A0A077Z3V2_TRITR Loading...

Solute carrier family 26 member 9

AlphaFold DB , UniProt , Accession A0A077Z3V2, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 113 aa.

						>A0A077Z3V2_TRITR|A0A077Z3V2
MTKQEPVVNICRPAYNMESFDATFRLQDVDLTVYGSAKRLLRKITDKPFAFVKQFVLARFPCFQWLMEYNWRKDLVQDITSGVTVGIFNISQGKLTSSSKLSMLCYHFHNLFI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	45.7	Very low	76.1	Confident	247 Å²	247	151.5 Å²	151.5	100%	1.217	81%	0.811	S	S	*	*				0	116.2	0	-69.8	179.2	174.8	0	0	107.7
2	T	64.5	Low	77.1	Confident	136 Å²	136	154.5 Å²	154.5	83%	0.834	80%	0.802	S	S	*	*			trans	-71.4	126.8	-176.4	36.6	0	0	0	0	110.8	Q4	T2-Q4 PolarHBondContact O-N 2.77Å
3	K	69.4	Low	77.8	Confident	209 Å²	209	149.3 Å²	149.3	91%	0.909	78%	0.784	S	S	*	*			trans	-79.6	101.6	178.4	-165.5	179.6	-176.6	-174.5	0	108.5
4	Q	73.9	Confident	78.5	Confident	181 Å²	181	146.2 Å²	146.2	85%	0.846	79%	0.79	S	S	*	*	P	Polyproline II helix	trans	-77	129.7	170.9	-81.2	176.8	-37.3	0	0	109.4	T2	T2-Q4 PolarHBondContact O-N 2.77Å
5	E	77.9	Confident	79	Confident	176 Å²	176	142.9 Å²	142.9	82%	0.822	76%	0.763	S	S	*	*	P	Polyproline II helix	trans	-68.3	141.3	175	-65	-155.5	151.9	0	0	110.7	V7	E5-V7 PolarHBondContact O-N 2.94Å; E5-V7 VanDerWaalsContact O-N 3.15Å
6	P	80.9	Confident	79.7	Confident	116 Å²	116	139.9 Å²	139.9	75%	0.753	75%	0.747	S	S	*	*	P	Polyproline II helix	trans	-66.5	118.3	-176.8	26.9	-32.9	0	0	0	110	V8	P6-V8 PolarHBondContact O-N 2.99Å; P6-V8 VanDerWaalsContact O-N 3.12Å
7	V	84.7	Confident	79.9	Confident	139 Å²	139	139.7 Å²	139.7	84%	0.842	74%	0.742	S	S	*	*			trans	-66.2	109	169	177.8	0	0	0	0	107.9	E5 N9	E5-V7 PolarHBondContact O-N 2.94Å; E5-V7 VanDerWaalsContact O-N 3.15Å; V7-N9 PolarHBondContact O-N 2.84Å; V7-N9 VanDerWaalsContact O-N 3.09Å
8	V	84.7	Confident	80.2	Confident	113 Å²	113	140.8 Å²	140.8	69%	0.685	74%	0.742	S	S	*	*			trans	-80.9	90.1	178.7	177.8	0	0	0	0	108.9	P6 I10	P6-V8 PolarHBondContact O-N 2.99Å; P6-V8 VanDerWaalsContact O-N 3.12Å; V8-I10 HydrophobicContact CG1-CD1 3.61Å; V8-I10 HydrophobicContact CG1-CG1 3.63Å; V8-I10 PolarHBondContact O-N 3.02Å
9	N	84.4	Confident	80.3	Confident	135 Å²	135	135.3 Å²	135.3	72%	0.722	72%	0.717	S	S	*	*			trans	-86.7	100.3	174.7	-170.6	28.1	0	0	0	110.2	V7	V7-N9 PolarHBondContact O-N 2.84Å; V7-N9 VanDerWaalsContact O-N 3.09Å
10	I	86.3	Confident	80.6	Confident	102 Å²	102	132.5 Å²	132.5	52%	0.523	70%	0.698	S	S	.	*			trans	-100.9	99.2	177.7	-59	161.4	0	0	0	108.8	V8 R12	V8-I10 HydrophobicContact CG1-CD1 3.61Å; V8-I10 HydrophobicContact CG1-CG1 3.63Å; V8-I10 PolarHBondContact O-N 3.02Å; I10-R12 HydrophobicContact CG2-CG 4.03Å
11	C	84.1	Confident	80.8	Confident	113 Å²	113	129.3 Å²	129.3	76%	0.764	68%	0.682	S	S	*	*			trans	-98.2	101.2	166.1	-66.7	0	0	0	0	109.1
12	R	88.2	Confident	82.5	Confident	187 Å²	187	120.9 Å²	120.9	71%	0.706	65%	0.651	S	S	*	*			trans	-130.2	144.6	169.9	63	-170.7	175	-143	-1.3	108.9	I10	I10-R12 HydrophobicContact CG2-CG 4.03Å
13	P	87	Confident	83.3	Confident	87 Å²	87	118.3 Å²	118.3	57%	0.565	64%	0.636	S	S	*	*	P	Polyproline II helix	trans	-61.8	148.6	177.5	27.4	-33.9	0	0	0	110.1	Y15	P13-Y15 HydrophobicContact CG-CE1 4.41Å; P13-Y15 HydrophobicContact CG-CE2 3.84Å; P13-Y15 VanDerWaalsContact O-CD2 3.28Å; P13-Y15 WeakPolarHBondContact O-CD2 3.27Å; P13-Y15 PolarHBondContact O-N 3.3Å
14	A	87.3	Confident	83.6	Confident	106 Å²	106	113.6 Å²	113.6	88%	0.876	62%	0.615	S	S	*	*	P	Polyproline II helix	trans	-72.5	118.8	170	0	0	0	0	0	108.3
15	Y	86.6	Confident	83.1	Confident	97 Å²	97	114.7 Å²	114.7	38%	0.38	61%	0.612	S	S	.	*	P	Polyproline II helix	trans	-91.5	134.9	176.4	-66.6	-87.3	0	0	0	110.1	P13 S19 F20 T23 F24	P13-Y15 HydrophobicContact CG-CE1 4.41Å; P13-Y15 HydrophobicContact CG-CE2 3.84Å; P13-Y15 VanDerWaalsContact O-CD2 3.28Å; P13-Y15 WeakPolarHBondContact O-CD2 3.27Å; P13-Y15 PolarHBondContact O-N 3.3Å; Y15-S19 WeakPolarHBondContact CA-OG 3.38Å; Y15-F20 HydrophobicContact CG-CD2 4.24Å; Y15-T23 HydrophobicContact CE1-CG2 4.07Å; Y15-F24 HydrophobicContact CE1-CE2 4.33Å; Y15-F24 HydrophobicContact CE2-CE2 4.36Å
16	N	88.8	Confident	82.4	Confident	94 Å²	94	111.7 Å²	111.7	50%	0.503	60%	0.601	S	S	.	*	P	Polyproline II helix	trans	-82	163.3	155.2	67.5	9.5	0	0	0	109.3	E18 S19 F20	N16-E18 VanDerWaalsContact C-N 3.3Å; N16-E18 PolarHBondContact O-N 3.36Å; N16-S19 PolarHBondContact N-OG 3.08Å; N16-S19 PolarHBondContact O-N 2.84Å; N16-S19 PolarHBondContact O-OG 2.8Å; N16-S19 WeakPolarHBondContact OD1-CA 3.18Å; N16-S19 WeakPolarHBondContact OD1-CB 3.43Å; N16-S19 PolarHBondContact OD1-N 3.17Å; N16-S19 PolarHBondContact OD1-OG 3.44Å; N16-F20 WeakPolarHBondContact O-CB 3.42Å; N16-F20 PolarHBondContact O-N 2.8Å
17	M	84.1	Confident	81.1	Confident	137 Å²	137	114.3 Å²	114.3	68%	0.675	60%	0.603	S	S	*	*	H	α-helix	trans	-58.1	-42.7	-176.2	-168.7	66.1	81.8	0	0	111.9	S19 F20 D21	M17-S19 PolarHBondContact O-N 3.09Å; M17-F20 WeakPolarHBondContact O-CB 3.35Å; M17-F20 PolarHBondContact O-N 2.86Å; M17-D21 PolarHBondContact O-N 3.32Å
18	E	84.2	Confident	79.8	Confident	159 Å²	159	114.5 Å²	114.5	74%	0.743	60%	0.599	S	S	*	*	H	α-helix	trans	-61.4	-42.7	178.5	-64	179.6	175.7	0	0	112.6	N16 A22	N16-E18 VanDerWaalsContact C-N 3.3Å; N16-E18 PolarHBondContact O-N 3.36Å; E18-A22 WeakPolarHBondContact O-CB 3.25Å; E18-A22 PolarHBondContact O-N 2.81Å
19	S	83.7	Confident	78.3	Confident	37 Å²	37	114 Å²	114	26%	0.259	60%	0.596	S	S	.	*	H	α-helix	trans	-71.8	-31.8	176.1	68.4	0	0	0	0	112	Y15 N16 M17 T23	Y15-S19 WeakPolarHBondContact CA-OG 3.38Å; N16-S19 PolarHBondContact N-OG 3.08Å; N16-S19 PolarHBondContact O-N 2.84Å; N16-S19 PolarHBondContact O-OG 2.8Å; N16-S19 WeakPolarHBondContact OD1-CA 3.18Å; N16-S19 WeakPolarHBondContact OD1-CB 3.43Å; N16-S19 PolarHBondContact OD1-N 3.17Å; N16-S19 PolarHBondContact OD1-OG 3.44Å; M17-S19 PolarHBondContact O-N 3.09Å; S19-T23 WeakPolarHBondContact O-CB 3.22Å; S19-T23 PolarHBondContact O-N 3.29Å; S19-T23 PolarHBondContact O-OG1 2.73Å
