A0A077Z3V8_TRITR Loading...

Immediate early response 3-interacting protein 1

Regulator of endoplasmic reticulum secretion that acts as a key determinant of brain size. Required for secretion of extracellular matrix proteins. Required for correct brain development by depositing sufficient extracellular matrix proteins for tissue integrity and the proliferation of neural progenitors. Acts as a regulator of the unfolded protein response (UPR).

AlphaFold DB , UniProt , Accession A0A077Z3V8, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 77 aa.

						>A0A077Z3V8_TRITR|A0A077Z3V8
MALGLYTLFEAVLLFVNSLAVLNRERFLRKIGLVSEDNFGAAGSNTLANFIQSIQMVMRVPLIAVNSLVILMKLFIG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50.6	Low	74.1	Confident	247 Å²	247	108.4 Å²	108.4	100%	1.217	59%	0.587	S	S	*	*				0	82.8	0	-64.4	174.3	171.5	0	0	106.6
2	A	54.3	Low	75	Confident	94 Å²	94	106.5 Å²	106.5	78%	0.777	58%	0.582	S	S	*	*			trans	-116.9	33.3	-134.9	0	0	0	0	0	116.3
3	L	61.4	Low	75.6	Confident	124 Å²	124	105.9 Å²	105.9	65%	0.649	58%	0.577	S	S	*	*			trans	-108.4	54.2	172.2	-57.4	-178.9	0	0	0	111.2	L5 Y6 T7	L3-L5 PolarHBondContact O-N 3.2Å; L3-L5 VanDerWaalsContact O-N 3.14Å; L3-Y6 WeakPolarHBondContact O-CB 3Å; L3-Y6 PolarHBondContact O-N 3.37Å; L3-T7 PolarHBondContact O-N 3.36Å; L3-T7 PolarHBondContact O-OG1 2.98Å
4	G	74.8	Confident	75.8	Confident	41 Å²	41	100.4 Å²	100.4	42%	0.423	55%	0.546	S	S	.	.	H	α-helix	trans	-52.3	-29.8	166.4	0	0	0	0	0	112.1	T7 L8	G4-T7 WeakPolarHBondContact CA-OG1 3.2Å; G4-T7 PolarHBondContact O-OG1 2.97Å; G4-T7 VanDerWaalsContact O-OG1 3.09Å; G4-L8 WeakPolarHBondContact O-CB 3.31Å; G4-L8 WeakPolarHBondContact O-CD1 3.29Å; G4-L8 WeakPolarHBondContact O-CG 3.42Å; G4-L8 PolarHBondContact O-N 3.25Å
5	L	79.6	Confident	76.1	Confident	149 Å²	149	102.7 Å²	102.7	78%	0.78	55%	0.549	S	S	*	.	H	α-helix	trans	-66.8	-40.4	172.1	-61.9	178.5	0	0	0	113.1	L3 F9	L3-L5 PolarHBondContact O-N 3.2Å; L3-L5 VanDerWaalsContact O-N 3.14Å; L5-F9 WeakPolarHBondContact O-CB 3.04Å; L5-F9 PolarHBondContact O-N 3.49Å
6	Y	82.7	Confident	76.5	Confident	145 Å²	145	101.6 Å²	101.6	57%	0.569	55%	0.547	S	S	*	.	H	α-helix	trans	-69.4	-45	179	178.9	-94.2	0	0	0	111	L3 L8 F9 E10	L3-Y6 WeakPolarHBondContact O-CB 3Å; L3-Y6 PolarHBondContact O-N 3.37Å; Y6-L8 VanDerWaalsContact C-N 3.33Å; Y6-L8 PolarHBondContact O-N 3.04Å; Y6-F9 WeakPolarHBondContact O-CB 3.44Å; Y6-F9 PolarHBondContact O-N 3.26Å; Y6-F9 VanDerWaalsContact O-N 3.17Å; Y6-E10 PolarHBondContact O-N 2.75Å
7	T	80.6	Confident	76.8	Confident	52 Å²	52	100.2 Å²	100.2	32%	0.319	54%	0.54	S	S	.	.	H	α-helix	trans	-66.3	-35.4	177.5	57.1	0	0	0	0	112.3	L3 G4 E10 A11 L74	L3-T7 PolarHBondContact O-N 3.36Å; L3-T7 PolarHBondContact O-OG1 2.98Å; G4-T7 WeakPolarHBondContact CA-OG1 3.2Å; G4-T7 PolarHBondContact O-OG1 2.97Å; G4-T7 VanDerWaalsContact O-OG1 3.09Å; T7-E10 PolarHBondContact O-N 2.76Å; T7-A11 WeakPolarHBondContact O-CB 3.44Å; T7-A11 PolarHBondContact O-N 3.48Å; T7-L74 HydrophobicContact CG2-CD1 3.79Å
8	L	81.5	Confident	76.7	Confident	109 Å²	109	97.2 Å²	97.2	57%	0.571	53%	0.527	S	S	*	.	H	α-helix	trans	-63.5	-43.4	170.7	-77.8	171.5	0	0	0	111.5	G4 Y6 E10 A11 V12	G4-L8 WeakPolarHBondContact O-CB 3.31Å; G4-L8 WeakPolarHBondContact O-CD1 3.29Å; G4-L8 WeakPolarHBondContact O-CG 3.42Å; G4-L8 PolarHBondContact O-N 3.25Å; Y6-L8 VanDerWaalsContact C-N 3.33Å; Y6-L8 PolarHBondContact O-N 3.04Å; L8-E10 VanDerWaalsContact C-N 3.35Å; L8-A11 PolarHBondContact O-N 3.32Å; L8-V12 VanDerWaalsContact O-CG2 3.31Å; L8-V12 WeakPolarHBondContact O-CG2 3.28Å; L8-V12 PolarHBondContact O-N 2.93Å
