K54 Y59	V23-S51 VanDerWaalsContact CB-O 3.25Å; V23-S51 WeakPolarHBondContact CB-O 3.45Å; V23-S51 WeakPolarHBondContact CG2-O 3.48Å; S51-E53 PolarHBondContact O-N 3Å; S51-K54 PolarHBondContact O-N 3.33Å; S51-K54 VanDerWaalsContact O-N 3.11Å; S51-Y59 PolarHBondContact N-OH 3.49Å
52	D	89.2	Confident	90.2	Very high	74 Å²	74	68.4 Å²	68.4	40%	0.396	37%	0.373	S	S	.	.	T	Hydrogen-bonded Turn	trans	-56.2	-32.3	178.8	44.5	-83.2	0	0	0	113.5	E24 K54	E24-D52 HydrophobicContact CB-CB 4.24Å; D52-K54 VanDerWaalsContact C-N 3.3Å; D52-K54 PolarHBondContact O-N 3.1Å
53	E	89.9	Confident	90.2	Very high	161 Å²	161	65.4 Å²	65.4	75%	0.752	38%	0.378	S	S	*	.	T	Hydrogen-bonded Turn	trans	-71.4	-18.7	178.8	-58.1	-174.3	90.6	0	0	114.6	S51	S51-E53 PolarHBondContact O-N 3Å
54	K	92.4	Very high	90.1	Very high	70 Å²	70	67.7 Å²	67.7	30%	0.304	40%	0.402	S	S	.	.	S	Bend	trans	-93.3	152	-177.1	-80.2	170.8	172.4	-89.2	0	111.6	V23 S51 D52 D58 Y59	V23-K54 WeakPolarHBondContact CG2-O 3.37Å; V23-K54 PolarHBondContact N-O 3.44Å; S51-K54 PolarHBondContact O-N 3.33Å; S51-K54 VanDerWaalsContact O-N 3.11Å; D52-K54 VanDerWaalsContact C-N 3.3Å; D52-K54 PolarHBondContact O-N 3.1Å; K54-D58 HydrophobicContact CB-CB 4.37Å; K54-D58 VanDerWaalsContact CD-OD1 3.26Å; K54-D58 WeakPolarHBondContact CD-OD1 3.43Å; K54-D58 WeakPolarHBondContact CE-OD1 3.43Å; K54-D58 WeakPolarHBondContact CG-OD1 3.43Å; K54-D58 IonicContact NZ-OD1 2.59Å; K54-D58 PolarHBondContact NZ-OD1 3.44Å; K54-D58 IonicContact NZ-OD2 3.69Å; K54-Y59 HydrophobicContact CB-CD2 4.03Å; K54-Y59 HydrophobicContact CB-CE2 3.38Å; K54-Y59 HydrophobicContact CD-CE2 3.63Å; K54-Y59 WeakPolarHBondContact CD-OH 3.45Å; K54-Y59 HydrophobicContact CG-CE2 4.13Å
55	T	93	Very high	90.2	Very high	41 Å²	41	65.7 Å²	65.7	25%	0.252	39%	0.393	S	S	.	.	B	Isolated β-bridge	trans	-92.7	161.8	177.4	59.1	0	0	0	0	112.1	D21 K22 A57 D58 Y59	D21-T55 CarbonylContact O-C 3.55Å; D21-T55 VanDerWaalsContact O-CA 3.32Å; D21-T55 WeakPolarHBondContact O-CA 3.46Å; K22-T55 HydrophobicContact CG-CG2 4.09Å; T55-A57 PolarHBondContact O-N 3.3Å; T55-D58 WeakPolarHBondContact O-CB 3.41Å; T55-D58 PolarHBondContact O-N 2.74Å; T55-D58 VanDerWaalsContact O-N 3.11Å; T55-D58 PolarHBondContact OG1-N 2.91Å; T55-Y59 WeakPolarHBondContact O-CD2 3.44Å; T55-Y59 PolarHBondContact O-N 3.38Å
56	A	90.7	Very high	90.2	Very high	0 Å²	0	66.2 Å²	66.2	0%	0	40%	0.401	C	S	.	.	T	Hydrogen-bonded Turn	trans	-55.9	-37.2	171.8	0	0	0	0	0	112	M1 I17 D21 I26 Y59 K60 I61	M1-A56 HydrophobicContact CE-CB 3.76Å; I17-A56 HydrophobicContact CD1-CB 3.94Å; D21-A56 PolarHBondContact O-N 2.95Å; I26-A56 HydrophobicContact CD1-CB 4.31Å; A56-Y59 PolarHBondContact O-N 3.45Å; A56-K60 PolarHBondContact O-N 3.23Å; A56-I61 HydrophobicContact CB-CB 4.22Å; A56-I61 HydrophobicContact CB-CD1 3.92Å; A56-I61 HydrophobicContact CB-CG1 4.4Å; A56-I61 WeakPolarHBondContact O-CB 3.18Å; A56-I61 WeakPolarHBondContact O-CG1 3.47Å; A56-I61 PolarHBondContact O-N 2.94Å