20	F	84.9	Confident	76.7	Confident	79 Å²	79	113.4 Å²	113.4	35%	0.346	59%	0.593	S	S	.	*	H	α-helix	trans	-66.2	-52.2	174.6	-172.9	-94.7	0	0	0	109.7	Y15 N16 M17 A22 T23 F24	Y15-F20 HydrophobicContact CG-CD2 4.24Å; N16-F20 WeakPolarHBondContact O-CB 3.42Å; N16-F20 PolarHBondContact O-N 2.8Å; M17-F20 WeakPolarHBondContact O-CB 3.35Å; M17-F20 PolarHBondContact O-N 2.86Å; F20-A22 VanDerWaalsContact C-N 3.32Å; F20-A22 PolarHBondContact O-N 3.44Å; F20-T23 PolarHBondContact O-N 3.48Å; F20-F24 HydrophobicContact CD1-CD2 4.19Å; F20-F24 AromaticContact CD2-CD2 3.37Å; F20-F24 HydrophobicContact CD2-CD2 3.37Å; F20-F24 AromaticContact CD2-CE2 3.49Å; F20-F24 HydrophobicContact CD2-CE2 3.49Å; F20-F24 VanDerWaalsContact CD2-CE2 3.49Å; F20-F24 HydrophobicContact CD2-CG 4.48Å; F20-F24 HydrophobicContact CE1-CB 4.4Å; F20-F24 HydrophobicContact CE1-CD2 4.11Å; F20-F24 HydrophobicContact CE1-CG 4.41Å; F20-F24 AromaticContact CE2-CD2 3.28Å; F20-F24 HydrophobicContact CE2-CD2 3.28Å; F20-F24 AromaticContact CE2-CE2 3.31Å; F20-F24 HydrophobicContact CE2-CE2 3.31Å; F20-F24 HydrophobicContact CE2-CG 4.1Å; F20-F24 HydrophobicContact CE2-CZ 4.15Å; F20-F24 AromaticContact CG-CD2 3.85Å; F20-F24 HydrophobicContact CG-CD2 3.85Å; F20-F24 HydrophobicContact CG-CE2 4.39Å; F20-F24 AromaticContact CZ-CD2 3.67Å; F20-F24 HydrophobicContact CZ-CD2 3.67Å; F20-F24 HydrophobicContact CZ-CE2 4.09Å; F20-F24 HydrophobicContact CZ-CG 4.06Å; F20-F24 WeakPolarHBondContact O-CB 3.35Å; F20-F24 WeakPolarHBondContact O-CD2 3.38Å; F20-F24 PolarHBondContact O-N 3.02Å
21	D	85.1	Confident	75.4	Confident	66 Å²	66	116.1 Å²	116.1	35%	0.353	61%	0.608	S	S	.	*	H	α-helix	trans	-64	-37.2	177.9	-73.6	-14.3	0	0	0	111.8	M17 R25 L26	M17-D21 PolarHBondContact O-N 3.32Å; D21-R25 WeakPolarHBondContact O-CA 3.25Å; D21-R25 PolarHBondContact O-N 3.42Å; D21-L26 WeakPolarHBondContact OD1-CD1 3.26Å
22	A	82.2	Confident	74.1	Confident	69 Å²	69	114.1 Å²	114.1	57%	0.57	59%	0.592	S	S	*	*	H	α-helix	trans	-67	-38.9	174.7	0	0	0	0	0	112.9	E18 F20 R25	E18-A22 WeakPolarHBondContact O-CB 3.25Å; E18-A22 PolarHBondContact O-N 2.81Å; F20-A22 VanDerWaalsContact C-N 3.32Å; F20-A22 PolarHBondContact O-N 3.44Å; A22-R25 WeakPolarHBondContact O-CG 2.9Å
23	T	79.9	Confident	72.9	Confident	83 Å²	83	110.9 Å²	110.9	51%	0.509	59%	0.593	S	S	.	*	H	α-helix	trans	-76.5	-47.8	-178.7	-58.1	0	0	0	0	111.4	Y15 S19 F20 R25	Y15-T23 HydrophobicContact CE1-CG2 4.07Å; S19-T23 WeakPolarHBondContact O-CB 3.22Å; S19-T23 PolarHBondContact O-N 3.29Å; S19-T23 PolarHBondContact O-OG1 2.73Å; F20-T23 PolarHBondContact O-N 3.48Å; T23-R25 VanDerWaalsContact C-N 3.34Å
24	F	76.3	Confident	72	Confident	110 Å²	110	114.9 Å²	114.9	48%	0.482	60%	0.598	S	S	.	*	H	α-helix	trans	-88.2	-7.1	-175.6	-70.2	-79	0	0	0	112.8	Y15 F20 L26	Y15-F24 HydrophobicContact CE1-CE2 4.33Å; Y15-F24 HydrophobicContact CE2-CE2 4.36Å; F20-F24 HydrophobicContact CD1-CD2 4.19Å; F20-F24 AromaticContact CD2-CD2 3.37Å; F20-F24 HydrophobicContact CD2-CD2 3.37Å; F20-F24 AromaticContact CD2-CE2 3.49Å; F20-F24 HydrophobicContact CD2-CE2 3.49Å; F20-F24 VanDerWaalsContact CD2-CE2 3.49Å; F20-F24 HydrophobicContact CD2-CG 4.48Å; F20-F24 HydrophobicContact CE1-CB 4.4Å; F20-F24 HydrophobicContact CE1-CD2 4.11Å; F20-F24 HydrophobicContact CE1-CG 4.41Å; F20-F24 AromaticContact CE2-CD2 3.28Å; F20-F24 HydrophobicContact CE2-CD2 3.28Å; F20-F24 AromaticContact CE2-CE2 3.31Å; F20-F24 HydrophobicContact CE2-CE2 3.31Å; F20-F24 HydrophobicContact CE2-CG 4.1Å; F20-F24 HydrophobicContact CE2-CZ 4.15Å; F20-F24 AromaticContact CG-CD2 3.85Å; F20-F24 HydrophobicContact CG-CD2 3.85Å; F20-F24 HydrophobicContact CG-CE2 4.39Å; F20-F24 AromaticContact CZ-CD2 3.67Å; F20-F24 HydrophobicContact CZ-CD2 3.67Å; F20-F24 HydrophobicContact CZ-CE2 4.09Å; F20-F24 HydrophobicContact CZ-CG 4.06Å; F20-F24 WeakPolarHBondContact O-CB 3.35Å; F20-F24 WeakPolarHBondContact O-CD2 3.38Å; F20-F24 PolarHBondContact O-N 3.02Å; F24-L26 PolarHBondContact O-N 2.82Å; F24-L26 VanDerWaalsContact O-N 3.12Å
25	R	63.5	Low	70.9	Confident	204 Å²	204	111.1 Å²	111.1	77%	0.77	57%	0.569	S	S	*	*			trans	31.8	63.9	-178.3	-66.3	-171.3	-177.4	-161.9	0.6	108.6	D21 A22 T23 Q27	D21-R25 WeakPolarHBondContact O-CA 3.25Å; D21-R25 PolarHBondContact O-N 3.42Å; A22-R25 WeakPolarHBondContact O-CG 2.9Å; T23-R25 VanDerWaalsContact C-N 3.34Å; R25-Q27 VanDerWaalsContact O-CA 3.31Å; R25-Q27 WeakPolarHBondContact O-CA 3.42Å; R25-Q27 PolarHBondContact O-N 3.29Å
26	L	63.8	Low	69.9	Low	113 Å²	113	109.8 Å²	109.8	59%	0.592	57%	0.574	S	S	*	*			trans	-45.5	105.6	175.8	-80.7	180	0	0	0	104.4	D21 F24 D28	D21-L26 WeakPolarHBondContact OD1-CD1 3.26Å; F24-L26 PolarHBondContact O-N 2.82Å; F24-L26 VanDerWaalsContact O-N 3.12Å; L26-D28 PolarHBondContact O-N 2.79Å
27	Q	54.2	Low	69	Low	171 Å²	171	107.4 Å²	107.4	80%	0.799	57%	0.568	S	S	*	*			trans	-71.1	96.2	-169.7	179.5	171.6	70	0	0	100.1	R25 V29	R25-Q27 VanDerWaalsContact O-CA 3.31Å; R25-Q27 WeakPolarHBondContact O-CA 3.42Å; R25-Q27 PolarHBondContact O-N 3.29Å; Q27-V29 PolarHBondContact O-N 3.04Å
28	D	56.2	Low	68.5	Low	143 Å²	143	105.6 Å²	105.6	77%	0.765	56%	0.556	S	S	*	*			trans	-46.5	101.8	171.6	-81.2	-40.3	0	0	0	102.9	L26 D30	L26-D28 PolarHBondContact O-N 2.79Å; D28-D30 PolarHBondContact O-N 3.31Å
29	V	54.3	Low	67.7	Low	103 Å²	103	106.2 Å²	106.2	62%	0.624	55%	0.552	S	S	*	*			trans	-68.5	93.7	-179.8	-94.3	0	0	0	0	101	Q27 L31	Q27-V29 PolarHBondContact O-N 3.04Å; V29-L31 VanDerWaalsContact C-N 3.26Å; V29-L31 PolarHBondContact O-N 3.48Å
30	D	49.9	Very low	67	Low	121 Å²	121	109.6 Å²	109.6	65%	0.647	57%	0.566	S	S	*	*			trans	-39.1	97.9	-176.8	-89.2	-39.1	0	0	0	107.2	D28 T32	D28-D30 PolarHBondContact O-N 3.31Å; D30-T32 WeakPolarHBondContact CB-OG1 3.18Å; D30-T32 PolarHBondContact O-N 2.9Å
31	L	59.4	Low	66.3	Low	159 Å²	159	111 Å²	111	83%	0.832	58%	0.577	S	S	*	*			trans	-70.6	9.6	172.5	-82.5	119.1	0	0	0	109.2	V29 V33	V29-L31 VanDerWaalsContact C-N 3.26Å; V29-L31 PolarHBondContact O-N 3.48Å; L31-V33 VanDerWaalsContact C-N 3.35Å; L31-V33 PolarHBondContact O-N 3.47Å
32	T	57	Low	65.5	Low	71 Å²	71	115 Å²	115	44%	0.436	59%	0.587	S	S	.	*			trans	-50.1	101.5	162.3	-36.6	0	0	0	0	108.3	D30 Y34 G35 S36	D30-T32 WeakPolarHBondContact CB-OG1 3.18Å; D30-T32 PolarHBondContact O-N 2.9Å; T32-Y34 PolarHBondContact O-N 3.33Å; T32-G35 WeakPolarHBondContact O-CA 3.35Å; T32-G35 PolarHBondContact O-N 3.35Å; T32-S36 PolarHBondContact O-N 3.2Å
33	V	63.1	Low	64.7	Low	120 Å²	120	119.4 Å²	119.4	73%	0.727	59%	0.593	S	S	*	*	H	α-helix	trans	-46.4	-34.2	173.3	178.8	0	0	0	0	110.6	L31 G35 S36 A37	L31-V33 VanDerWaalsContact C-N 3.35Å; L31-V33 PolarHBondContact O-N 3.47Å; V33-G35 PolarHBondContact O-N 2.72Å; V33-S36 PolarHBondContact O-N 2.85Å; V33-A37 WeakPolarHBondContact O-CB 3.46Å; V33-A37 PolarHBondContact O-N 3.04Å