9	F	84.2	Confident	76.6	Confident	131 Å²	131	96.1 Å²	96.1	58%	0.575	52%	0.521	S	S	*	.	H	α-helix	trans	-62.4	-43.2	176.9	-169.9	-104.8	0	0	0	111.6	L5 Y6 V12 L13	L5-F9 WeakPolarHBondContact O-CB 3.04Å; L5-F9 PolarHBondContact O-N 3.49Å; Y6-F9 WeakPolarHBondContact O-CB 3.44Å; Y6-F9 PolarHBondContact O-N 3.26Å; Y6-F9 VanDerWaalsContact O-N 3.17Å; F9-V12 PolarHBondContact O-N 3.38Å; F9-L13 HydrophobicContact CD1-CD1 3.76Å; F9-L13 HydrophobicContact CD1-CG 4.33Å; F9-L13 HydrophobicContact CE1-CD1 3.48Å; F9-L13 VanDerWaalsContact CE1-CD1 3.48Å; F9-L13 HydrophobicContact CE1-CG 4.1Å; F9-L13 HydrophobicContact CZ-CD1 4.2Å; F9-L13 HydrophobicContact CZ-CG 4.41Å; F9-L13 WeakPolarHBondContact O-CG 3.28Å; F9-L13 PolarHBondContact O-N 2.89Å
10	E	82	Confident	76.3	Confident	69 Å²	69	94.8 Å²	94.8	32%	0.322	52%	0.523	S	S	.	.	H	α-helix	trans	-59.8	-47.2	172.9	-170.8	174.4	172.4	0	0	111.2	Y6 T7 L8 V12 L13 L14	Y6-E10 PolarHBondContact O-N 2.75Å; T7-E10 PolarHBondContact O-N 2.76Å; L8-E10 VanDerWaalsContact C-N 3.35Å; E10-V12 VanDerWaalsContact C-N 3.35Å; E10-V12 PolarHBondContact O-N 3.12Å; E10-L13 PolarHBondContact O-N 2.88Å; E10-L14 HydrophobicContact CG-CD1 4.21Å; E10-L14 WeakPolarHBondContact O-CB 3.2Å; E10-L14 WeakPolarHBondContact O-CG 3.22Å; E10-L14 PolarHBondContact O-N 3.26Å
11	A	83.3	Confident	75.9	Confident	31 Å²	31	92.7 Å²	92.7	26%	0.256	51%	0.513	S	S	.	.	H	α-helix	trans	-60.6	-39.8	176.9	0	0	0	0	0	113	T7 L8 L14 F15	T7-A11 WeakPolarHBondContact O-CB 3.44Å; T7-A11 PolarHBondContact O-N 3.48Å; L8-A11 PolarHBondContact O-N 3.32Å; A11-L14 PolarHBondContact O-N 3.35Å; A11-F15 WeakPolarHBondContact O-CB 3.17Å; A11-F15 PolarHBondContact O-N 3.48Å
12	V	84.9	Confident	76.9	Confident	86 Å²	86	84 Å²	84	52%	0.521	47%	0.471	S	S	.	.	H	α-helix	trans	-66.3	-45.2	175.6	171	0	0	0	0	110.8	L8 F9 E10 L14 F15 V16	L8-V12 VanDerWaalsContact O-CG2 3.31Å; L8-V12 WeakPolarHBondContact O-CG2 3.28Å; L8-V12 PolarHBondContact O-N 2.93Å; F9-V12 PolarHBondContact O-N 3.38Å; E10-V12 VanDerWaalsContact C-N 3.35Å; E10-V12 PolarHBondContact O-N 3.12Å; V12-L14 VanDerWaalsContact C-N 3.28Å; V12-L14 PolarHBondContact O-N 2.9Å; V12-F15 PolarHBondContact O-N 3.49Å; V12-V16 WeakPolarHBondContact O-CG2 3.21Å; V12-V16 PolarHBondContact O-N 3.28Å
13	L	82.4	Confident	77.1	Confident	99 Å²	99	82.7 Å²	82.7	52%	0.518	45%	0.451	S	S	.	.	H	α-helix	trans	-59.3	-40.1	174.9	-75.1	175.9	0	0	0	111.7	F9 E10 V16 N17	F9-L13 HydrophobicContact CD1-CD1 3.76Å; F9-L13 HydrophobicContact CD1-CG 4.33Å; F9-L13 HydrophobicContact CE1-CD1 3.48Å; F9-L13 VanDerWaalsContact CE1-CD1 3.48Å; F9-L13 HydrophobicContact CE1-CG 4.1Å; F9-L13 HydrophobicContact CZ-CD1 4.2Å; F9-L13 HydrophobicContact CZ-CG 4.41Å; F9-L13 WeakPolarHBondContact O-CG 3.28Å; F9-L13 PolarHBondContact O-N 2.89Å; E10-L13 PolarHBondContact O-N 2.88Å; L13-V16 PolarHBondContact O-N 2.88Å; L13-N17 WeakPolarHBondContact O-CB 3.19Å; L13-N17 PolarHBondContact O-N 2.7Å
14	L	78.5	Confident	77	Confident	28 Å²	28	85.5 Å²	85.5	15%	0.147	45%	0.453	C	S	.	.	H	α-helix	trans	-66.7	-42.5	175.5	-68.2	170	0	0	0	112.2	E10 A11 V12 V16 N17 S18 I70	E10-L14 HydrophobicContact CG-CD1 4.21Å; E10-L14 WeakPolarHBondContact O-CB 3.2Å; E10-L14 WeakPolarHBondContact O-CG 3.22Å; E10-L14 PolarHBondContact O-N 3.26Å; A11-L14 PolarHBondContact O-N 3.35Å; V12-L14 VanDerWaalsContact C-N 3.28Å; V12-L14 PolarHBondContact O-N 2.9Å; L14-V16 VanDerWaalsContact C-N 3.33Å; L14-V16 PolarHBondContact O-N 3.5Å; L14-N17 PolarHBondContact O-N 3.43Å; L14-S18 WeakPolarHBondContact O-CB 3.41Å; L14-S18 PolarHBondContact O-N 2.97Å; L14-S18 PolarHBondContact O-OG 3.06Å; L14-I70 HydrophobicContact CD1-CB 4.43Å; L14-I70 HydrophobicContact CD1-CG2 3.7Å; L14-I70 HydrophobicContact CD2-CD1 4.25Å; L14-I70 HydrophobicContact CD2-CG2 4.39Å
15	F	80.6	Confident	76.2	Confident	135 Å²	135	89.1 Å²	89.1	59%	0.592	46%	0.459	S	S	*	.	H	α-helix	trans	-61.7	-44.1	176.1	-170.6	-102.9	0	0	0	110.8	A11 V12 S18 L19	A11-F15 WeakPolarHBondContact O-CB 3.17Å; A11-F15 PolarHBondContact O-N 3.48Å; V12-F15 PolarHBondContact O-N 3.49Å; F15-S18 PolarHBondContact O-N 3.46Å; F15-S18 PolarHBondContact O-OG 2.86Å; F15-L19 HydrophobicContact CE1-CD2 4.3Å; F15-L19 VanDerWaalsContact O-CB 3.22Å; F15-L19 WeakPolarHBondContact O-CB 3.36Å; F15-L19 PolarHBondContact O-N 3.49Å