57	A	90.4	Very high	90.4	Very high	52 Å²	52	61.7 Å²	61.7	43%	0.43	36%	0.363	S	S	.	.	T	Hydrogen-bonded Turn	trans	-62.9	-39	174.8	0	0	0	0	0	113.4	A19 T55 Y59 K60	A19-A57 HydrophobicContact CB-CB 4.25Å; A19-A57 WeakPolarHBondContact O-CB 3.47Å; A19-A57 PolarHBondContact O-N 2.78Å; T55-A57 PolarHBondContact O-N 3.3Å; A57-Y59 PolarHBondContact O-N 3.11Å; A57-K60 WeakPolarHBondContact O-CA 3.2Å; A57-K60 PolarHBondContact O-N 2.8Å
58	D	91.9	Very high	90.6	Very high	84 Å²	84	62.6 Å²	62.6	45%	0.449	35%	0.346	S	S	.	.	T	Hydrogen-bonded Turn	trans	-61.7	-35.3	179	-175.2	-97.3	0	0	0	111.8	K54 T55 K60	K54-D58 HydrophobicContact CB-CB 4.37Å; K54-D58 VanDerWaalsContact CD-OD1 3.26Å; K54-D58 WeakPolarHBondContact CD-OD1 3.43Å; K54-D58 WeakPolarHBondContact CE-OD1 3.43Å; K54-D58 WeakPolarHBondContact CG-OD1 3.43Å; K54-D58 IonicContact NZ-OD1 2.59Å; K54-D58 PolarHBondContact NZ-OD1 3.44Å; K54-D58 IonicContact NZ-OD2 3.69Å; T55-D58 WeakPolarHBondContact O-CB 3.41Å; T55-D58 PolarHBondContact O-N 2.74Å; T55-D58 VanDerWaalsContact O-N 3.11Å; T55-D58 PolarHBondContact OG1-N 2.91Å; D58-K60 VanDerWaalsContact C-N 3.28Å; D58-K60 PolarHBondContact O-N 3.33Å
59	Y	89.8	Confident	90.6	Very high	28 Å²	28	57.1 Å²	57.1	11%	0.11	32%	0.323	C	S	.	.	T	Hydrogen-bonded Turn	trans	-85.1	2.7	173.9	-73.1	-82	0	0	0	114.2	V23 Y45 K48 Q49 M50 S51 K54 T55 A56 A57 I61	V23-Y59 HydrophobicContact CG2-CD2 4.45Å; V23-Y59 HydrophobicContact CG2-CE2 4.16Å; Y45-Y59 WeakPolarHBondContact CE1-O 3.31Å; K48-Y59 HydrophobicContact CD-CE1 4.19Å; K48-Y59 HydrophobicContact CG-CE1 4.37Å; Q49-Y59 PolarHBondContact O-OH 2.85Å; M50-Y59 WeakPolarHBondContact CA-OH 3.39Å; M50-Y59 HydrophobicContact CB-CE2 4.39Å; M50-Y59 HydrophobicContact CE-CD1 3.92Å; M50-Y59 HydrophobicContact CE-CD2 3.02Å; M50-Y59 HydrophobicContact CE-CE1 4.26Å; M50-Y59 HydrophobicContact CE-CE2 3.4Å; M50-Y59 HydrophobicContact CE-CG 3.28Å; M50-Y59 HydrophobicContact SD-CD1 3.37Å; M50-Y59 WeakPolarHBondContact SD-CD1 3.3Å; M50-Y59 HydrophobicContact SD-CD2 3.58Å; M50-Y59 VanDerWaalsContact SD-CD2 3.58Å; M50-Y59 HydrophobicContact SD-CE1 3.43Å; M50-Y59 WeakPolarHBondContact SD-CE1 3.46Å; M50-Y59 HydrophobicContact SD-CE2 3.6Å; M50-Y59 VanDerWaalsContact SD-CE2 3.6Å; M50-Y59 HydrophobicContact SD-CG 3.43Å; M50-Y59 VanDerWaalsContact SD-CZ 3.55Å; S51-Y59 PolarHBondContact N-OH 3.49Å; K54-Y59 HydrophobicContact CB-CD2 4.03Å; K54-Y59 HydrophobicContact CB-CE2 3.38Å; K54-Y59 HydrophobicContact CD-CE2 3.63Å; K54-Y59 WeakPolarHBondContact CD-OH 3.45Å; K54-Y59 HydrophobicContact CG-CE2 4.13Å; T55-Y59 WeakPolarHBondContact O-CD2 3.44Å; T55-Y59 PolarHBondContact O-N 3.38Å; A56-Y59 PolarHBondContact O-N 3.45Å; A57-Y59 PolarHBondContact O-N 3.11Å; Y59-I61 PolarHBondContact O-N 3.3Å
60	K	88.8	Confident	90.5	Very high	172 Å²	172	54.1 Å²	54.1	75%	0.748	31%	0.312	S	S	*	.	T	Hydrogen-bonded Turn	trans	53.6	36.8	-176	-54	-178	-179.3	-176.8	0	112.5	A56 A57 D58 T62	A56-K60 PolarHBondContact O-N 3.23Å; A57-K60 WeakPolarHBondContact O-CA 3.2Å; A57-K60 PolarHBondContact O-N 2.8Å; D58-K60 VanDerWaalsContact C-N 3.28Å; D58-K60 PolarHBondContact O-N 3.33Å; K60-T62 PolarHBondContact O-N 3.26Å