34	Y	67.7	Low	64	Low	171 Å²	171	118.3 Å²	118.3	67%	0.671	58%	0.583	S	S	*	*	H	α-helix	trans	-60	-41.5	174.5	-172.3	-101.5	0	0	0	114	T32 K38	T32-Y34 PolarHBondContact O-N 3.33Å; Y34-K38 VanDerWaalsContact O-CB 3.3Å; Y34-K38 WeakPolarHBondContact O-CB 3.29Å; Y34-K38 PolarHBondContact O-N 3.38Å
35	G	63.3	Low	63.7	Low	26 Å²	26	118.2 Å²	118.2	27%	0.268	59%	0.592	S	S	.	*	H	α-helix	trans	-68.8	-43	177.4	0	0	0	0	0	112.1	T32 V33 K38 R39	T32-G35 WeakPolarHBondContact O-CA 3.35Å; T32-G35 PolarHBondContact O-N 3.35Å; V33-G35 PolarHBondContact O-N 2.72Å; G35-K38 PolarHBondContact O-N 3.18Å; G35-R39 WeakPolarHBondContact O-CB 3.39Å; G35-R39 VanDerWaalsContact O-CG 3.3Å; G35-R39 WeakPolarHBondContact O-CG 3.31Å; G35-R39 PolarHBondContact O-N 2.53Å
36	S	65.6	Low	63.9	Low	70 Å²	70	114.3 Å²	114.3	49%	0.49	59%	0.586	S	S	.	*	H	α-helix	trans	-65.2	-41.1	173.7	-76.8	0	0	0	0	112.2	T32 V33 R39 L40	T32-S36 PolarHBondContact O-N 3.2Å; V33-S36 PolarHBondContact O-N 2.85Å; S36-R39 PolarHBondContact O-N 2.92Å; S36-L40 PolarHBondContact O-N 3.2Å
37	A	70.8	Confident	64	Low	44 Å²	44	115.9 Å²	115.9	36%	0.364	59%	0.588	S	S	.	*	H	α-helix	trans	-63.1	-45.4	174.6	0	0	0	0	0	111.3	V33 R39 L40 L41	V33-A37 WeakPolarHBondContact O-CB 3.46Å; V33-A37 PolarHBondContact O-N 3.04Å; A37-R39 VanDerWaalsContact C-N 3.33Å; A37-R39 PolarHBondContact O-N 2.8Å; A37-L40 WeakPolarHBondContact O-CB 3.37Å; A37-L40 PolarHBondContact O-N 3.39Å; A37-L40 VanDerWaalsContact O-N 3.15Å; A37-L41 WeakPolarHBondContact O-CB 3.45Å; A37-L41 VanDerWaalsContact O-CG 3.29Å; A37-L41 WeakPolarHBondContact O-CG 3.41Å; A37-L41 PolarHBondContact O-N 3.09Å
38	K	74.1	Confident	64.6	Low	99 Å²	99	111.3 Å²	111.3	43%	0.43	57%	0.574	S	S	.	*	H	α-helix	trans	-62.6	-38.1	175.8	-172.5	176.5	-177.5	176.1	0	112.2	Y34 G35 L41 R42	Y34-K38 VanDerWaalsContact O-CB 3.3Å; Y34-K38 WeakPolarHBondContact O-CB 3.29Å; Y34-K38 PolarHBondContact O-N 3.38Å; G35-K38 PolarHBondContact O-N 3.18Å; K38-L41 PolarHBondContact O-N 3.41Å; K38-R42 WeakPolarHBondContact O-CB 3.48Å; K38-R42 WeakPolarHBondContact O-CG 3.48Å; K38-R42 PolarHBondContact O-N 3.36Å
39	R	67.7	Low	65.1	Low	172 Å²	172	112.5 Å²	112.5	65%	0.649	57%	0.572	S	S	*	*	H	α-helix	trans	-64.3	-40.7	173.3	-74.8	175.2	-174.3	179.8	3.7	111.5	G35 S36 A37 K43	G35-R39 WeakPolarHBondContact O-CB 3.39Å; G35-R39 VanDerWaalsContact O-CG 3.3Å; G35-R39 WeakPolarHBondContact O-CG 3.31Å; G35-R39 PolarHBondContact O-N 2.53Å; S36-R39 PolarHBondContact O-N 2.92Å; A37-R39 VanDerWaalsContact C-N 3.33Å; A37-R39 PolarHBondContact O-N 2.8Å; R39-K43 WeakPolarHBondContact O-CG 3.36Å; R39-K43 PolarHBondContact O-N 3.09Å
40	L	67.8	Low	65.9	Low	108 Å²	108	109.9 Å²	109.9	57%	0.565	56%	0.561	S	S	*	*	H	α-helix	trans	-65.3	-45.2	175.8	-157.4	101.9	0	0	0	111.1	S36 A37 R42 K43 I44	S36-L40 PolarHBondContact O-N 3.2Å; A37-L40 WeakPolarHBondContact O-CB 3.37Å; A37-L40 PolarHBondContact O-N 3.39Å; A37-L40 VanDerWaalsContact O-N 3.15Å; L40-R42 PolarHBondContact O-N 2.86Å; L40-K43 WeakPolarHBondContact O-CB 3.45Å; L40-K43 PolarHBondContact O-N 3.41Å; L40-I44 HydrophobicContact CD2-CD1 4.12Å; L40-I44 WeakPolarHBondContact O-CG1 3.31Å; L40-I44 PolarHBondContact O-N 3.44Å
41	L	71	Confident	66.8	Low	108 Å²	108	109.2 Å²	109.2	57%	0.565	55%	0.553	S	S	*	*	H	α-helix	trans	-62.2	-42.8	177.1	-71	171.8	0	0	0	111.5	A37 K38 K43 I44 T45	A37-L41 WeakPolarHBondContact O-CB 3.45Å; A37-L41 VanDerWaalsContact O-CG 3.29Å; A37-L41 WeakPolarHBondContact O-CG 3.41Å; A37-L41 PolarHBondContact O-N 3.09Å; K38-L41 PolarHBondContact O-N 3.41Å; L41-K43 PolarHBondContact O-N 3.37Å; L41-I44 PolarHBondContact O-N 3.15Å; L41-I44 VanDerWaalsContact O-N 3.16Å; L41-T45 PolarHBondContact O-N 3.03Å; L41-T45 PolarHBondContact O-OG1 3.38Å
42	R	68.6	Low	67.4	Low	150 Å²	150	105.4 Å²	105.4	57%	0.566	54%	0.536	S	S	*	.	H	α-helix	trans	-59.4	-44.4	172.6	-77.7	-174.8	-177.5	-178.9	-1.3	112	K38 L40 I44 T45 D46	K38-R42 WeakPolarHBondContact O-CB 3.48Å; K38-R42 WeakPolarHBondContact O-CG 3.48Å; K38-R42 PolarHBondContact O-N 3.36Å; L40-R42 PolarHBondContact O-N 2.86Å; R42-I44 VanDerWaalsContact C-N 3.25Å; R42-I44 PolarHBondContact O-N 2.76Å; R42-T45 PolarHBondContact O-N 2.79Å; R42-T45 VanDerWaalsContact O-N 3.16Å; R42-D46 WeakPolarHBondContact O-CB 3.26Å; R42-D46 VanDerWaalsContact O-CG 3.26Å; R42-D46 PolarHBondContact O-N 2.95Å; R42-D46 VanDerWaalsContact O-OD2 3.12Å
43	K	64.5	Low	68.2	Low	162 Å²	162	106.9 Å²	106.9	70%	0.704	54%	0.537	S	S	*	.	H	α-helix	trans	-59.3	-35.7	175.7	-77.8	-177.2	178	-176.2	0	112.8	R39 L40 L41	R39-K43 WeakPolarHBondContact O-CG 3.36Å; R39-K43 PolarHBondContact O-N 3.09Å; L40-K43 WeakPolarHBondContact O-CB 3.45Å; L40-K43 PolarHBondContact O-N 3.41Å; L41-K43 PolarHBondContact O-N 3.37Å
44	I	64.7	Low	68.7	Low	59 Å²	59	108.2 Å²	108.2	30%	0.303	54%	0.535	S	S	.	.	H	α-helix	trans	-72.6	-42.3	176.1	-63.9	164.2	0	0	0	110.6	L40 L41 R42 P48	L40-I44 HydrophobicContact CD2-CD1 4.12Å; L40-I44 WeakPolarHBondContact O-CG1 3.31Å; L40-I44 PolarHBondContact O-N 3.44Å; L41-I44 PolarHBondContact O-N 3.15Å; L41-I44 VanDerWaalsContact O-N 3.16Å; R42-I44 VanDerWaalsContact C-N 3.25Å; R42-I44 PolarHBondContact O-N 2.76Å; I44-P48 WeakPolarHBondContact O-CA 3.49Å
45	T	70.3	Confident	69	Low	109 Å²	109	105.4 Å²	105.4	67%	0.669	53%	0.526	S	S	*	.	H	α-helix	trans	-71.6	-40	-178.2	-57.6	0	0	0	0	113.4	L41 R42 K47 P48	L41-T45 PolarHBondContact O-N 3.03Å; L41-T45 PolarHBondContact O-OG1 3.38Å; R42-T45 PolarHBondContact O-N 2.79Å; R42-T45 VanDerWaalsContact O-N 3.16Å; T45-K47 VanDerWaalsContact C-N 3.34Å; T45-K47 PolarHBondContact O-N 2.9Å; T45-P48 WeakPolarHBondContact O-CD 3.43Å
46	D	68.7	Low	69.5	Low	121 Å²	121	106.2 Å²	106.2	65%	0.647	53%	0.526	S	S	*	.	H	α-helix	trans	-71.2	-31.6	-175.1	-69.3	-36.6	0	0	0	111.9	R42	R42-D46 WeakPolarHBondContact O-CB 3.26Å; R42-D46 VanDerWaalsContact O-CG 3.26Å; R42-D46 PolarHBondContact O-N 2.95Å; R42-D46 VanDerWaalsContact O-OD2 3.12Å
47	K	64.5	Low	69.8	Low	146 Å²	146	105.8 Å²	105.8	64%	0.635	52%	0.518	S	S	*	.			trans	-144.5	66.5	-177	-63	-173.6	-179.6	175.9	0	112	T45 F49 A50 F51	T45-K47 VanDerWaalsContact C-N 3.34Å; T45-K47 PolarHBondContact O-N 2.9Å; K47-F49 PolarHBondContact O-N 3.11Å; K47-A50 HydrophobicContact CB-CB 3.93Å; K47-A50 PolarHBondContact O-N 3.25Å; K47-F51 PolarHBondContact O-N 3.34Å
48	P	67.1	Low	69.9	Low	75 Å²	75	107.7 Å²	107.7	49%	0.487	53%	0.533	S	S	.	.	H	α-helix	trans	-57.4	-38.9	179.2	24.3	-34.1	0	0	0	110.7	I44 T45 A50 F51 V52	I44-P48 WeakPolarHBondContact O-CA 3.49Å; T45-P48 WeakPolarHBondContact O-CD 3.43Å; P48-A50 VanDerWaalsContact C-N 3.34Å; P48-A50 PolarHBondContact O-N 3.46Å; P48-F51 PolarHBondContact O-N 3.41Å; P48-V52 VanDerWaalsContact O-CB 3.32Å; P48-V52 WeakPolarHBondContact O-CB 3.24Å; P48-V52 WeakPolarHBondContact O-CG2 3.36Å; P48-V52 PolarHBondContact O-N 3.45Å