16	V	82.1	Confident	75.2	Confident	85 Å²	85	89.2 Å²	89.2	52%	0.515	45%	0.449	S	S	.	.	H	α-helix	trans	-63.8	-44.2	175.4	174	0	0	0	0	111.3	V12 L13 L14 S18 L19 A20	V12-V16 WeakPolarHBondContact O-CG2 3.21Å; V12-V16 PolarHBondContact O-N 3.28Å; L13-V16 PolarHBondContact O-N 2.88Å; L14-V16 VanDerWaalsContact C-N 3.33Å; L14-V16 PolarHBondContact O-N 3.5Å; V16-S18 PolarHBondContact O-N 3.37Å; V16-L19 PolarHBondContact O-N 2.83Å; V16-A20 WeakPolarHBondContact O-CB 3.03Å; V16-A20 PolarHBondContact O-N 2.87Å
17	N	82.1	Confident	74.1	Confident	79 Å²	79	85.8 Å²	85.8	42%	0.422	44%	0.437	S	S	.	.	H	α-helix	trans	-61	-45.2	177.4	-174.1	39	0	0	0	111.9	L13 L14 V21	L13-N17 WeakPolarHBondContact O-CB 3.19Å; L13-N17 PolarHBondContact O-N 2.7Å; L14-N17 PolarHBondContact O-N 3.43Å; N17-V21 WeakPolarHBondContact O-CG2 3.12Å; N17-V21 PolarHBondContact O-N 3.34Å
18	S	75.4	Confident	72.8	Confident	45 Å²	45	86.7 Å²	86.7	32%	0.315	44%	0.439	S	S	.	.	H	α-helix	trans	-66.8	-41	177.2	67.7	0	0	0	0	112.8	L14 F15 V16 V21 L22	L14-S18 WeakPolarHBondContact O-CB 3.41Å; L14-S18 PolarHBondContact O-N 2.97Å; L14-S18 PolarHBondContact O-OG 3.06Å; F15-S18 PolarHBondContact O-N 3.46Å; F15-S18 PolarHBondContact O-OG 2.86Å; V16-S18 PolarHBondContact O-N 3.37Å; S18-V21 PolarHBondContact O-N 3.27Å; S18-L22 WeakPolarHBondContact O-CB 2.78Å; S18-L22 PolarHBondContact O-N 3.13Å
19	L	74.1	Confident	71.4	Confident	77 Å²	77	89.9 Å²	89.9	40%	0.403	44%	0.444	S	S	.	.	H	α-helix	trans	-67.5	-41.2	178.9	-167.3	69.6	0	0	0	111.4	F15 V16 V21 L22 N23	F15-L19 HydrophobicContact CE1-CD2 4.3Å; F15-L19 VanDerWaalsContact O-CB 3.22Å; F15-L19 WeakPolarHBondContact O-CB 3.36Å; F15-L19 PolarHBondContact O-N 3.49Å; V16-L19 PolarHBondContact O-N 2.83Å; L19-V21 VanDerWaalsContact C-N 3.27Å; L19-V21 PolarHBondContact O-N 2.89Å; L19-L22 PolarHBondContact O-N 3.04Å; L19-N23 WeakPolarHBondContact O-CB 2.8Å; L19-N23 PolarHBondContact O-N 3.46Å
20	A	71.7	Confident	70.4	Confident	69 Å²	69	91.8 Å²	91.8	57%	0.57	45%	0.452	S	S	*	.	H	α-helix	trans	-59.5	-37.6	176.2	0	0	0	0	0	112.2	V16	V16-A20 WeakPolarHBondContact O-CB 3.03Å; V16-A20 PolarHBondContact O-N 2.87Å
21	V	68.1	Low	69.4	Low	51 Å²	51	93.8 Å²	93.8	31%	0.309	46%	0.464	S	S	.	.	H	α-helix	trans	-82.1	-37.8	-179.3	173	0	0	0	0	112.4	N17 S18 L19 N23 I63	N17-V21 WeakPolarHBondContact O-CG2 3.12Å; N17-V21 PolarHBondContact O-N 3.34Å; S18-V21 PolarHBondContact O-N 3.27Å; L19-V21 VanDerWaalsContact C-N 3.27Å; L19-V21 PolarHBondContact O-N 2.89Å; V21-N23 VanDerWaalsContact C-N 3.33Å; V21-N23 PolarHBondContact O-N 3.46Å; V21-I63 HydrophobicContact CG1-CD1 4.05Å; V21-I63 HydrophobicContact CG2-CD1 3.94Å; V21-I63 HydrophobicContact CG2-CG2 4.43Å
22	L	71.2	Confident	68.1	Low	65 Å²	65	95.1 Å²	95.1	34%	0.34	48%	0.481	S	S	.	.	H	α-helix	trans	-68	-34	177.9	-172.8	66	0	0	0	112	S18 L19 F27	S18-L22 WeakPolarHBondContact O-CB 2.78Å; S18-L22 PolarHBondContact O-N 3.13Å; L19-L22 PolarHBondContact O-N 3.04Å; L22-F27 HydrophobicContact CD2-CE2 3.78Å; L22-F27 HydrophobicContact CD2-CZ 4.49Å; L22-F27 HydrophobicContact CG-CD2 4.28Å; L22-F27 HydrophobicContact CG-CE2 3.75Å
23	N	58.6	Low	66.5	Low	67 Å²	67	97.8 Å²	97.8	36%	0.358	49%	0.491	S	S	.	.	T	Hydrogen-bonded Turn	trans	-102.8	38.2	-159.6	-162.1	20.6	0	0	0	117	L19 V21 F27	L19-N23 WeakPolarHBondContact O-CB 2.8Å; L19-N23 PolarHBondContact O-N 3.46Å; V21-N23 VanDerWaalsContact C-N 3.33Å; V21-N23 PolarHBondContact O-N 3.46Å; N23-F27 HydrophobicContact CB-CD2 3.82Å; N23-F27 HydrophobicContact CB-CE2 4.02Å; N23-F27 HydrophobicContact CB-CG 4.4Å; N23-F27 WeakPolarHBondContact OD1-CB 3.15Å; N23-F27 WeakPolarHBondContact OD1-CD1 3.33Å; N23-F27 WeakPolarHBondContact OD1-CD2 3.45Å; N23-F27 WeakPolarHBondContact OD1-CG 3.32Å