61	I	89.1	Confident	90.1	Very high	8 Å²	8	57.4 Å²	57.4	4%	0.041	33%	0.329	C	S	.	.	P	Polyproline II helix	trans	-65.6	123.1	175.1	-57.1	-178.7	0	0	0	108	M1 I3 I17 Y45 M50 A56 Y59 A65 L67	M1-I61 HydrophobicContact CE-CB 4.3Å; M1-I61 HydrophobicContact CE-CG2 4.25Å; M1-I61 WeakPolarHBondContact CE-O 3.33Å; I3-I61 HydrophobicContact CG2-CG2 3.64Å; I17-I61 HydrophobicContact CD1-CG2 4.35Å; Y45-I61 HydrophobicContact CD1-CG1 4.1Å; Y45-I61 HydrophobicContact CE1-CG1 4.04Å; M50-I61 HydrophobicContact CE-CD1 3.67Å; M50-I61 HydrophobicContact CE-CG1 4.45Å; A56-I61 HydrophobicContact CB-CB 4.22Å; A56-I61 HydrophobicContact CB-CD1 3.92Å; A56-I61 HydrophobicContact CB-CG1 4.4Å; A56-I61 WeakPolarHBondContact O-CB 3.18Å; A56-I61 WeakPolarHBondContact O-CG1 3.47Å; A56-I61 PolarHBondContact O-N 2.94Å; Y59-I61 PolarHBondContact O-N 3.3Å; I61-A65 HydrophobicContact CG2-CB 3.63Å; I61-L67 HydrophobicContact CD1-CD2 4.29Å; I61-L67 HydrophobicContact CG2-CD1 4.44Å
62	T	89	Confident	89.2	Confident	87 Å²	87	55.7 Å²	55.7	53%	0.534	32%	0.318	S	S	.	.	P	Polyproline II helix	trans	-103.2	164.2	174.8	54.8	0	0	0	0	111.2	K60 G64 A65	K60-T62 PolarHBondContact O-N 3.26Å; T62-G64 PolarHBondContact O-N 2.74Å; T62-A65 WeakPolarHBondContact O-CB 3.44Å; T62-A65 PolarHBondContact O-N 2.78Å
63	G	89.5	Confident	88	Confident	51 Å²	51	60.1 Å²	60.1	53%	0.526	34%	0.341	S	S	.	.	T	Hydrogen-bonded Turn	trans	-57.2	129.6	168.1	0	0	0	0	0	110.7	L2	L2-G63 CarbonylContact O-C 3.58Å; L2-G63 WeakPolarHBondContact O-CA 3.41Å
64	G	89.6	Confident	86.4	Confident	50 Å²	50	63.1 Å²	63.1	52%	0.515	35%	0.345	S	S	.	.	T	Hydrogen-bonded Turn	trans	90.2	-0.2	-174.9	0	0	0	0	0	114.6	L2 T62	L2-G64 PolarHBondContact O-N 3.44Å; T62-G64 PolarHBondContact O-N 2.74Å
65	A	92.4	Very high	84.4	Confident	7 Å²	7	63.4 Å²	63.4	6%	0.058	37%	0.367	C	S	.	.	P	Polyproline II helix	trans	-61.3	140.2	175.3	0	0	0	0	0	111.8	I3 K4 Y45 I61 T62 L67	I3-A65 HydrophobicContact CG2-CB 4.32Å; K4-A65 PolarHBondContact N-O 3.09Å; Y45-A65 HydrophobicContact CE2-CB 3.78Å; I61-A65 HydrophobicContact CG2-CB 3.63Å; T62-A65 WeakPolarHBondContact O-CB 3.44Å; T62-A65 PolarHBondContact O-N 2.78Å; A65-L67 HydrophobicContact CB-CD1 4.4Å
66	V	92	Very high	82.1	Confident	55 Å²	55	65.2 Å²	65.2	33%	0.333	39%	0.387	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.8	116.4	176.1	-174.4	0	0	0	0	109.3	K4 K6	K4-V66 HydrophobicContact CB-CG2 4.22Å; K4-V66 HydrophobicContact CD-CG2 4.49Å; K4-V66 CarbonylContact O-C 3.6Å; K4-V66 VanDerWaalsContact O-CA 3.31Å; K4-V66 WeakPolarHBondContact O-CA 3.48Å; K6-V66 HydrophobicContact CB-CG1 4Å