49	F	68.1	Low	70	Confident	168 Å²	168	110.5 Å²	110.5	74%	0.737	54%	0.541	S	S	*	.	H	α-helix	trans	-62.5	-36.1	179.3	-170.7	-103	0	0	0	113.5	K47 K53	K47-F49 PolarHBondContact O-N 3.11Å; F49-K53 WeakPolarHBondContact O-CB 3.36Å; F49-K53 PolarHBondContact O-N 2.99Å
50	A	70.9	Confident	70.6	Confident	48 Å²	48	107.7 Å²	107.7	40%	0.397	53%	0.534	S	S	.	.	H	α-helix	trans	-74.1	-40.4	179.2	0	0	0	0	0	111.8	K47 P48 K53 Q54	K47-A50 HydrophobicContact CB-CB 3.93Å; K47-A50 PolarHBondContact O-N 3.25Å; P48-A50 VanDerWaalsContact C-N 3.34Å; P48-A50 PolarHBondContact O-N 3.46Å; A50-K53 PolarHBondContact O-N 2.86Å; A50-Q54 PolarHBondContact O-N 2.93Å
51	F	69.3	Low	71	Confident	107 Å²	107	106.8 Å²	106.8	47%	0.469	54%	0.535	S	S	.	.	H	α-helix	trans	-66.5	-45.2	175.5	-172.7	-97.1	0	0	0	111.2	K47 P48 K53 Q54 F55	K47-F51 PolarHBondContact O-N 3.34Å; P48-F51 PolarHBondContact O-N 3.41Å; F51-K53 PolarHBondContact O-N 3.41Å; F51-Q54 PolarHBondContact O-N 2.96Å; F51-F55 WeakPolarHBondContact O-CB 3.28Å; F51-F55 PolarHBondContact O-N 3.13Å
52	V	70.6	Confident	71.1	Confident	79 Å²	79	104.9 Å²	104.9	48%	0.479	53%	0.529	S	S	.	.	H	α-helix	trans	-61.8	-43.7	174.2	172.9	0	0	0	0	110.3	P48 Q54 F55 V56	P48-V52 VanDerWaalsContact O-CB 3.32Å; P48-V52 WeakPolarHBondContact O-CB 3.24Å; P48-V52 WeakPolarHBondContact O-CG2 3.36Å; P48-V52 PolarHBondContact O-N 3.45Å; V52-Q54 PolarHBondContact O-N 3.36Å; V52-F55 PolarHBondContact O-N 2.94Å; V52-V56 HydrophobicContact CG1-CG2 3.79Å; V52-V56 WeakPolarHBondContact O-CB 3.47Å; V52-V56 WeakPolarHBondContact O-CG2 3.42Å; V52-V56 PolarHBondContact O-N 3.38Å
53	K	73.3	Confident	71.1	Confident	103 Å²	103	101.9 Å²	101.9	45%	0.448	52%	0.521	S	S	.	.	H	α-helix	trans	-58.8	-45.7	175.8	-175.8	178.2	179.9	-178.9	0	111.6	F49 A50 F51 L57	F49-K53 WeakPolarHBondContact O-CB 3.36Å; F49-K53 PolarHBondContact O-N 2.99Å; A50-K53 PolarHBondContact O-N 2.86Å; F51-K53 PolarHBondContact O-N 3.41Å; K53-L57 HydrophobicContact CG-CD1 3.87Å; K53-L57 HydrophobicContact CG-CG 4.38Å; K53-L57 VanDerWaalsContact O-CB 3.26Å; K53-L57 WeakPolarHBondContact O-CB 3.41Å; K53-L57 WeakPolarHBondContact O-CG 3.37Å; K53-L57 PolarHBondContact O-N 2.92Å
54	Q	74.3	Confident	71.5	Confident	147 Å²	147	100.3 Å²	100.3	69%	0.687	52%	0.516	S	S	*	.	H	α-helix	trans	-65.5	-41.6	176	-75.1	-157.8	-15.6	0	0	112.5	A50 F51 V52 L57 A58	A50-Q54 PolarHBondContact O-N 2.93Å; F51-Q54 PolarHBondContact O-N 2.96Å; V52-Q54 PolarHBondContact O-N 3.36Å; Q54-L57 PolarHBondContact O-N 3.38Å; Q54-A58 VanDerWaalsContact O-CB 3.24Å; Q54-A58 WeakPolarHBondContact O-CB 3.43Å; Q54-A58 PolarHBondContact O-N 2.6Å
55	F	73.9	Confident	72	Confident	112 Å²	112	105.2 Å²	105.2	49%	0.491	53%	0.531	S	S	.	.	H	α-helix	trans	-66.6	-39.7	178.5	-167.5	-96.7	0	0	0	112.2	F51 V52 A58 R59	F51-F55 WeakPolarHBondContact O-CB 3.28Å; F51-F55 PolarHBondContact O-N 3.13Å; V52-F55 PolarHBondContact O-N 2.94Å; F55-A58 PolarHBondContact O-N 3.05Å; F55-R59 WeakPolarHBondContact O-CB 3.04Å; F55-R59 PolarHBondContact O-N 3.08Å
56	V	74.6	Confident	72.2	Confident	43 Å²	43	103.5 Å²	103.5	26%	0.261	52%	0.517	S	S	.	.	H	α-helix	trans	-70	-43.2	177.1	170.6	0	0	0	0	110.5	V52 A58 R59 F60 F63	V52-V56 HydrophobicContact CG1-CG2 3.79Å; V52-V56 WeakPolarHBondContact O-CB 3.47Å; V52-V56 WeakPolarHBondContact O-CG2 3.42Å; V52-V56 PolarHBondContact O-N 3.38Å; V56-A58 VanDerWaalsContact C-N 3.29Å; V56-A58 PolarHBondContact O-N 3.08Å; V56-R59 PolarHBondContact O-N 2.89Å; V56-F60 CarbonylContact O-C 3.48Å; V56-F60 WeakPolarHBondContact O-CA 3.4Å; V56-F60 WeakPolarHBondContact O-CB 3.26Å; V56-F60 PolarHBondContact O-N 3.49Å; V56-F63 HydrophobicContact CG1-CB 4.34Å; V56-F63 HydrophobicContact CG1-CD1 4.47Å; V56-F63 HydrophobicContact CG1-CD2 3.16Å; V56-F63 HydrophobicContact CG1-CE2 3.41Å; V56-F63 VanDerWaalsContact CG1-CE2 3.41Å; V56-F63 HydrophobicContact CG1-CG 3.74Å; V56-F63 HydrophobicContact CG1-CZ 4.18Å
57	L	71.8	Confident	72.3	Confident	62 Å²	62	104.6 Å²	104.6	33%	0.325	52%	0.52	S	S	.	.	H	α-helix	trans	-63.2	-35.3	173.4	-72.8	171	0	0	0	112	K53 Q54 F63 Q64	K53-L57 HydrophobicContact CG-CD1 3.87Å; K53-L57 HydrophobicContact CG-CG 4.38Å; K53-L57 VanDerWaalsContact O-CB 3.26Å; K53-L57 WeakPolarHBondContact O-CB 3.41Å; K53-L57 WeakPolarHBondContact O-CG 3.37Å; K53-L57 PolarHBondContact O-N 2.92Å; Q54-L57 PolarHBondContact O-N 3.38Å; L57-F63 HydrophobicContact CD2-CB 4.33Å; L57-Q64 HydrophobicContact CD2-CB 4.16Å
58	A	71.5	Confident	73	Confident	83 Å²	83	105 Å²	105	69%	0.686	52%	0.524	S	S	*	.	H	α-helix	trans	-75.4	-36.9	176.6	0	0	0	0	0	113.1	Q54 F55 V56	Q54-A58 VanDerWaalsContact O-CB 3.24Å; Q54-A58 WeakPolarHBondContact O-CB 3.43Å; Q54-A58 PolarHBondContact O-N 2.6Å; F55-A58 PolarHBondContact O-N 3.05Å; V56-A58 VanDerWaalsContact C-N 3.29Å; V56-A58 PolarHBondContact O-N 3.08Å
59	R	77.6	Confident	73.4	Confident	159 Å²	159	103.4 Å²	103.4	60%	0.6	51%	0.509	S	S	*	.	H	α-helix	trans	-80.3	-38.7	-178.6	-176.1	61.7	62.5	177.5	2.9	112.3	F55 V56	F55-R59 WeakPolarHBondContact O-CB 3.04Å; F55-R59 PolarHBondContact O-N 3.08Å; V56-R59 PolarHBondContact O-N 2.89Å
60	F	80.1	Confident	73.9	Confident	113 Å²	113	100.5 Å²	100.5	50%	0.496	50%	0.501	S	S	.	.			trans	-129.1	89.2	-175.4	-65.2	-74	0	0	0	107.3	V56 C62 F63	V56-F60 CarbonylContact O-C 3.48Å; V56-F60 WeakPolarHBondContact O-CA 3.4Å; V56-F60 WeakPolarHBondContact O-CB 3.26Å; V56-F60 PolarHBondContact O-N 3.49Å; F60-C62 PolarHBondContact O-N 3.45Å; F60-F63 HydrophobicContact CB-CD2 3.51Å; F60-F63 HydrophobicContact CB-CE2 3.61Å; F60-F63 HydrophobicContact CD2-CE2 4.06Å; F60-F63 HydrophobicContact CG-CD2 4.38Å; F60-F63 HydrophobicContact CG-CE2 4Å; F60-F63 PolarHBondContact O-N 3.41Å
61	P	75.1	Confident	74.3	Confident	89 Å²	89	105.9 Å²	105.9	58%	0.578	51%	0.511	S	S	*	.	G	3₁₀ helix	trans	-54.9	-18.2	168.3	25.6	-34.9	0	0	0	111	F63 Q64	P61-F63 PolarHBondContact O-N 3.36Å; P61-F63 VanDerWaalsContact O-N 3.08Å; P61-Q64 PolarHBondContact O-N 3.49Å; P61-Q64 VanDerWaalsContact O-N 3.08Å
62	C	72.8	Confident	74.7	Confident	67 Å²	67	111.8 Å²	111.8	45%	0.453	53%	0.53	S	S	.	.	G	3₁₀ helix	trans	-61.1	-1.5	170.5	-53.9	0	0	0	0	116.2	F60 W65 L66	F60-C62 PolarHBondContact O-N 3.45Å; C62-W65 PolarHBondContact O-NE1 2.91Å; C62-L66 WeakPolarHBondContact O-CB 3.41Å