24	R	58.7	Low	65.2	Low	182 Å²	182	98.2 Å²	98.2	69%	0.687	50%	0.498	S	S	*	.	T	Hydrogen-bonded Turn	trans	-116.7	-68.4	155.7	-79.4	-174.6	-173.2	-96.1	0.7	111.7	L28	R24-L28 HydrophobicContact CB-CD2 4.24Å; R24-L28 HydrophobicContact CG-CD2 4.45Å; R24-L28 WeakPolarHBondContact O-CA 3.29Å; R24-L28 WeakPolarHBondContact O-CB 3.33Å; R24-L28 WeakPolarHBondContact O-CD1 3.15Å; R24-L28 VanDerWaalsContact O-CG 3.31Å; R24-L28 WeakPolarHBondContact O-CG 3.49Å; R24-L28 PolarHBondContact O-N 3.2Å
25	E	57.4	Low	63.9	Low	117 Å²	117	101 Å²	101	55%	0.547	52%	0.519	S	S	.	.	H	α-helix	trans	-79.5	-36.3	-162.6	-62.7	163.9	167.5	0	0	113.9	R29 M56	E25-R29 WeakPolarHBondContact O-CB 3.22Å; E25-R29 PolarHBondContact O-N 3.14Å; E25-M56 HydrophobicContact CB-CE 3.2Å; E25-M56 HydrophobicContact CB-SD 4.15Å; E25-M56 HydrophobicContact CG-CE 4.14Å; E25-M56 WeakPolarHBondContact OE2-CE 3.42Å; E25-M56 WeakPolarHBondContact OE2-CG 3.47Å
26	R	59.9	Low	62.5	Low	152 Å²	152	103.4 Å²	103.4	57%	0.574	53%	0.533	S	S	*	.	H	α-helix	trans	-71.8	-41.3	175	-179.1	177.6	173.2	-121.3	2.5	112.2	K30	R26-K30 VanDerWaalsContact O-CB 3.32Å; R26-K30 WeakPolarHBondContact O-CB 3.32Å; R26-K30 PolarHBondContact O-N 2.94Å
27	F	58.2	Low	60.9	Low	73 Å²	73	105.5 Å²	105.5	32%	0.32	54%	0.541	S	S	.	.	H	α-helix	trans	-75.3	-41.4	179.4	-84	-93.8	0	0	0	112.1	L22 N23 R29 K30 I31	L22-F27 HydrophobicContact CD2-CE2 3.78Å; L22-F27 HydrophobicContact CD2-CZ 4.49Å; L22-F27 HydrophobicContact CG-CD2 4.28Å; L22-F27 HydrophobicContact CG-CE2 3.75Å; N23-F27 HydrophobicContact CB-CD2 3.82Å; N23-F27 HydrophobicContact CB-CE2 4.02Å; N23-F27 HydrophobicContact CB-CG 4.4Å; N23-F27 WeakPolarHBondContact OD1-CB 3.15Å; N23-F27 WeakPolarHBondContact OD1-CD1 3.33Å; N23-F27 WeakPolarHBondContact OD1-CD2 3.45Å; N23-F27 WeakPolarHBondContact OD1-CG 3.32Å; F27-R29 VanDerWaalsContact C-N 3.32Å; F27-R29 PolarHBondContact O-N 2.89Å; F27-K30 CarbonylContact O-C 3.52Å; F27-K30 PolarHBondContact O-N 3.25Å; F27-K30 VanDerWaalsContact O-N 3.12Å; F27-I31 WeakPolarHBondContact O-CB 3.42Å; F27-I31 WeakPolarHBondContact O-CD1 3.37Å; F27-I31 WeakPolarHBondContact O-CG1 3.21Å; F27-I31 PolarHBondContact O-N 3.46Å
28	L	53.8	Low	59.3	Low	70 Å²	70	109.5 Å²	109.5	37%	0.366	56%	0.562	S	S	.	*	H	α-helix	trans	-64	-38.8	173	-80.1	39	0	0	0	110.7	R24 K30 I31 G32	R24-L28 HydrophobicContact CB-CD2 4.24Å; R24-L28 HydrophobicContact CG-CD2 4.45Å; R24-L28 WeakPolarHBondContact O-CA 3.29Å; R24-L28 WeakPolarHBondContact O-CB 3.33Å; R24-L28 WeakPolarHBondContact O-CD1 3.15Å; R24-L28 VanDerWaalsContact O-CG 3.31Å; R24-L28 WeakPolarHBondContact O-CG 3.49Å; R24-L28 PolarHBondContact O-N 3.2Å; L28-K30 VanDerWaalsContact C-N 3.32Å; L28-K30 PolarHBondContact O-N 3.49Å; L28-I31 PolarHBondContact O-N 3.37Å; L28-G32 PolarHBondContact O-N 3.37Å
29	R	53.1	Low	57.9	Low	176 Å²	176	118 Å²	118	66%	0.664	59%	0.594	S	S	*	*	H	α-helix	trans	-64.7	-36.7	172.3	-166.3	174.9	79.1	-154.4	7.6	112	E25 F27 G32	E25-R29 WeakPolarHBondContact O-CB 3.22Å; E25-R29 PolarHBondContact O-N 3.14Å; F27-R29 VanDerWaalsContact C-N 3.32Å; F27-R29 PolarHBondContact O-N 2.89Å; R29-G32 PolarHBondContact O-N 2.86Å
30	K	62.2	Low	56.5	Low	172 Å²	172	117.8 Å²	117.8	75%	0.748	61%	0.611	S	S	*	*	H	α-helix	trans	-72.9	-30.4	175.2	-172.2	169.5	-171.6	-69.2	0	113.3	R26 F27 L28 G32	R26-K30 VanDerWaalsContact O-CB 3.32Å; R26-K30 WeakPolarHBondContact O-CB 3.32Å; R26-K30 PolarHBondContact O-N 2.94Å; F27-K30 CarbonylContact O-C 3.52Å; F27-K30 PolarHBondContact O-N 3.25Å; F27-K30 VanDerWaalsContact O-N 3.12Å; L28-K30 VanDerWaalsContact C-N 3.32Å; L28-K30 PolarHBondContact O-N 3.49Å; K30-G32 PolarHBondContact O-N 3.31Å
31	I	61.3	Low	55.5	Low	111 Å²	111	118.2 Å²	118.2	57%	0.569	61%	0.614	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.4	-8.9	173.6	-67.9	161	0	0	0	110.4	F27 L28 L33	F27-I31 WeakPolarHBondContact O-CB 3.42Å; F27-I31 WeakPolarHBondContact O-CD1 3.37Å; F27-I31 WeakPolarHBondContact O-CG1 3.21Å; F27-I31 PolarHBondContact O-N 3.46Å; L28-I31 PolarHBondContact O-N 3.37Å; I31-L33 HydrophobicContact CG2-CB 4.33Å; I31-L33 PolarHBondContact O-N 2.9Å