67	L	92.3	Very high	80.2	Confident	0 Å²	0	69.5 Å²	69.5	0%	0	42%	0.417	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.9	143.5	173	-71.3	76.2	0	0	0	109.3	I3 K4 V5 K6 Y45 I61 A65	I3-L67 HydrophobicContact CB-CD1 4.15Å; I3-L67 HydrophobicContact CD1-CD1 3.67Å; I3-L67 HydrophobicContact CD1-CD2 4.23Å; K4-L67 PolarHBondContact O-N 2.9Å; V5-L67 CarbonylContact C-O 3.51Å; V5-L67 WeakPolarHBondContact CA-O 3.08Å; V5-L67 HydrophobicContact CG2-CB 4.45Å; K6-L67 PolarHBondContact N-O 2.71Å; Y45-L67 HydrophobicContact CD2-CD1 4.27Å; Y45-L67 HydrophobicContact CD2-CG 4.11Å; Y45-L67 HydrophobicContact CG-CG 4.48Å; I61-L67 HydrophobicContact CD1-CD2 4.29Å; I61-L67 HydrophobicContact CG2-CD1 4.44Å; A65-L67 HydrophobicContact CB-CD1 4.4Å
68	H	91.4	Very high	78.3	Confident	97 Å²	97	70.7 Å²	70.7	45%	0.449	41%	0.412	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.4	122.8	174.3	-68.2	-98.3	0	0	0	109.8	K6 I44	K6-H68 CarbonylContact O-C 3.57Å; K6-H68 WeakPolarHBondContact O-CA 3.39Å; I44-H68 HydrophobicContact CB-CB 4.27Å; I44-H68 PolarHBondContact N-O 3.02Å; I44-H68 PolarHBondContact O-N 3.19Å
69	L	89.8	Confident	76.3	Confident	6 Å²	6	74 Å²	74	3%	0.031	43%	0.425	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.8	119.5	173.2	178	67.3	0	0	0	110	V5 K6 T7 V30 I36 Q41 L43	V5-L69 HydrophobicContact CG1-CB 3.61Å; V5-L69 HydrophobicContact CG1-CD2 4.38Å; K6-L69 PolarHBondContact O-N 2.83Å; T7-L69 HydrophobicContact CG2-CD2 4.23Å; V30-L69 HydrophobicContact CG1-CD1 4.33Å; V30-L69 HydrophobicContact CG1-CD2 3.7Å; I36-L69 HydrophobicContact CD1-CD2 3.92Å; Q41-L69 HydrophobicContact CB-CD1 3.85Å; Q41-L69 HydrophobicContact CG-CD1 4.08Å; L43-L69 HydrophobicContact CD2-CB 4.35Å; L43-L69 HydrophobicContact CD2-CD1 3.87Å
70	V	86.3	Confident	74.4	Confident	41 Å²	41	76 Å²	76	25%	0.248	44%	0.44	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.8	141.9	174.1	-178.7	0	0	0	0	109	L8 R42 I44	L8-V70 HydrophobicContact CD1-CG1 4.29Å; L8-V70 HydrophobicContact CD2-CG2 4.09Å; R42-V70 WeakPolarHBondContact CA-O 3.15Å; R42-V70 HydrophobicContact CB-CB 4.2Å; R42-V70 WeakPolarHBondContact CB-O 3.31Å; R42-V70 PolarHBondContact N-O 2.74Å; R42-V70 PolarHBondContact O-N 2.96Å; I44-V70 HydrophobicContact CD1-CB 4.34Å; I44-V70 HydrophobicContact CD1-CG2 3.61Å; I44-V70 HydrophobicContact CG1-CG2 4.48Å
71	L	82.5	Confident	72.3	Confident	70 Å²	70	72.2 Å²	72.2	37%	0.366	44%	0.435	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.6	127.9	176.4	-68.2	172.2	0	0	0	110.7	I36 Q40 L73	I36-L71 HydrophobicContact CB-CD2 4.46Å; I36-L71 HydrophobicContact CD1-CD2 3.71Å; I36-L71 HydrophobicContact CG1-CD2 4.08Å; I36-L71 HydrophobicContact CG2-CD2 3.57Å; Q40-L71 CarbonylContact O-C 3.6Å; L71-L73 PolarHBondContact O-N 3.07Å
72	A	73.5	Confident	70.3	Confident	16 Å²	16	81.5 Å²	81.5	13%	0.132	48%	0.475	C	S	.	.			trans	-82.9	104.2	165.5	0	0	0	0	0	109.1	Q40 R42 R74	Q40-A72 PolarHBondContact O-N 3.01Å; R42-A72 HydrophobicContact CG-CB 4.05Å; A72-R74 PolarHBondContact O-N 3.29Å; A72-R74 VanDerWaalsContact O-N 3.17Å
73	L	64.3	Low	68.2	Low	167 Å²	167	88.6 Å²	88.6	87%	0.874	49%	0.492	S	S	*	.			trans	-75.4	102.1	172.7	-62.2	172.1	0	0	0	109.3	L71	L71-L73 PolarHBondContact O-N 3.07Å
74	R	55.3	Low	66.1	Low	224 Å²	224	89.3 Å²	89.3	85%	0.845	48%	0.481	S	S	*	.			trans	-123.5	136.5	157.4	-81.8	-169.4	173.1	154.2	-2.1	107.8	A72	A72-R74 PolarHBondContact O-N 3.29Å; A72-R74 VanDerWaalsContact O-N 3.17Å