63	F	70.3	Confident	75.2	Confident	88 Å²	88	115.9 Å²	115.9	39%	0.386	54%	0.542	S	S	.	.	G	3₁₀ helix	trans	-94.5	-26.4	167.4	-73.3	-81	0	0	0	112.4	V56 L57 F60 P61 L66 M67	V56-F63 HydrophobicContact CG1-CB 4.34Å; V56-F63 HydrophobicContact CG1-CD1 4.47Å; V56-F63 HydrophobicContact CG1-CD2 3.16Å; V56-F63 HydrophobicContact CG1-CE2 3.41Å; V56-F63 VanDerWaalsContact CG1-CE2 3.41Å; V56-F63 HydrophobicContact CG1-CG 3.74Å; V56-F63 HydrophobicContact CG1-CZ 4.18Å; L57-F63 HydrophobicContact CD2-CB 4.33Å; F60-F63 HydrophobicContact CB-CD2 3.51Å; F60-F63 HydrophobicContact CB-CE2 3.61Å; F60-F63 HydrophobicContact CD2-CE2 4.06Å; F60-F63 HydrophobicContact CG-CD2 4.38Å; F60-F63 HydrophobicContact CG-CE2 4Å; F60-F63 PolarHBondContact O-N 3.41Å; P61-F63 PolarHBondContact O-N 3.36Å; P61-F63 VanDerWaalsContact O-N 3.08Å; F63-L66 HydrophobicContact CD1-CD2 4.47Å; F63-L66 PolarHBondContact O-N 3.32Å; F63-M67 WeakPolarHBondContact O-CB 3.49Å; F63-M67 VanDerWaalsContact O-CG 3.28Å; F63-M67 WeakPolarHBondContact O-CG 3.14Å; F63-M67 PolarHBondContact O-N 2.85Å
64	Q	72.1	Confident	75.6	Confident	129 Å²	129	113.6 Å²	113.6	60%	0.603	53%	0.534	S	S	*	.	H	α-helix	trans	-67	-50.3	179.2	-171.3	173.8	-10.7	0	0	111.2	L57 P61 L66 M67 E68	L57-Q64 HydrophobicContact CD2-CB 4.16Å; P61-Q64 PolarHBondContact O-N 3.49Å; P61-Q64 VanDerWaalsContact O-N 3.08Å; Q64-L66 VanDerWaalsContact C-N 3.28Å; Q64-L66 PolarHBondContact O-N 2.82Å; Q64-M67 PolarHBondContact O-N 3.15Å; Q64-E68 PolarHBondContact O-N 2.91Å
65	W	74.3	Confident	76	Confident	162 Å²	162	109.7 Å²	109.7	61%	0.614	52%	0.518	S	S	*	.	H	α-helix	trans	-60.6	-35.9	174.3	78.1	-43.4	0	0	0	112.4	C62 E68 Y69	C62-W65 PolarHBondContact O-NE1 2.91Å; W65-E68 PolarHBondContact O-N 3.46Å; W65-Y69 WeakPolarHBondContact O-CB 3.41Å; W65-Y69 PolarHBondContact O-N 3Å; W65-Y69 VanDerWaalsContact O-N 3.15Å
66	L	75.4	Confident	76.6	Confident	73 Å²	73	108.8 Å²	108.8	38%	0.382	52%	0.521	S	S	.	.	H	α-helix	trans	-73.8	-34.7	-176.3	-170.5	67.8	0	0	0	112	C62 F63 Q64 E68 Y69 W71	C62-L66 WeakPolarHBondContact O-CB 3.41Å; F63-L66 HydrophobicContact CD1-CD2 4.47Å; F63-L66 PolarHBondContact O-N 3.32Å; Q64-L66 VanDerWaalsContact C-N 3.28Å; Q64-L66 PolarHBondContact O-N 2.82Å; L66-E68 VanDerWaalsContact C-N 3.32Å; L66-Y69 WeakPolarHBondContact O-CB 3.49Å; L66-Y69 PolarHBondContact O-N 2.93Å; L66-W71 HydrophobicContact CD1-CZ2 4.41Å
67	M	71.8	Confident	77.1	Confident	143 Å²	143	113.2 Å²	113.2	70%	0.704	54%	0.539	S	S	*	.	H	α-helix	trans	-70.1	-28.4	175.8	-73.9	-170.9	76.2	0	0	112.7	F63 Q64	F63-M67 WeakPolarHBondContact O-CB 3.49Å; F63-M67 VanDerWaalsContact O-CG 3.28Å; F63-M67 WeakPolarHBondContact O-CG 3.14Å; F63-M67 PolarHBondContact O-N 2.85Å; Q64-M67 PolarHBondContact O-N 3.15Å
68	E	77.6	Confident	77.9	Confident	155 Å²	155	113.8 Å²	113.8	72%	0.724	54%	0.542	S	S	*	.	H	α-helix	trans	-90.6	-6.2	178.1	-166.1	159.8	-157.4	0	0	113	Q64 W65 L66 N70	Q64-E68 PolarHBondContact O-N 2.91Å; W65-E68 PolarHBondContact O-N 3.46Å; L66-E68 VanDerWaalsContact C-N 3.32Å; E68-N70 PolarHBondContact O-N 3.43Å
69	Y	76.5	Confident	78.7	Confident	41 Å²	41	114.4 Å²	114.4	16%	0.161	53%	0.533	C	S	.	.			trans	-70.8	122	-174.6	-169.3	-98.9	0	0	0	112.9	W65 L66 W71 D74 L75 D78	W65-Y69 WeakPolarHBondContact O-CB 3.41Å; W65-Y69 PolarHBondContact O-N 3Å; W65-Y69 VanDerWaalsContact O-N 3.15Å; L66-Y69 WeakPolarHBondContact O-CB 3.49Å; L66-Y69 PolarHBondContact O-N 2.93Å; Y69-W71 HydrophobicContact CD1-CD2 4.15Å; Y69-W71 HydrophobicContact CD1-CG 4.13Å; Y69-W71 HydrophobicContact CE1-CD2 4.35Å; Y69-W71 HydrophobicContact CE1-CE3 4.43Å; Y69-W71 HydrophobicContact CE1-CG 4.48Å; Y69-W71 PolarHBondContact O-N 2.99Å; Y69-D74 HydrophobicContact CD2-CB 3.95Å; Y69-D74 HydrophobicContact CE1-CB 3.97Å; Y69-D74 HydrophobicContact CE2-CB 3.3Å; Y69-D74 PolarHBondContact OH-O 3.15Å; Y69-L75 HydrophobicContact CE1-CB 4.5Å; Y69-L75 VanDerWaalsContact OH-CA 3.26Å; Y69-L75 WeakPolarHBondContact OH-CA 3.16Å; Y69-L75 PolarHBondContact OH-N 2.9Å; Y69-L75 VanDerWaalsContact OH-N 3.08Å; Y69-D78 WeakPolarHBondContact CE2-OD2 3.32Å; Y69-D78 PolarHBondContact OH-OD2 3.35Å
70	N	79.1	Confident	79.3	Confident	108 Å²	108	110.8 Å²	110.8	58%	0.578	53%	0.529	S	S	*	.			trans	-88.3	88.4	176.5	-78.6	-66.2	0	0	0	110.1	E68 R72 K73 D74	E68-N70 PolarHBondContact O-N 3.43Å; N70-R72 PolarHBondContact O-N 2.84Å; N70-K73 PolarHBondContact O-N 3.29Å; N70-D74 PolarHBondContact N-OD2 3.46Å; N70-D74 PolarHBondContact O-N 3.31Å
71	W	78.7	Confident	79.7	Confident	160 Å²	160	108 Å²	108	61%	0.606	52%	0.524	S	S	*	.	T	Hydrogen-bonded Turn	trans	-44.4	-29	-179	-69.3	85.6	0	0	0	115.9	L66 Y69 L75	L66-W71 HydrophobicContact CD1-CZ2 4.41Å; Y69-W71 HydrophobicContact CD1-CD2 4.15Å; Y69-W71 HydrophobicContact CD1-CG 4.13Å; Y69-W71 HydrophobicContact CE1-CD2 4.35Å; Y69-W71 HydrophobicContact CE1-CE3 4.43Å; Y69-W71 HydrophobicContact CE1-CG 4.48Å; Y69-W71 PolarHBondContact O-N 2.99Å; W71-L75 HydrophobicContact CE3-CD1 4.32Å; W71-L75 HydrophobicContact CE3-CD2 4.42Å; W71-L75 HydrophobicContact CZ3-CD1 4.43Å; W71-L75 WeakPolarHBondContact O-CB 3.26Å
72	R	78.3	Confident	80.4	Confident	231 Å²	231	105.8 Å²	105.8	87%	0.872	52%	0.516	S	S	*	.	T	Hydrogen-bonded Turn	trans	-79.7	-34.9	-180	-68.1	-176.3	-178.9	-90.4	0.9	113.9	N70	N70-R72 PolarHBondContact O-N 2.84Å
73	K	79.8	Confident	81.2	Confident	166 Å²	166	106.6 Å²	106.6	72%	0.722	52%	0.519	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.6	-45.8	-175.6	-70.9	-176.3	177.5	-179	0	110.8	N70	N70-K73 PolarHBondContact O-N 3.29Å
74	D	81.4	Confident	82	Confident	54 Å²	54	105.5 Å²	105.5	29%	0.289	52%	0.52	S	S	.	.	H	α-helix	trans	-82.5	-35.2	-169.8	-54.6	-34.1	0	0	0	111	Y69 N70 V76 Q77 D78	Y69-D74 HydrophobicContact CD2-CB 3.95Å; Y69-D74 HydrophobicContact CE1-CB 3.97Å; Y69-D74 HydrophobicContact CE2-CB 3.3Å; Y69-D74 PolarHBondContact OH-O 3.15Å; N70-D74 PolarHBondContact N-OD2 3.46Å; N70-D74 PolarHBondContact O-N 3.31Å; D74-V76 VanDerWaalsContact C-N 3.33Å; D74-V76 PolarHBondContact O-N 3.49Å; D74-Q77 PolarHBondContact O-N 3.45Å; D74-Q77 VanDerWaalsContact O-N 3.17Å; D74-D78 WeakPolarHBondContact O-CB 3.47Å; D74-D78 PolarHBondContact O-N 3.27Å