32	G	54.9	Low	54.7	Low	59 Å²	59	121.2 Å²	121.2	61%	0.608	64%	0.644	S	S	*	*	T	Hydrogen-bonded Turn	trans	65.8	13.9	167	0	0	0	0	0	114	L28 R29 K30	L28-G32 PolarHBondContact O-N 3.37Å; R29-G32 PolarHBondContact O-N 2.86Å; K30-G32 PolarHBondContact O-N 3.31Å
33	L	52.1	Low	53.9	Low	142 Å²	142	121.1 Å²	121.1	74%	0.743	66%	0.659	S	S	*	*			trans	-95.5	-3.9	-177.5	-143.4	113	0	0	0	113	I31 S35	I31-L33 HydrophobicContact CG2-CB 4.33Å; I31-L33 PolarHBondContact O-N 2.9Å; L33-S35 VanDerWaalsContact C-N 3.27Å; L33-S35 PolarHBondContact O-N 3.49Å
34	V	55.9	Low	53.8	Low	108 Å²	108	122.4 Å²	122.4	66%	0.655	67%	0.673	S	S	*	*	S	Bend	trans	-87.4	83.5	165.8	-178.1	0	0	0	0	106.2	E36	V34-E36 PolarHBondContact O-N 3.38Å
35	S	50	Low	53.9	Low	86 Å²	86	118 Å²	118	60%	0.601	66%	0.663	S	S	*	*			trans	-51.1	127.3	177.3	-53.2	0	0	0	0	110.7	L33 D37	L33-S35 VanDerWaalsContact C-N 3.27Å; L33-S35 PolarHBondContact O-N 3.49Å; S35-D37 PolarHBondContact O-N 3.49Å
36	E	52.5	Low	54.3	Low	186 Å²	186	117 Å²	117	87%	0.869	67%	0.665	S	S	*	*			trans	-79	46.6	177.8	-140.6	141.9	89.3	0	0	110.4	V34	V34-E36 PolarHBondContact O-N 3.38Å
37	D	48.5	Very low	54.9	Low	129 Å²	129	115.9 Å²	115.9	69%	0.69	67%	0.67	S	S	*	*			trans	-108.9	99.6	-179	-71.2	-40	0	0	0	108.8	S35	S35-D37 PolarHBondContact O-N 3.49Å
38	N	47.3	Very low	55.4	Low	162 Å²	162	114.5 Å²	114.5	87%	0.866	67%	0.672	S	S	*	*			trans	163.1	62.5	140.2	-82.1	-63.9	0	0	0	109.2	G40	N38-G40 VanDerWaalsContact C-N 3.29Å; N38-G40 PolarHBondContact O-N 3.48Å
39	F	46.8	Very low	56.1	Low	224 Å²	224	115.5 Å²	115.5	98%	0.982	68%	0.678	S	S	*	*			trans	-70	79	170.6	-157	-94.5	0	0	0	109.2
40	G	45.2	Very low	57.1	Low	73 Å²	73	113.6 Å²	113.6	75%	0.753	68%	0.675	S	S	*	*			trans	-159	33.6	-168	0	0	0	0	0	117.8	N38	N38-G40 VanDerWaalsContact C-N 3.29Å; N38-G40 PolarHBondContact O-N 3.48Å
41	A	49.3	Very low	57.7	Low	78 Å²	78	109.9 Å²	109.9	65%	0.645	66%	0.662	S	S	*	*			trans	-156.6	85.5	162	0	0	0	0	0	110.5	G43	A41-G43 PolarHBondContact O-N 2.91Å
42	A	51.3	Low	58	Low	114 Å²	114	110.4 Å²	110.4	94%	0.942	66%	0.662	S	S	*	*			trans	-67.4	124.2	175.8	0	0	0	0	0	110.8
43	G	54.5	Low	58.8	Low	63 Å²	63	110.7 Å²	110.7	65%	0.649	65%	0.654	S	S	*	*	S	Bend	trans	150	-64	161	0	0	0	0	0	115	A41	A41-G43 PolarHBondContact O-N 2.91Å
44	S	57.4	Low	59.6	Low	93 Å²	93	107.7 Å²	107.7	65%	0.65	64%	0.639	S	S	*	*	S	Bend	trans	-101.7	-21.4	-166.7	51.6	0	0	0	0	115.2
45	N	60.5	Low	60.3	Low	89 Å²	89	108.6 Å²	108.6	48%	0.476	64%	0.635	S	S	.	*	H	α-helix	trans	-89.9	-9.8	-166.8	-65.6	19	0	0	0	113.5	A48 N49	N45-A48 PolarHBondContact O-N 3.45Å; N45-N49 VanDerWaalsContact O-CB 3.29Å; N45-N49 WeakPolarHBondContact O-CB 3.3Å; N45-N49 PolarHBondContact O-N 2.88Å; N45-N49 PolarHBondContact O-OD1 3.33Å
46	T	66	Low	61	Low	96 Å²	96	107.4 Å²	107.4	59%	0.589	62%	0.621	S	S	*	*	H	α-helix	trans	-68.5	-43.3	-178.4	53.9	0	0	0	0	111.8	N49 F50	T46-N49 PolarHBondContact O-N 3.39Å; T46-F50 WeakPolarHBondContact O-CB 2.74Å; T46-F50 PolarHBondContact O-N 3.01Å
47	L	71.7	Confident	61.8	Low	129 Å²	129	103.2 Å²	103.2	68%	0.675	61%	0.608	S	S	*	*	H	α-helix	trans	-64.8	-42.4	176.8	-63.7	-179.7	0	0	0	111.2	F50 I51	L47-F50 PolarHBondContact O-N 3.44Å; L47-I51 VanDerWaalsContact O-CG1 3.28Å; L47-I51 WeakPolarHBondContact O-CG1 3.37Å; L47-I51 PolarHBondContact O-N 2.88Å
48	A	68.9	Low	62.7	Low	45 Å²	45	102.7 Å²	102.7	37%	0.372	60%	0.603	S	S	.	*	H	α-helix	trans	-63.2	-47	176.5	0	0	0	0	0	111.5	N45 F50 I51 Q52	N45-A48 PolarHBondContact O-N 3.45Å; A48-F50 VanDerWaalsContact C-N 3.27Å; A48-F50 PolarHBondContact O-N 3.34Å; A48-I51 PolarHBondContact O-N 3.39Å; A48-Q52 WeakPolarHBondContact O-CB 3.27Å; A48-Q52 VanDerWaalsContact O-CG 3.28Å; A48-Q52 WeakPolarHBondContact O-CG 3.47Å; A48-Q52 PolarHBondContact O-N 3.4Å