75	G	51.1	Low	64.1	Low	75 Å²	75	96.1 Å²	96.1	77%	0.773	50%	0.496	S	S	*	.	S	Bend	trans	-48.3	137.7	-160.6	0	0	0	0	0	117.2	S77	G75-S77 PolarHBondContact O-N 2.9Å
76	A	45.6	Very low	61.8	Low	80 Å²	80	99.9 Å²	99.9	66%	0.661	52%	0.522	S	S	*	.	S	Bend	trans	50.2	51.3	146.1	0	0	0	0	0	119.7
77	S	50.4	Low	59.7	Low	90 Å²	90	99.5 Å²	99.5	63%	0.629	53%	0.525	S	S	*	.			trans	-143.9	78.2	158.5	-67.9	0	0	0	0	110.1	Q40 G75 H79	Q40-S77 PolarHBondContact NE2-O 2.92Å; G75-S77 PolarHBondContact O-N 2.9Å; S77-H79 PolarHBondContact O-N 2.91Å
78	F	50.4	Low	57.3	Low	76 Å²	76	109.3 Å²	109.3	33%	0.333	57%	0.568	S	S	.	*			trans	-85.4	97.8	169.7	-158.5	-91.4	0	0	0	106.8	V80 F84 I97	F78-V80 HydrophobicContact CD1-CG2 4.08Å; F78-V80 PolarHBondContact O-N 2.86Å; F78-F84 HydrophobicContact CE1-CZ 4.08Å; F78-I97 HydrophobicContact CD1-CD1 4.48Å; F78-I97 HydrophobicContact CE1-CD1 4Å; F78-I97 HydrophobicContact CE1-CG1 4.17Å; F78-I97 HydrophobicContact CE1-CG2 4.23Å; F78-I97 HydrophobicContact CE2-CD1 4.37Å; F78-I97 HydrophobicContact CZ-CD1 3.94Å; F78-I97 HydrophobicContact CZ-CG1 4.32Å; F78-I97 HydrophobicContact CZ-CG2 3.82Å
79	H	50.3	Low	54.9	Low	154 Å²	154	110.7 Å²	110.7	71%	0.713	58%	0.578	S	S	*	*			trans	-70.8	101.3	175.7	-170.8	97.9	0	0	0	108.7	S77 S81	S77-H79 PolarHBondContact O-N 2.91Å; H79-S81 PolarHBondContact O-N 2.92Å
80	V	49.3	Very low	52.2	Low	69 Å²	69	117.7 Å²	117.7	42%	0.418	62%	0.615	S	S	.	*			trans	-68.4	95.5	178	161.9	0	0	0	0	109.9	F78 K82 F84 L95	F78-V80 HydrophobicContact CD1-CG2 4.08Å; F78-V80 PolarHBondContact O-N 2.86Å; V80-K82 PolarHBondContact O-N 2.91Å; V80-F84 HydrophobicContact CB-CD2 4.27Å; V80-F84 HydrophobicContact CB-CE2 3.91Å; V80-F84 HydrophobicContact CG1-CD2 3.23Å; V80-F84 HydrophobicContact CG1-CE2 3.36Å; V80-F84 HydrophobicContact CG1-CG 4.16Å; V80-F84 HydrophobicContact CG1-CZ 4.37Å; V80-F84 HydrophobicContact CG2-CD2 4.35Å; V80-F84 HydrophobicContact CG2-CE2 3.81Å; V80-F84 HydrophobicContact CG2-CZ 4.07Å; V80-L95 HydrophobicContact CG2-CD2 3.87Å
81	S	45	Very low	50.6	Low	94 Å²	94	120.9 Å²	120.9	66%	0.657	64%	0.639	S	S	*	*			trans	-85.2	93.7	171.7	-139.3	0	0	0	0	110.9	H79 R83	H79-S81 PolarHBondContact O-N 2.92Å; S81-R83 PolarHBondContact O-N 2.99Å
82	K	47.5	Very low	48.4	Very low	203 Å²	203	124.9 Å²	124.9	88%	0.883	65%	0.651	S	S	*	*	S	Bend	trans	47	10.2	153.6	-76	-174.2	-179.8	176.4	0	123.7	V80	V80-K82 PolarHBondContact O-N 2.91Å
83	R	44	Very low	47	Very low	235 Å²	235	131.4 Å²	131.4	89%	0.887	68%	0.676	S	S	*	*			trans	-130.6	86.2	166.9	-83.9	-176.2	176.5	174.2	-0.5	112.4	S81	S81-R83 PolarHBondContact O-N 2.99Å