75	L	83.8	Confident	82.7	Confident	65 Å²	65	103.9 Å²	103.9	34%	0.34	52%	0.519	S	S	.	.	H	α-helix	trans	-62.4	-38	-178.3	-172.4	71.9	0	0	0	112.7	Y69 W71 Q77 D78 I79	Y69-L75 HydrophobicContact CE1-CB 4.5Å; Y69-L75 VanDerWaalsContact OH-CA 3.26Å; Y69-L75 WeakPolarHBondContact OH-CA 3.16Å; Y69-L75 PolarHBondContact OH-N 2.9Å; Y69-L75 VanDerWaalsContact OH-N 3.08Å; W71-L75 HydrophobicContact CE3-CD1 4.32Å; W71-L75 HydrophobicContact CE3-CD2 4.42Å; W71-L75 HydrophobicContact CZ3-CD1 4.43Å; W71-L75 WeakPolarHBondContact O-CB 3.26Å; L75-Q77 VanDerWaalsContact C-N 3.35Å; L75-D78 PolarHBondContact O-N 2.87Å; L75-I79 HydrophobicContact CD1-CD1 4.25Å; L75-I79 HydrophobicContact CD1-CG1 4.46Å; L75-I79 HydrophobicContact CD2-CD1 4.29Å; L75-I79 HydrophobicContact CG-CD1 3.78Å; L75-I79 HydrophobicContact CG-CG1 4.34Å; L75-I79 WeakPolarHBondContact O-CB 3.19Å; L75-I79 WeakPolarHBondContact O-CG1 3.38Å; L75-I79 PolarHBondContact O-N 3.25Å
76	V	85.7	Confident	83.2	Confident	93 Å²	93	97.6 Å²	97.6	56%	0.564	50%	0.504	S	S	*	.	H	α-helix	trans	-67.3	-40.8	179.6	179.6	0	0	0	0	110.3	D74 T80	D74-V76 VanDerWaalsContact C-N 3.33Å; D74-V76 PolarHBondContact O-N 3.49Å; V76-T80 WeakPolarHBondContact O-CB 3.24Å; V76-T80 PolarHBondContact O-N 3.37Å; V76-T80 PolarHBondContact O-OG1 3.07Å
77	Q	85.6	Confident	83.6	Confident	136 Å²	136	99.4 Å²	99.4	64%	0.636	51%	0.513	S	S	*	.	H	α-helix	trans	-68.1	-40.9	176.4	-175.8	174	-30.2	0	0	111.3	D74 L75 T80 S81	D74-Q77 PolarHBondContact O-N 3.45Å; D74-Q77 VanDerWaalsContact O-N 3.17Å; L75-Q77 VanDerWaalsContact C-N 3.35Å; Q77-T80 PolarHBondContact O-N 2.82Å; Q77-S81 VanDerWaalsContact O-CB 3.25Å; Q77-S81 WeakPolarHBondContact O-CB 3.42Å; Q77-S81 PolarHBondContact O-N 3.43Å; Q77-S81 PolarHBondContact O-OG 3.42Å
78	D	88.6	Confident	84	Confident	74 Å²	74	99.1 Å²	99.1	40%	0.396	51%	0.508	S	S	.	.	H	α-helix	trans	-68.9	-38.3	178.1	-72.9	-10.8	0	0	0	112.2	Y69 D74 L75 S81 G82	Y69-D78 WeakPolarHBondContact CE2-OD2 3.32Å; Y69-D78 PolarHBondContact OH-OD2 3.35Å; D74-D78 WeakPolarHBondContact O-CB 3.47Å; D74-D78 PolarHBondContact O-N 3.27Å; L75-D78 PolarHBondContact O-N 2.87Å; D78-S81 WeakPolarHBondContact CA-OG 3.14Å; D78-S81 PolarHBondContact O-OG 2.8Å; D78-S81 VanDerWaalsContact O-OG 3.09Å; D78-G82 WeakPolarHBondContact O-CA 3.19Å; D78-G82 PolarHBondContact O-N 3.3Å
79	I	89.2	Confident	84.1	Confident	97 Å²	97	96.4 Å²	96.4	50%	0.497	50%	0.498	S	S	.	.	H	α-helix	trans	-65.9	-48	172.9	-70.4	168.9	0	0	0	110.3	L75 S81 G82 V83	L75-I79 HydrophobicContact CD1-CD1 4.25Å; L75-I79 HydrophobicContact CD1-CG1 4.46Å; L75-I79 HydrophobicContact CD2-CD1 4.29Å; L75-I79 HydrophobicContact CG-CD1 3.78Å; L75-I79 HydrophobicContact CG-CG1 4.34Å; L75-I79 WeakPolarHBondContact O-CB 3.19Å; L75-I79 WeakPolarHBondContact O-CG1 3.38Å; L75-I79 PolarHBondContact O-N 3.25Å; I79-S81 PolarHBondContact O-N 3.23Å; I79-G82 PolarHBondContact O-N 3.29Å; I79-V83 HydrophobicContact CG2-CG2 4.26Å; I79-V83 WeakPolarHBondContact O-CB 3.2Å; I79-V83 VanDerWaalsContact O-CG2 3.25Å; I79-V83 WeakPolarHBondContact O-CG2 3.32Å; I79-V83 PolarHBondContact O-N 2.97Å
80	T	89.8	Confident	83.9	Confident	83 Å²	83	99.9 Å²	99.9	51%	0.509	52%	0.518	S	S	.	.	H	α-helix	trans	-64	-44.1	-178	-54.7	0	0	0	0	111.2	V76 Q77 T84	V76-T80 WeakPolarHBondContact O-CB 3.24Å; V76-T80 PolarHBondContact O-N 3.37Å; V76-T80 PolarHBondContact O-OG1 3.07Å; Q77-T80 PolarHBondContact O-N 2.82Å; T80-T84 WeakPolarHBondContact O-CB 3.48Å; T80-T84 PolarHBondContact O-N 3.43Å; T80-T84 PolarHBondContact O-OG1 3.36Å
81	S	88.9	Confident	83.5	Confident	55 Å²	55	97.8 Å²	97.8	39%	0.385	51%	0.512	S	S	.	.	H	α-helix	trans	-66.3	-42.5	175.5	61.3	0	0	0	0	111.5	Q77 D78 I79 T84 V85	Q77-S81 VanDerWaalsContact O-CB 3.25Å; Q77-S81 WeakPolarHBondContact O-CB 3.42Å; Q77-S81 PolarHBondContact O-N 3.43Å; Q77-S81 PolarHBondContact O-OG 3.42Å; D78-S81 WeakPolarHBondContact CA-OG 3.14Å; D78-S81 PolarHBondContact O-OG 2.8Å; D78-S81 VanDerWaalsContact O-OG 3.09Å; I79-S81 PolarHBondContact O-N 3.23Å; S81-T84 PolarHBondContact O-N 2.83Å; S81-V85 WeakPolarHBondContact O-CB 3.4Å; S81-V85 VanDerWaalsContact O-CG2 3.22Å; S81-V85 WeakPolarHBondContact O-CG2 3.45Å; S81-V85 PolarHBondContact O-N 3.42Å
82	G	88.2	Confident	83.1	Confident	41 Å²	41	95.7 Å²	95.7	42%	0.423	51%	0.509	S	S	.	.	H	α-helix	trans	-62.8	-42	176.9	0	0	0	0	0	113.6	D78 I79 G86	D78-G82 WeakPolarHBondContact O-CA 3.19Å; D78-G82 PolarHBondContact O-N 3.3Å; I79-G82 PolarHBondContact O-N 3.29Å; G82-G86 WeakPolarHBondContact O-CA 3.48Å; G82-G86 PolarHBondContact O-N 2.85Å
83	V	90	Very high	82.5	Confident	84 Å²	84	85.9 Å²	85.9	51%	0.509	48%	0.48	S	S	.	.	H	α-helix	trans	-64.3	-46.1	173.7	170.6	0	0	0	0	110.3	I79 G86 I87	I79-V83 HydrophobicContact CG2-CG2 4.26Å; I79-V83 WeakPolarHBondContact O-CB 3.2Å; I79-V83 VanDerWaalsContact O-CG2 3.25Å; I79-V83 WeakPolarHBondContact O-CG2 3.32Å; I79-V83 PolarHBondContact O-N 2.97Å; V83-G86 PolarHBondContact O-N 3.05Å; V83-I87 HydrophobicContact CG1-CD1 3.84Å; V83-I87 VanDerWaalsContact O-CG1 3.27Å; V83-I87 WeakPolarHBondContact O-CG1 3.44Å; V83-I87 PolarHBondContact O-N 3.5Å
84	T	88.4	Confident	81.6	Confident	65 Å²	65	85.2 Å²	85.2	40%	0.399	48%	0.477	S	S	.	.	H	α-helix	trans	-60.1	-52.1	178.4	-56.5	0	0	0	0	111.1	T80 S81 G86 I87 F88	T80-T84 WeakPolarHBondContact O-CB 3.48Å; T80-T84 PolarHBondContact O-N 3.43Å; T80-T84 PolarHBondContact O-OG1 3.36Å; S81-T84 PolarHBondContact O-N 2.83Å; T84-G86 VanDerWaalsContact C-N 3.3Å; T84-G86 PolarHBondContact O-N 3.18Å; T84-I87 PolarHBondContact O-N 2.74Å; T84-F88 HydrophobicContact CG2-CD2 3.97Å; T84-F88 HydrophobicContact CG2-CE2 3.77Å; T84-F88 WeakPolarHBondContact O-CD2 3.5Å; T84-F88 PolarHBondContact O-N 3.47Å
85	V	86	Confident	80.4	Confident	96 Å²	96	88.5 Å²	88.5	58%	0.582	49%	0.494	S	S	*	.	H	α-helix	trans	-62.6	-38.1	177.5	173.2	0	0	0	0	111	S81 F88 N89	S81-V85 WeakPolarHBondContact O-CB 3.4Å; S81-V85 VanDerWaalsContact O-CG2 3.22Å; S81-V85 WeakPolarHBondContact O-CG2 3.45Å; S81-V85 PolarHBondContact O-N 3.42Å; V85-F88 PolarHBondContact O-N 2.82Å; V85-N89 VanDerWaalsContact O-CB 3.31Å; V85-N89 WeakPolarHBondContact O-CB 3.37Å; V85-N89 PolarHBondContact O-N 3.2Å
86	G	84	Confident	79.2	Confident	30 Å²	30	88.3 Å²	88.3	31%	0.309	50%	0.496	S	S	.	.	H	α-helix	trans	-62.3	-45.6	175.8	0	0	0	0	0	112.8	G82 V83 T84 F88 N89 I90	G82-G86 WeakPolarHBondContact O-CA 3.48Å; G82-G86 PolarHBondContact O-N 2.85Å; V83-G86 PolarHBondContact O-N 3.05Å; T84-G86 VanDerWaalsContact C-N 3.3Å; T84-G86 PolarHBondContact O-N 3.18Å; G86-F88 VanDerWaalsContact C-N 3.33Å; G86-F88 PolarHBondContact O-N 3.16Å; G86-N89 PolarHBondContact O-N 3.49Å; G86-I90 VanDerWaalsContact O-CG1 3.29Å; G86-I90 WeakPolarHBondContact O-CG1 3.45Å; G86-I90 PolarHBondContact O-N 3.46Å