49	N	69.4	Low	63.8	Low	90 Å²	90	104.1 Å²	104.1	48%	0.481	60%	0.596	S	S	.	*	H	α-helix	trans	-63.2	-33.5	175.3	-72.5	0.4	0	0	0	112	N45 T46 S53	N45-N49 VanDerWaalsContact O-CB 3.29Å; N45-N49 WeakPolarHBondContact O-CB 3.3Å; N45-N49 PolarHBondContact O-N 2.88Å; N45-N49 PolarHBondContact O-OD1 3.33Å; T46-N49 PolarHBondContact O-N 3.39Å; N49-S53 VanDerWaalsContact O-CB 3.22Å; N49-S53 WeakPolarHBondContact O-CB 3.2Å; N49-S53 PolarHBondContact O-N 3.2Å; N49-S53 PolarHBondContact O-OG 3.46Å
50	F	73.5	Confident	64.8	Low	137 Å²	137	96.1 Å²	96.1	60%	0.601	57%	0.566	S	S	*	*	H	α-helix	trans	-69.8	-46.1	177.1	-165.4	-110.9	0	0	0	111.2	T46 L47 A48 Q52 S53 I54	T46-F50 WeakPolarHBondContact O-CB 2.74Å; T46-F50 PolarHBondContact O-N 3.01Å; L47-F50 PolarHBondContact O-N 3.44Å; A48-F50 VanDerWaalsContact C-N 3.27Å; A48-F50 PolarHBondContact O-N 3.34Å; F50-Q52 PolarHBondContact O-N 2.89Å; F50-S53 WeakPolarHBondContact O-CB 3.36Å; F50-S53 PolarHBondContact O-N 2.87Å; F50-I54 HydrophobicContact CD1-CD1 3.55Å; F50-I54 HydrophobicContact CE1-CD1 3.4Å; F50-I54 HydrophobicContact CE1-CG1 4.42Å; F50-I54 HydrophobicContact CG-CD1 4.3Å; F50-I54 HydrophobicContact CZ-CD1 4.01Å; F50-I54 VanDerWaalsContact O-CG1 3.29Å; F50-I54 WeakPolarHBondContact O-CG1 3.43Å; F50-I54 PolarHBondContact O-N 2.95Å
51	I	73.8	Confident	66	Low	93 Å²	93	95.2 Å²	95.2	48%	0.477	55%	0.547	S	S	.	.	H	α-helix	trans	-61.5	-45	174.6	-67.2	164.4	0	0	0	110.5	L47 A48 S53 I54 Q55	L47-I51 VanDerWaalsContact O-CG1 3.28Å; L47-I51 WeakPolarHBondContact O-CG1 3.37Å; L47-I51 PolarHBondContact O-N 2.88Å; A48-I51 PolarHBondContact O-N 3.39Å; I51-S53 PolarHBondContact O-N 2.88Å; I51-I54 PolarHBondContact O-N 3.39Å; I51-Q55 HydrophobicContact CG2-CG 4.34Å; I51-Q55 WeakPolarHBondContact O-CB 3.44Å; I51-Q55 WeakPolarHBondContact O-CG 3.48Å; I51-Q55 PolarHBondContact O-N 3.21Å
52	Q	68.1	Low	67.2	Low	122 Å²	122	97.1 Å²	97.1	57%	0.57	55%	0.545	S	S	*	.	H	α-helix	trans	-61.3	-43.9	176.2	-74.2	178.2	8	0	0	111.5	A48 F50 I54 Q55 M56	A48-Q52 WeakPolarHBondContact O-CB 3.27Å; A48-Q52 VanDerWaalsContact O-CG 3.28Å; A48-Q52 WeakPolarHBondContact O-CG 3.47Å; A48-Q52 PolarHBondContact O-N 3.4Å; F50-Q52 PolarHBondContact O-N 2.89Å; Q52-I54 PolarHBondContact O-N 3.24Å; Q52-Q55 PolarHBondContact O-N 3.23Å; Q52-M56 WeakPolarHBondContact O-CB 3.4Å; Q52-M56 PolarHBondContact O-N 2.86Å
53	S	71.8	Confident	68	Low	65 Å²	65	93.9 Å²	93.9	46%	0.455	51%	0.512	S	S	.	.	H	α-helix	trans	-60.1	-43.4	175.6	-64.3	0	0	0	0	111.9	N49 F50 I51 V57	N49-S53 VanDerWaalsContact O-CB 3.22Å; N49-S53 WeakPolarHBondContact O-CB 3.2Å; N49-S53 PolarHBondContact O-N 3.2Å; N49-S53 PolarHBondContact O-OG 3.46Å; F50-S53 WeakPolarHBondContact O-CB 3.36Å; F50-S53 PolarHBondContact O-N 2.87Å; I51-S53 PolarHBondContact O-N 2.88Å; S53-V57 WeakPolarHBondContact O-CB 3.31Å; S53-V57 WeakPolarHBondContact O-CG2 3.25Å; S53-V57 PolarHBondContact O-N 3.22Å
54	I	69.6	Low	69.1	Low	80 Å²	80	93.2 Å²	93.2	41%	0.41	50%	0.5	S	S	.	.	H	α-helix	trans	-66.3	-46	177.4	-68.4	165.5	0	0	0	110.9	F50 I51 Q52 M56 V57 M58	F50-I54 HydrophobicContact CD1-CD1 3.55Å; F50-I54 HydrophobicContact CE1-CD1 3.4Å; F50-I54 HydrophobicContact CE1-CG1 4.42Å; F50-I54 HydrophobicContact CG-CD1 4.3Å; F50-I54 HydrophobicContact CZ-CD1 4.01Å; F50-I54 VanDerWaalsContact O-CG1 3.29Å; F50-I54 WeakPolarHBondContact O-CG1 3.43Å; F50-I54 PolarHBondContact O-N 2.95Å; I51-I54 PolarHBondContact O-N 3.39Å; Q52-I54 PolarHBondContact O-N 3.24Å; I54-M56 VanDerWaalsContact C-N 3.34Å; I54-M56 PolarHBondContact O-N 2.75Å; I54-V57 CarbonylContact O-C 3.55Å; I54-V57 WeakPolarHBondContact O-CB 3.41Å; I54-V57 PolarHBondContact O-N 2.87Å; I54-V57 VanDerWaalsContact O-N 3.13Å; I54-M58 HydrophobicContact CG2-CG 4.25Å; I54-M58 VanDerWaalsContact O-CG 3.32Å; I54-M58 WeakPolarHBondContact O-CG 3.45Å; I54-M58 PolarHBondContact O-N 3.49Å