84	F	45.8	Very low	46	Very low	66 Å²	66	125.2 Å²	125.2	29%	0.289	64%	0.644	S	S	.	*			trans	-131.2	125.8	173.3	-78.9	-89	0	0	0	111.4	F78 V80 L95 V96 I97	F78-F84 HydrophobicContact CE1-CZ 4.08Å; V80-F84 HydrophobicContact CB-CD2 4.27Å; V80-F84 HydrophobicContact CB-CE2 3.91Å; V80-F84 HydrophobicContact CG1-CD2 3.23Å; V80-F84 HydrophobicContact CG1-CE2 3.36Å; V80-F84 HydrophobicContact CG1-CG 4.16Å; V80-F84 HydrophobicContact CG1-CZ 4.37Å; V80-F84 HydrophobicContact CG2-CD2 4.35Å; V80-F84 HydrophobicContact CG2-CE2 3.81Å; V80-F84 HydrophobicContact CG2-CZ 4.07Å; F84-L95 HydrophobicContact CD1-CD1 3.57Å; F84-L95 HydrophobicContact CD1-CD2 3.92Å; F84-L95 HydrophobicContact CD1-CG 3.5Å; F84-L95 VanDerWaalsContact CD1-CG 3.5Å; F84-L95 HydrophobicContact CE1-CD1 3.96Å; F84-L95 HydrophobicContact CE1-CD2 3.39Å; F84-L95 HydrophobicContact CE1-CG 3.43Å; F84-L95 VanDerWaalsContact CE1-CG 3.43Å; F84-L95 HydrophobicContact CG-CD1 4.07Å; F84-L95 HydrophobicContact CG-CG 4.43Å; F84-L95 HydrophobicContact CZ-CD2 3.82Å; F84-L95 HydrophobicContact CZ-CG 4.33Å; F84-V96 VanDerWaalsContact CD1-O 3.24Å; F84-V96 WeakPolarHBondContact CD1-O 3.36Å; F84-V96 WeakPolarHBondContact CE1-O 3.47Å; F84-I97 HydrophobicContact CE1-CB 4.13Å; F84-I97 HydrophobicContact CE1-CG1 3.58Å; F84-I97 HydrophobicContact CZ-CG1 4Å
85	K	47.6	Very low	45.6	Very low	194 Å²	194	116.7 Å²	116.7	84%	0.843	62%	0.615	S	S	*	*			trans	-86	116.9	162.2	-98.3	-179.1	175.4	179.8	0	107.7
86	S	44	Very low	45.5	Very low	85 Å²	85	116 Å²	116	59%	0.594	60%	0.595	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-81.4	129.1	176.5	-172.8	0	0	0	0	110.2	K93	S86-K93 WeakPolarHBondContact OG-CE 3.38Å
87	A	46.7	Very low	45.8	Very low	48 Å²	48	114.6 Å²	114.6	40%	0.397	58%	0.576	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-110.1	135.9	162.3	0	0	0	0	0	108.8
88	K	42.1	Very low	45.6	Very low	206 Å²	206	114.9 Å²	114.9	90%	0.896	57%	0.57	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-103.6	118.8	-175.5	-164.8	174.1	-176.1	178.4	0	109
89	L	41.1	Very low	45.6	Very low	126 Å²	126	116.9 Å²	116.9	66%	0.66	59%	0.594	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-122.4	146.4	164.8	-97.8	130.3	0	0	0	108.6	Y92	L89-Y92 PolarHBondContact O-N 3.27Å
90	N	33.8	Very low	45.6	Very low	152 Å²	152	115.5 Å²	115.5	81%	0.813	59%	0.592	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58.8	136.4	-171.6	-149.5	9.3	0	0	0	111.3	Y92	N90-Y92 WeakPolarHBondContact O-CD2 3.08Å; N90-Y92 PolarHBondContact O-N 2.8Å; N90-Y92 VanDerWaalsContact O-N 3.09Å
91	S	51.9	Low	45.5	Very low	109 Å²	109	117.6 Å²	117.6	76%	0.762	60%	0.596	S	S	*	*	T	Hydrogen-bonded Turn	trans	61.4	-8.3	-175.6	-67.6	0	0	0	0	119.5
92	Y	36.5	Very low	45.4	Very low	154 Å²	154	118.1 Å²	118.1	60%	0.604	59%	0.591	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-139.9	124.2	-179.4	-48.5	-83.3	0	0	0	111.3	L89 N90 L94	L89-Y92 PolarHBondContact O-N 3.27Å; N90-Y92 WeakPolarHBondContact O-CD2 3.08Å; N90-Y92 PolarHBondContact O-N 2.8Å; N90-Y92 VanDerWaalsContact O-N 3.09Å; Y92-L94 PolarHBondContact O-N 2.86Å
93	K	44.4	Very low	45.5	Very low	152 Å²	152	109.1 Å²	109.1	66%	0.661	56%	0.555	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-88.2	108.2	173.8	-163	171.6	-175.2	177.4	0	109.5	S86	S86-K93 WeakPolarHBondContact OG-CE 3.38Å