87	I	84.1	Confident	77.9	Confident	110 Å²	110	87.7 Å²	87.7	56%	0.564	50%	0.496	S	S	*	.	H	α-helix	trans	-59.6	-46.1	174.5	-68.1	163.6	0	0	0	110.3	V83 T84 N89 I90 S91	V83-I87 HydrophobicContact CG1-CD1 3.84Å; V83-I87 VanDerWaalsContact O-CG1 3.27Å; V83-I87 WeakPolarHBondContact O-CG1 3.44Å; V83-I87 PolarHBondContact O-N 3.5Å; T84-I87 PolarHBondContact O-N 2.74Å; I87-N89 PolarHBondContact O-N 3.01Å; I87-I90 PolarHBondContact O-N 3.16Å; I87-S91 PolarHBondContact O-N 3.29Å
88	F	80.9	Confident	76.6	Confident	138 Å²	138	85.1 Å²	85.1	61%	0.605	49%	0.493	S	S	*	.	H	α-helix	trans	-59.7	-45.8	174.8	-82.4	-66.6	0	0	0	111.7	T84 V85 G86 I90 S91 Q92	T84-F88 HydrophobicContact CG2-CD2 3.97Å; T84-F88 HydrophobicContact CG2-CE2 3.77Å; T84-F88 WeakPolarHBondContact O-CD2 3.5Å; T84-F88 PolarHBondContact O-N 3.47Å; V85-F88 PolarHBondContact O-N 2.82Å; G86-F88 VanDerWaalsContact C-N 3.33Å; G86-F88 PolarHBondContact O-N 3.16Å; F88-I90 VanDerWaalsContact C-N 3.34Å; F88-I90 PolarHBondContact O-N 3.03Å; F88-S91 PolarHBondContact O-N 3.15Å; F88-S91 PolarHBondContact O-OG 3.45Å; F88-Q92 WeakPolarHBondContact O-CB 3.42Å; F88-Q92 PolarHBondContact O-N 2.87Å
89	N	78.5	Confident	75.1	Confident	98 Å²	98	84.5 Å²	84.5	52%	0.524	49%	0.494	S	S	.	.	H	α-helix	trans	-67.2	-31	-178.2	-167.3	51	0	0	0	113.2	V85 G86 I87 S91 Q92 G93	V85-N89 VanDerWaalsContact O-CB 3.31Å; V85-N89 WeakPolarHBondContact O-CB 3.37Å; V85-N89 PolarHBondContact O-N 3.2Å; G86-N89 PolarHBondContact O-N 3.49Å; I87-N89 PolarHBondContact O-N 3.01Å; N89-S91 VanDerWaalsContact C-N 3.34Å; N89-Q92 PolarHBondContact O-N 2.81Å; N89-G93 WeakPolarHBondContact O-CA 3.29Å; N89-G93 PolarHBondContact O-N 2.91Å
90	I	73.8	Confident	73.8	Confident	113 Å²	113	86.7 Å²	86.7	58%	0.579	50%	0.5	S	S	*	.	H	α-helix	trans	-63.1	-44.4	173.2	-69.1	162.5	0	0	0	110.4	G86 I87 F88	G86-I90 VanDerWaalsContact O-CG1 3.29Å; G86-I90 WeakPolarHBondContact O-CG1 3.45Å; G86-I90 PolarHBondContact O-N 3.46Å; I87-I90 PolarHBondContact O-N 3.16Å; F88-I90 VanDerWaalsContact C-N 3.34Å; F88-I90 PolarHBondContact O-N 3.03Å
91	S	69.3	Low	72.3	Confident	64 Å²	64	88.3 Å²	88.3	45%	0.448	51%	0.505	S	S	.	.	H	α-helix	trans	-68.9	-40.3	177.1	73.6	0	0	0	0	111.7	I87 F88 N89 L95	I87-S91 PolarHBondContact O-N 3.29Å; F88-S91 PolarHBondContact O-N 3.15Å; F88-S91 PolarHBondContact O-OG 3.45Å; N89-S91 VanDerWaalsContact C-N 3.34Å; S91-L95 WeakPolarHBondContact O-CG 3.3Å; S91-L95 PolarHBondContact O-N 2.88Å
92	Q	71.1	Confident	71.1	Confident	116 Å²	116	88.4 Å²	88.4	54%	0.542	51%	0.506	S	S	.	.	H	α-helix	trans	-70.5	-41.1	-179.2	-168.1	172.1	46.4	0	0	112.2	F88 N89 K94 L95 T96	F88-Q92 WeakPolarHBondContact O-CB 3.42Å; F88-Q92 PolarHBondContact O-N 2.87Å; N89-Q92 PolarHBondContact O-N 2.81Å; Q92-K94 VanDerWaalsContact C-N 3.31Å; Q92-K94 PolarHBondContact O-N 3.32Å; Q92-L95 CarbonylContact O-C 3.57Å; Q92-L95 PolarHBondContact O-N 2.94Å; Q92-L95 VanDerWaalsContact O-N 3.09Å; Q92-T96 HydrophobicContact CG-CG2 4.25Å; Q92-T96 PolarHBondContact O-N 3.41Å; Q92-T96 PolarHBondContact O-OG1 3.42Å; Q92-T96 VanDerWaalsContact O-OG1 3.09Å
93	G	65.1	Low	70	Confident	26 Å²	26	93.6 Å²	93.6	27%	0.268	52%	0.521	S	S	.	.	H	α-helix	trans	-59.6	-40.5	-179.5	0	0	0	0	0	112.5	N89 T96 S97	N89-G93 WeakPolarHBondContact O-CA 3.29Å; N89-G93 PolarHBondContact O-N 2.91Å; G93-T96 WeakPolarHBondContact CA-OG1 3.49Å; G93-T96 PolarHBondContact O-N 3.5Å; G93-T96 PolarHBondContact O-OG1 2.86Å; G93-S97 WeakPolarHBondContact O-CB 3.3Å; G93-S97 PolarHBondContact O-N 2.8Å; G93-S97 PolarHBondContact O-OG 3.29Å
94	K	60.7	Low	68.9	Low	151 Å²	151	94 Å²	94	66%	0.657	52%	0.52	S	S	*	.	H	α-helix	trans	-65.4	-43.5	173.9	-68.1	-173.9	-179.2	179.1	0	111.6	Q92 S97 S98	Q92-K94 VanDerWaalsContact C-N 3.31Å; Q92-K94 PolarHBondContact O-N 3.32Å; K94-S97 PolarHBondContact O-N 2.98Å; K94-S98 VanDerWaalsContact O-CB 3.31Å; K94-S98 WeakPolarHBondContact O-CB 3.21Å; K94-S98 PolarHBondContact O-N 3.32Å; K94-S98 PolarHBondContact O-OG 3.42Å; K94-S98 VanDerWaalsContact O-OG 3.11Å
95	L	56.4	Low	67.8	Low	123 Å²	123	94.9 Å²	94.9	64%	0.644	53%	0.527	S	S	*	.	H	α-helix	trans	-66	-37.7	177.2	-68.9	168.4	0	0	0	112.4	S91 Q92 S99	S91-L95 WeakPolarHBondContact O-CG 3.3Å; S91-L95 PolarHBondContact O-N 2.88Å; Q92-L95 CarbonylContact O-C 3.57Å; Q92-L95 PolarHBondContact O-N 2.94Å; Q92-L95 VanDerWaalsContact O-N 3.09Å; L95-S99 VanDerWaalsContact O-CB 3.26Å; L95-S99 WeakPolarHBondContact O-CB 3.31Å; L95-S99 PolarHBondContact O-N 2.78Å; L95-S99 PolarHBondContact O-OG 3.15Å
96	T	59.5	Low	66.9	Low	62 Å²	62	98.1 Å²	98.1	38%	0.38	53%	0.53	S	S	.	.	H	α-helix	trans	-74.2	-32.7	178	51.6	0	0	0	0	113.3	Q92 G93 S99 K100	Q92-T96 HydrophobicContact CG-CG2 4.25Å; Q92-T96 PolarHBondContact O-N 3.41Å; Q92-T96 PolarHBondContact O-OG1 3.42Å; Q92-T96 VanDerWaalsContact O-OG1 3.09Å; G93-T96 WeakPolarHBondContact CA-OG1 3.49Å; G93-T96 PolarHBondContact O-N 3.5Å; G93-T96 PolarHBondContact O-OG1 2.86Å; T96-S99 WeakPolarHBondContact CA-OG 3.47Å; T96-S99 PolarHBondContact O-OG 3.12Å; T96-K100 WeakPolarHBondContact O-CB 3.48Å; T96-K100 VanDerWaalsContact O-CG 3.24Å; T96-K100 WeakPolarHBondContact O-CG 3.43Å; T96-K100 PolarHBondContact O-N 2.98Å; T96-K100 VanDerWaalsContact O-N 3.13Å
97	S	58.1	Low	66.5	Low	80 Å²	80	103.2 Å²	103.2	56%	0.559	55%	0.546	S	S	*	.	H	α-helix	trans	-72.9	-40.7	172.3	-74.6	0	0	0	0	111.1	G93 K94 L101	G93-S97 WeakPolarHBondContact O-CB 3.3Å; G93-S97 PolarHBondContact O-N 2.8Å; G93-S97 PolarHBondContact O-OG 3.29Å; K94-S97 PolarHBondContact O-N 2.98Å; S97-L101 WeakPolarHBondContact O-CB 3.17Å; S97-L101 PolarHBondContact O-N 3.12Å
98	S	57.3	Low	65.8	Low	81 Å²	81	104.6 Å²	104.6	57%	0.566	55%	0.548	S	S	*	.	H	α-helix	trans	-67.8	-36.3	175.8	-67.8	0	0	0	0	113.1	K94 L101 S102	K94-S98 VanDerWaalsContact O-CB 3.31Å; K94-S98 WeakPolarHBondContact O-CB 3.21Å; K94-S98 PolarHBondContact O-N 3.32Å; K94-S98 PolarHBondContact O-OG 3.42Å; K94-S98 VanDerWaalsContact O-OG 3.11Å; S98-L101 PolarHBondContact O-N 2.64Å; S98-S102 PolarHBondContact O-N 2.72Å; S98-S102 PolarHBondContact O-OG 2.69Å