55	Q	69.5	Low	70.2	Confident	126 Å²	126	92.7 Å²	92.7	59%	0.589	49%	0.493	S	S	*	.	H	α-helix	trans	-63.7	-40.9	-179.6	-74.6	179.9	-8.7	0	0	112.1	I51 Q52 V57 M58 R59	I51-Q55 HydrophobicContact CG2-CG 4.34Å; I51-Q55 WeakPolarHBondContact O-CB 3.44Å; I51-Q55 WeakPolarHBondContact O-CG 3.48Å; I51-Q55 PolarHBondContact O-N 3.21Å; Q52-Q55 PolarHBondContact O-N 3.23Å; Q55-V57 VanDerWaalsContact C-N 3.29Å; Q55-V57 PolarHBondContact O-N 3.36Å; Q55-M58 PolarHBondContact O-N 3.07Å; Q55-R59 PolarHBondContact O-N 3.12Å; Q55-R59 VanDerWaalsContact O-N 3.14Å
56	M	66.3	Low	71.1	Confident	61 Å²	61	93 Å²	93	30%	0.3	49%	0.494	S	S	.	.	H	α-helix	trans	-59.5	-42.5	173	-177.6	-175	152.9	0	0	111	E25 Q52 I54	E25-M56 HydrophobicContact CB-CE 3.2Å; E25-M56 HydrophobicContact CB-SD 4.15Å; E25-M56 HydrophobicContact CG-CE 4.14Å; E25-M56 WeakPolarHBondContact OE2-CE 3.42Å; E25-M56 WeakPolarHBondContact OE2-CG 3.47Å; Q52-M56 WeakPolarHBondContact O-CB 3.4Å; Q52-M56 PolarHBondContact O-N 2.86Å; I54-M56 VanDerWaalsContact C-N 3.34Å; I54-M56 PolarHBondContact O-N 2.75Å
57	V	68.1	Low	71.7	Confident	99 Å²	99	89 Å²	89	60%	0.6	47%	0.471	S	S	*	.	H	α-helix	trans	-68.1	-31.4	176.3	169.4	0	0	0	0	112.6	S53 I54 Q55 P61	S53-V57 WeakPolarHBondContact O-CB 3.31Å; S53-V57 WeakPolarHBondContact O-CG2 3.25Å; S53-V57 PolarHBondContact O-N 3.22Å; I54-V57 CarbonylContact O-C 3.55Å; I54-V57 WeakPolarHBondContact O-CB 3.41Å; I54-V57 PolarHBondContact O-N 2.87Å; I54-V57 VanDerWaalsContact O-N 3.13Å; Q55-V57 VanDerWaalsContact C-N 3.29Å; Q55-V57 PolarHBondContact O-N 3.36Å; V57-P61 WeakPolarHBondContact O-CD 3.45Å; V57-P61 WeakPolarHBondContact O-CG 3.34Å
58	M	68.1	Low	72.2	Confident	118 Å²	118	87.4 Å²	87.4	58%	0.581	46%	0.462	S	S	*	.	H	α-helix	trans	-81.6	-24.2	-178.5	-70.7	-64.3	-69	0	0	113.9	I54 Q55 P61	I54-M58 HydrophobicContact CG2-CG 4.25Å; I54-M58 VanDerWaalsContact O-CG 3.32Å; I54-M58 WeakPolarHBondContact O-CG 3.45Å; I54-M58 PolarHBondContact O-N 3.49Å; Q55-M58 PolarHBondContact O-N 3.07Å; M58-P61 VanDerWaalsContact C-CD 3.5Å; M58-P61 WeakPolarHBondContact O-CD 3.42Å; M58-P61 VanDerWaalsContact O-CG 3.3Å; M58-P61 WeakPolarHBondContact O-CG 3.48Å
59	R	69.4	Low	72.8	Confident	191 Å²	191	88.7 Å²	88.7	72%	0.721	47%	0.465	S	S	*	.	H	α-helix	trans	-74.1	-40.9	-179.2	-167.7	178	-130.1	-173.8	2.8	113.1	Q55 L62 I63	Q55-R59 PolarHBondContact O-N 3.12Å; Q55-R59 VanDerWaalsContact O-N 3.14Å; R59-L62 PolarHBondContact O-N 3.41Å; R59-I63 PolarHBondContact O-N 2.89Å
60	V	68.8	Low	73.1	Confident	57 Å²	57	87.1 Å²	87.1	35%	0.345	46%	0.456	S	S	.	.	H	α-helix	trans	-59.3	-48.9	178.3	179.7	0	0	0	0	113.2	L62 A64	V60-L62 VanDerWaalsContact C-N 3.33Å; V60-L62 PolarHBondContact O-N 2.75Å; V60-A64 VanDerWaalsContact O-CB 3.27Å; V60-A64 WeakPolarHBondContact O-CB 3.13Å; V60-A64 PolarHBondContact O-N 3.17Å
61	P	69.7	Low	73.3	Confident	54 Å²	54	84.1 Å²	84.1	35%	0.351	45%	0.446	S	S	.	.	H	α-helix	trans	-67.8	-32.6	178.9	26.2	-34.4	0	0	0	111.5	V57 M58 I63 A64 V65	V57-P61 WeakPolarHBondContact O-CD 3.45Å; V57-P61 WeakPolarHBondContact O-CG 3.34Å; M58-P61 VanDerWaalsContact C-CD 3.5Å; M58-P61 WeakPolarHBondContact O-CD 3.42Å; M58-P61 VanDerWaalsContact O-CG 3.3Å; M58-P61 WeakPolarHBondContact O-CG 3.48Å; P61-I63 PolarHBondContact O-N 3.46Å; P61-A64 PolarHBondContact O-N 3.47Å; P61-V65 WeakPolarHBondContact O-CB 3.5Å; P61-V65 WeakPolarHBondContact O-CG2 3.18Å; P61-V65 PolarHBondContact O-N 3.28Å
62	L	73.7	Confident	73.5	Confident	117 Å²	117	84.6 Å²	84.6	61%	0.613	45%	0.447	S	S	*	.	H	α-helix	trans	-63.5	-43.4	-179.4	-147.4	76.3	0	0	0	111.8	R59 V60 N66	R59-L62 PolarHBondContact O-N 3.41Å; V60-L62 VanDerWaalsContact C-N 3.33Å; V60-L62 PolarHBondContact O-N 2.75Å; L62-N66 WeakPolarHBondContact O-CB 3.38Å; L62-N66 PolarHBondContact O-N 2.8Å; L62-N66 VanDerWaalsContact O-N 3.07Å; L62-N66 PolarHBondContact O-ND2 3.14Å; L62-N66 PolarHBondContact O-OD1 2.99Å
63	I	70.1	Confident	74.1	Confident	46 Å²	46	86 Å²	86	24%	0.236	45%	0.452	C	S	.	.	H	α-helix	trans	-74.5	-36.7	176.5	-60.9	170.5	0	0	0	111.2	V21 R59 P61 N66 S67	V21-I63 HydrophobicContact CG1-CD1 4.05Å; V21-I63 HydrophobicContact CG2-CD1 3.94Å; V21-I63 HydrophobicContact CG2-CG2 4.43Å; R59-I63 PolarHBondContact O-N 2.89Å; P61-I63 PolarHBondContact O-N 3.46Å; I63-N66 PolarHBondContact O-N 2.89Å; I63-S67 WeakPolarHBondContact O-CB 3.22Å; I63-S67 PolarHBondContact O-N 2.98Å; I63-S67 PolarHBondContact O-OG 3.44Å