94	L	43.7	Very low	45.5	Very low	38 Å²	38	104.9 Å²	104.9	20%	0.199	54%	0.543	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.6	124.6	175.9	-145.1	69.5	0	0	0	109.5	Y92 L102 F104	Y92-L94 PolarHBondContact O-N 2.86Å; L94-L102 HydrophobicContact CD1-CD2 3.79Å; L94-L102 HydrophobicContact CD2-CD2 3.69Å; L94-L102 HydrophobicContact CD2-CG 4.44Å; L94-L102 HydrophobicContact CG-CD2 3.89Å; L94-F104 HydrophobicContact CD1-CD1 3.78Å; L94-F104 HydrophobicContact CD1-CE1 3.28Å; L94-F104 HydrophobicContact CD1-CZ 3.8Å
95	L	47.2	Very low	45.5	Very low	45 Å²	45	107.9 Å²	107.9	24%	0.236	55%	0.554	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-99.9	106.8	170.9	-161.4	83.8	0	0	0	108.3	V80 F84 I97 G103	V80-L95 HydrophobicContact CG2-CD2 3.87Å; F84-L95 HydrophobicContact CD1-CD1 3.57Å; F84-L95 HydrophobicContact CD1-CD2 3.92Å; F84-L95 HydrophobicContact CD1-CG 3.5Å; F84-L95 VanDerWaalsContact CD1-CG 3.5Å; F84-L95 HydrophobicContact CE1-CD1 3.96Å; F84-L95 HydrophobicContact CE1-CD2 3.39Å; F84-L95 HydrophobicContact CE1-CG 3.43Å; F84-L95 VanDerWaalsContact CE1-CG 3.43Å; F84-L95 HydrophobicContact CG-CD1 4.07Å; F84-L95 HydrophobicContact CG-CG 4.43Å; F84-L95 HydrophobicContact CZ-CD2 3.82Å; F84-L95 HydrophobicContact CZ-CG 4.33Å; L95-I97 HydrophobicContact CD2-CD1 4.19Å; L95-I97 HydrophobicContact CD2-CG1 3.9Å; L95-I97 HydrophobicContact CG-CG1 4.33Å; L95-I97 PolarHBondContact O-N 3.27Å; L95-G103 PolarHBondContact N-O 3.34Å; L95-G103 VanDerWaalsContact N-O 3.08Å; L95-G103 PolarHBondContact O-N 2.75Å
96	V	48.6	Very low	45.1	Very low	60 Å²	60	105.9 Å²	105.9	36%	0.364	55%	0.552	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-81.5	111	172.5	-177.8	0	0	0	0	107.6	F84	F84-V96 VanDerWaalsContact CD1-O 3.24Å; F84-V96 WeakPolarHBondContact CD1-O 3.36Å; F84-V96 WeakPolarHBondContact CE1-O 3.47Å
97	I	51.2	Low	45.3	Very low	50 Å²	50	114 Å²	114	26%	0.256	58%	0.579	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-90.7	-34.2	-176.6	-64.9	161.2	0	0	0	110.8	F78 F84 L95 F101	F78-I97 HydrophobicContact CD1-CD1 4.48Å; F78-I97 HydrophobicContact CE1-CD1 4Å; F78-I97 HydrophobicContact CE1-CG1 4.17Å; F78-I97 HydrophobicContact CE1-CG2 4.23Å; F78-I97 HydrophobicContact CE2-CD1 4.37Å; F78-I97 HydrophobicContact CZ-CD1 3.94Å; F78-I97 HydrophobicContact CZ-CG1 4.32Å; F78-I97 HydrophobicContact CZ-CG2 3.82Å; F84-I97 HydrophobicContact CE1-CB 4.13Å; F84-I97 HydrophobicContact CE1-CG1 3.58Å; F84-I97 HydrophobicContact CZ-CG1 4Å; L95-I97 HydrophobicContact CD2-CD1 4.19Å; L95-I97 HydrophobicContact CD2-CG1 3.9Å; L95-I97 HydrophobicContact CG-CG1 4.33Å; L95-I97 PolarHBondContact O-N 3.27Å; I97-F101 HydrophobicContact CB-CB 4.29Å; I97-F101 HydrophobicContact CB-CD1 4.12Å; I97-F101 HydrophobicContact CD1-CD1 3.47Å; I97-F101 VanDerWaalsContact CD1-CD1 3.47Å; I97-F101 HydrophobicContact CD1-CE1 3.82Å; I97-F101 HydrophobicContact CG1-CD1 4.33Å; I97-F101 HydrophobicContact CG2-CD1 4.41Å; I97-F101 PolarHBondContact N-O 2.93Å; I97-F101 VanDerWaalsContact N-O 3.1Å