99	S	58.3	Low	65.5	Low	61 Å²	61	103.8 Å²	103.8	43%	0.427	55%	0.546	S	S	.	.	H	α-helix	trans	-73.7	-35	177.1	64.1	0	0	0	0	112.8	L95 T96 S102 M103	L95-S99 VanDerWaalsContact O-CB 3.26Å; L95-S99 WeakPolarHBondContact O-CB 3.31Å; L95-S99 PolarHBondContact O-N 2.78Å; L95-S99 PolarHBondContact O-OG 3.15Å; T96-S99 WeakPolarHBondContact CA-OG 3.47Å; T96-S99 PolarHBondContact O-OG 3.12Å; S99-S102 WeakPolarHBondContact CA-OG 3.34Å; S99-S102 PolarHBondContact O-OG 2.67Å; S99-M103 WeakPolarHBondContact O-CB 3.38Å; S99-M103 PolarHBondContact O-N 2.83Å
100	K	60.5	Low	65.3	Low	144 Å²	144	104.9 Å²	104.9	63%	0.626	55%	0.552	S	S	*	*	H	α-helix	trans	-70.2	-37.1	171.6	-72.6	179.3	-177.1	-176.4	0	112	T96 M103 L104	T96-K100 WeakPolarHBondContact O-CB 3.48Å; T96-K100 VanDerWaalsContact O-CG 3.24Å; T96-K100 WeakPolarHBondContact O-CG 3.43Å; T96-K100 PolarHBondContact O-N 2.98Å; T96-K100 VanDerWaalsContact O-N 3.13Å; K100-M103 PolarHBondContact O-N 2.65Å; K100-L104 WeakPolarHBondContact O-CB 3.48Å; K100-L104 PolarHBondContact O-N 3.09Å
101	L	59.9	Low	65.3	Low	117 Å²	117	105.7 Å²	105.7	61%	0.613	56%	0.557	S	S	*	*	H	α-helix	trans	-67.6	-40.5	175.4	-135.7	94.2	0	0	0	111.6	S97 S98 M103 L104 C105	S97-L101 WeakPolarHBondContact O-CB 3.17Å; S97-L101 PolarHBondContact O-N 3.12Å; S98-L101 PolarHBondContact O-N 2.64Å; L101-M103 VanDerWaalsContact C-N 3.35Å; L101-L104 PolarHBondContact O-N 3.43Å; L101-C105 WeakPolarHBondContact O-CB 3.28Å; L101-C105 PolarHBondContact O-N 2.83Å
102	S	63.3	Low	65.2	Low	57 Å²	57	112 Å²	112	40%	0.399	58%	0.576	S	S	.	*	H	α-helix	trans	-63.5	-43.1	174.3	63.7	0	0	0	0	110.7	S98 S99 L104 C105 Y106	S98-S102 PolarHBondContact O-N 2.72Å; S98-S102 PolarHBondContact O-OG 2.69Å; S99-S102 WeakPolarHBondContact CA-OG 3.34Å; S99-S102 PolarHBondContact O-OG 2.67Å; S102-L104 PolarHBondContact O-N 2.64Å; S102-C105 PolarHBondContact O-N 2.78Å; S102-Y106 WeakPolarHBondContact O-CD2 3.48Å; S102-Y106 PolarHBondContact O-N 2.66Å
103	M	65	Low	65	Low	149 Å²	149	114.5 Å²	114.5	73%	0.734	59%	0.592	S	S	*	*	H	α-helix	trans	-62	-41.4	176.4	-135.8	179	-139.9	0	0	112.2	S99 K100 L101 H107	S99-M103 WeakPolarHBondContact O-CB 3.38Å; S99-M103 PolarHBondContact O-N 2.83Å; K100-M103 PolarHBondContact O-N 2.65Å; L101-M103 VanDerWaalsContact C-N 3.35Å; M103-H107 WeakPolarHBondContact O-CB 2.93Å; M103-H107 PolarHBondContact O-N 2.84Å
104	L	67	Low	65	Low	93 Å²	93	119 Å²	119	49%	0.487	61%	0.608	S	S	.	*	H	α-helix	trans	-66.2	-43.7	174.7	-84.2	159.9	0	0	0	112.1	K100 L101 S102 Y106 H107 F108	K100-L104 WeakPolarHBondContact O-CB 3.48Å; K100-L104 PolarHBondContact O-N 3.09Å; L101-L104 PolarHBondContact O-N 3.43Å; S102-L104 PolarHBondContact O-N 2.64Å; L104-Y106 PolarHBondContact O-N 2.88Å; L104-H107 PolarHBondContact O-N 2.9Å; L104-H107 VanDerWaalsContact O-N 3.15Å; L104-F108 HydrophobicContact CD2-CD2 4.49Å; L104-F108 HydrophobicContact CD2-CE2 4.16Å; L104-F108 WeakPolarHBondContact O-CD2 3.06Å; L104-F108 PolarHBondContact O-N 3.2Å
105	C	64.6	Low	65.2	Low	83 Å²	83	117.3 Å²	117.3	56%	0.561	61%	0.605	S	S	*	*	H	α-helix	trans	-61.3	-42.8	175.1	-87.9	0	0	0	0	112	L101 S102 H107 F108 H109	L101-C105 WeakPolarHBondContact O-CB 3.28Å; L101-C105 PolarHBondContact O-N 2.83Å; S102-C105 PolarHBondContact O-N 2.78Å; C105-H107 VanDerWaalsContact C-N 3.28Å; C105-H107 PolarHBondContact O-N 3.41Å; C105-F108 PolarHBondContact O-N 2.88Å; C105-H109 VanDerWaalsContact O-CB 3.26Å; C105-H109 WeakPolarHBondContact O-CB 3.35Å; C105-H109 PolarHBondContact O-N 3.36Å
106	Y	68.1	Low	65.7	Low	164 Å²	164	116.9 Å²	116.9	64%	0.643	60%	0.603	S	S	*	*	H	α-helix	trans	-63.4	-35.2	173.9	-81.4	-68.1	0	0	0	112.1	S102 L104 N110	S102-Y106 WeakPolarHBondContact O-CD2 3.48Å; S102-Y106 PolarHBondContact O-N 2.66Å; L104-Y106 PolarHBondContact O-N 2.88Å; Y106-N110 WeakPolarHBondContact O-CB 3.43Å; Y106-N110 PolarHBondContact O-N 2.85Å; Y106-N110 PolarHBondContact O-ND2 3.43Å
107	H	74.2	Confident	66.1	Low	138 Å²	138	120.2 Å²	120.2	64%	0.639	62%	0.616	S	S	*	*	H	α-helix	trans	-73.7	-40.1	178.5	-157.2	34.2	0	0	0	112.6	M103 L104 C105 L111	M103-H107 WeakPolarHBondContact O-CB 2.93Å; M103-H107 PolarHBondContact O-N 2.84Å; L104-H107 PolarHBondContact O-N 2.9Å; L104-H107 VanDerWaalsContact O-N 3.15Å; C105-H107 VanDerWaalsContact C-N 3.28Å; C105-H107 PolarHBondContact O-N 3.41Å; H107-L111 PolarHBondContact O-N 3.2Å
108	F	70	Confident	66.6	Low	139 Å²	139	122.7 Å²	122.7	61%	0.61	62%	0.62	S	S	*	*	H	α-helix	trans	-71.1	-37.7	175.7	-88.5	-78.7	0	0	0	113	L104 C105 L111 F112	L104-F108 HydrophobicContact CD2-CD2 4.49Å; L104-F108 HydrophobicContact CD2-CE2 4.16Å; L104-F108 WeakPolarHBondContact O-CD2 3.06Å; L104-F108 PolarHBondContact O-N 3.2Å; C105-F108 PolarHBondContact O-N 2.88Å; F108-L111 PolarHBondContact O-N 2.71Å; F108-L111 VanDerWaalsContact O-N 3.15Å; F108-F112 PolarHBondContact O-N 3.18Å
109	H	74	Confident	67.2	Low	121 Å²	121	125.5 Å²	125.5	56%	0.56	62%	0.623	S	S	*	*	H	α-helix	trans	-66.3	-37.1	177.7	-171.1	-119.9	0	0	0	112.1	C105 L111 I113	C105-H109 VanDerWaalsContact O-CB 3.26Å; C105-H109 WeakPolarHBondContact O-CB 3.35Å; C105-H109 PolarHBondContact O-N 3.36Å; H109-L111 VanDerWaalsContact C-N 3.28Å; H109-L111 PolarHBondContact O-N 3.31Å; H109-I113 VanDerWaalsContact CE1-CD1 3.41Å; H109-I113 WeakPolarHBondContact CE1-CD1 3.46Å; H109-I113 WeakPolarHBondContact O-CG1 3.15Å; H109-I113 PolarHBondContact O-N 3.01Å
110	N	75.6	Confident	67.9	Low	120 Å²	120	130.1 Å²	130.1	64%	0.642	64%	0.637	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.8	-10.8	173.3	-83	-37.7	0	0	0	114.1	Y106	Y106-N110 WeakPolarHBondContact O-CB 3.43Å; Y106-N110 PolarHBondContact O-N 2.85Å; Y106-N110 PolarHBondContact O-ND2 3.43Å
111	L	73.2	Confident	68.4	Low	131 Å²	131	129 Å²	129	69%	0.686	64%	0.638	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.5	-15.9	177.4	-161.3	72.3	0	0	0	112.4	H107 F108 H109	H107-L111 PolarHBondContact O-N 3.2Å; F108-L111 PolarHBondContact O-N 2.71Å; F108-L111 VanDerWaalsContact O-N 3.15Å; H109-L111 VanDerWaalsContact C-N 3.28Å; H109-L111 PolarHBondContact O-N 3.31Å
112	F	68.2	Low	69.1	Low	196 Å²	196	130 Å²	130	86%	0.86	64%	0.641	S	S	*	*			trans	-114.5	2.3	-175.8	-133.8	-92.6	0	0	0	114	F108	F108-F112 PolarHBondContact O-N 3.18Å
113	I	66.4	Low	69.7	Low	169 Å²	169	136.6 Å²	136.6	87%	0.867	66%	0.662	S	S	*	*			trans	-103.5	0	165	-65.2	174.8	0	0	0	107.4	H109	H109-I113 VanDerWaalsContact CE1-CD1 3.41Å; H109-I113 WeakPolarHBondContact CE1-CD1 3.46Å; H109-I113 WeakPolarHBondContact O-CG1 3.15Å; H109-I113 PolarHBondContact O-N 3.01Å

Retrieved 113 of 113 residues in 22.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).