98	D	46.1	Very low	45.3	Very low	96 Å²	96	117.3 Å²	117.3	51%	0.513	59%	0.589	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-167.9	173	169.5	-179.1	-109	0	0	0	107.9	N100 F101	D98-N100 PolarHBondContact O-N 3.06Å; D98-N100 PolarHBondContact OD1-ND2 2.83Å; D98-F101 PolarHBondContact O-N 2.72Å; D98-F101 VanDerWaalsContact O-N 3.1Å
99	S	51.7	Low	45.4	Very low	118 Å²	118	112.6 Å²	112.6	83%	0.825	57%	0.572	S	S	*	*	T	Hydrogen-bonded Turn	trans	-51.3	-13.4	174.9	-61.4	0	0	0	0	114.5
100	N	50.5	Low	45.7	Very low	126 Å²	126	111.8 Å²	111.8	67%	0.674	57%	0.568	S	S	*	*	T	Hydrogen-bonded Turn	trans	-118.7	4.3	-176.2	-60.3	-58.9	0	0	0	115.3	D98	D98-N100 PolarHBondContact O-N 3.06Å; D98-N100 PolarHBondContact OD1-ND2 2.83Å
101	F	45.7	Very low	46.4	Very low	113 Å²	113	109.5 Å²	109.5	50%	0.496	55%	0.553	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-145	110.9	-177.3	-155.3	-95.7	0	0	0	113	I97 D98	I97-F101 HydrophobicContact CB-CB 4.29Å; I97-F101 HydrophobicContact CB-CD1 4.12Å; I97-F101 HydrophobicContact CD1-CD1 3.47Å; I97-F101 VanDerWaalsContact CD1-CD1 3.47Å; I97-F101 HydrophobicContact CD1-CE1 3.82Å; I97-F101 HydrophobicContact CG1-CD1 4.33Å; I97-F101 HydrophobicContact CG2-CD1 4.41Å; I97-F101 PolarHBondContact N-O 2.93Å; I97-F101 VanDerWaalsContact N-O 3.1Å; D98-F101 PolarHBondContact O-N 2.72Å; D98-F101 VanDerWaalsContact O-N 3.1Å
102	L	43.7	Very low	46	Very low	105 Å²	105	109.5 Å²	109.5	55%	0.55	54%	0.54	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.5	116.1	169	-90.9	91.1	0	0	0	109.7	L94 F104	L94-L102 HydrophobicContact CD1-CD2 3.79Å; L94-L102 HydrophobicContact CD2-CD2 3.69Å; L94-L102 HydrophobicContact CD2-CG 4.44Å; L94-L102 HydrophobicContact CG-CD2 3.89Å; L102-F104 HydrophobicContact CB-CE2 4.44Å; L102-F104 HydrophobicContact CD2-CE2 4.46Å; L102-F104 HydrophobicContact CD2-CZ 4.17Å
103	G	49.1	Very low	46.7	Very low	14 Å²	14	106.5 Å²	106.5	14%	0.144	54%	0.536	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.9	131.3	165.9	0	0	0	0	0	110.7	L95	L95-G103 PolarHBondContact N-O 3.34Å; L95-G103 VanDerWaalsContact N-O 3.08Å; L95-G103 PolarHBondContact O-N 2.75Å
104	F	45.4	Very low	46.8	Very low	145 Å²	145	103.3 Å²	103.3	64%	0.636	53%	0.527	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-100.9	134.8	167.3	-64.3	-90.4	0	0	0	109.1	L94 L102	L94-F104 HydrophobicContact CD1-CD1 3.78Å; L94-F104 HydrophobicContact CD1-CE1 3.28Å; L94-F104 HydrophobicContact CD1-CZ 3.8Å; L102-F104 HydrophobicContact CB-CE2 4.44Å; L102-F104 HydrophobicContact CD2-CE2 4.46Å; L102-F104 HydrophobicContact CD2-CZ 4.17Å
105	Y	45.7	Very low	47.1	Very low	129 Å²	129	108.3 Å²	108.3	51%	0.506	55%	0.552	S	S	.	*			trans	-122.4	136.4	162.9	-104.8	-92.6	0	0	0	109.1
106	L	39	Very low	47	Very low	153 Å²	153	113.6 Å²	113.6	80%	0.801	58%	0.578	S	S	*	*			trans	-85.4	150.2	169.6	-154.2	72.7	0	0	0	108.9
107	H	48	Very low	46.9	Very low	254 Å²	254	118.5 Å²	118.5	100%	1.176	60%	0.598	S	S	*	*			trans	-70.8	0	176	-161.1	-120.6	0	0	0	111.5

Retrieved 107 of 107 residues in 54.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).