64	A	77.7	Confident	74	Confident	50 Å²	50	85.9 Å²	85.9	41%	0.413	45%	0.446	S	S	.	.	H	α-helix	trans	-65.5	-43.7	176.2	0	0	0	0	0	112.2	V60 P61 S67 L68	V60-A64 VanDerWaalsContact O-CB 3.27Å; V60-A64 WeakPolarHBondContact O-CB 3.13Å; V60-A64 PolarHBondContact O-N 3.17Å; P61-A64 PolarHBondContact O-N 3.47Å; A64-S67 WeakPolarHBondContact O-CB 3.38Å; A64-S67 PolarHBondContact O-N 3.05Å; A64-L68 WeakPolarHBondContact O-CB 3.22Å; A64-L68 PolarHBondContact O-N 2.86Å
65	V	78.9	Confident	74.2	Confident	82 Å²	82	90.3 Å²	90.3	50%	0.497	46%	0.462	S	S	.	.	H	α-helix	trans	-62.6	-45	174.1	170.6	0	0	0	0	109.8	P61 S67 L68 V69	P61-V65 WeakPolarHBondContact O-CB 3.5Å; P61-V65 WeakPolarHBondContact O-CG2 3.18Å; P61-V65 PolarHBondContact O-N 3.28Å; V65-S67 VanDerWaalsContact C-N 3.28Å; V65-S67 PolarHBondContact O-N 3.09Å; V65-L68 PolarHBondContact O-N 3.39Å; V65-V69 HydrophobicContact CG1-CG2 4.22Å; V65-V69 WeakPolarHBondContact O-CB 3.41Å; V65-V69 VanDerWaalsContact O-CG2 3.24Å; V65-V69 WeakPolarHBondContact O-CG2 3.43Å; V65-V69 PolarHBondContact O-N 2.88Å
66	N	79.8	Confident	74.5	Confident	94 Å²	94	91 Å²	91	50%	0.503	47%	0.469	S	S	.	.	H	α-helix	trans	-58.6	-41.2	174.3	-71.7	-16.5	0	0	0	111.9	L62 I63 I70	L62-N66 WeakPolarHBondContact O-CB 3.38Å; L62-N66 PolarHBondContact O-N 2.8Å; L62-N66 VanDerWaalsContact O-N 3.07Å; L62-N66 PolarHBondContact O-ND2 3.14Å; L62-N66 PolarHBondContact O-OD1 2.99Å; I63-N66 PolarHBondContact O-N 2.89Å; N66-I70 WeakPolarHBondContact O-CD1 3.49Å; N66-I70 VanDerWaalsContact O-CG1 3.25Å; N66-I70 WeakPolarHBondContact O-CG1 3.07Å; N66-I70 PolarHBondContact O-N 2.91Å; N66-I70 VanDerWaalsContact O-N 3.12Å
67	S	78.2	Confident	74.3	Confident	13 Å²	13	93.3 Å²	93.3	9%	0.091	51%	0.507	C	S	.	.	H	α-helix	trans	-66.9	-42.2	176.7	-54.3	0	0	0	0	111.8	I63 A64 V65 I70 L71	I63-S67 WeakPolarHBondContact O-CB 3.22Å; I63-S67 PolarHBondContact O-N 2.98Å; I63-S67 PolarHBondContact O-OG 3.44Å; A64-S67 WeakPolarHBondContact O-CB 3.38Å; A64-S67 PolarHBondContact O-N 3.05Å; V65-S67 VanDerWaalsContact C-N 3.28Å; V65-S67 PolarHBondContact O-N 3.09Å; S67-I70 PolarHBondContact O-N 3.21Å; S67-L71 WeakPolarHBondContact O-CG 3.28Å; S67-L71 PolarHBondContact O-N 3.31Å
68	L	82.7	Confident	74.6	Confident	95 Å²	95	93 Å²	93	50%	0.497	50%	0.503	S	S	.	.	H	α-helix	trans	-66.1	-42	178.2	-165	159.8	0	0	0	111.2	A64 V65 I70 L71 M72	A64-L68 WeakPolarHBondContact O-CB 3.22Å; A64-L68 PolarHBondContact O-N 2.86Å; V65-L68 PolarHBondContact O-N 3.39Å; L68-I70 VanDerWaalsContact C-N 3.3Å; L68-I70 PolarHBondContact O-N 3.05Å; L68-L71 PolarHBondContact O-N 3.41Å; L68-M72 HydrophobicContact CD2-CE 4.17Å; L68-M72 HydrophobicContact CD2-CG 3.71Å; L68-M72 WeakPolarHBondContact O-CB 3.33Å; L68-M72 VanDerWaalsContact O-CG 3.3Å; L68-M72 WeakPolarHBondContact O-CG 3.46Å; L68-M72 PolarHBondContact O-N 2.92Å
69	V	81.3	Confident	74.9	Confident	72 Å²	72	91.7 Å²	91.7	44%	0.436	50%	0.499	S	S	.	.	H	α-helix	trans	-62.1	-38.8	175.4	170.4	0	0	0	0	110.9	V65 K73	V65-V69 HydrophobicContact CG1-CG2 4.22Å; V65-V69 WeakPolarHBondContact O-CB 3.41Å; V65-V69 VanDerWaalsContact O-CG2 3.24Å; V65-V69 WeakPolarHBondContact O-CG2 3.43Å; V65-V69 PolarHBondContact O-N 2.88Å; V69-K73 WeakPolarHBondContact O-CB 3.45Å; V69-K73 WeakPolarHBondContact O-CG 3.24Å; V69-K73 PolarHBondContact O-N 2.82Å
70	I	75.2	Confident	75.2	Confident	58 Å²	58	86.2 Å²	86.2	30%	0.297	49%	0.486	S	S	.	.	H	α-helix	trans	-71.4	-38.9	175.7	-63.6	165	0	0	0	111.3	L14 N66 S67 L68 K73 L74	L14-I70 HydrophobicContact CD1-CB 4.43Å; L14-I70 HydrophobicContact CD1-CG2 3.7Å; L14-I70 HydrophobicContact CD2-CD1 4.25Å; L14-I70 HydrophobicContact CD2-CG2 4.39Å; N66-I70 WeakPolarHBondContact O-CD1 3.49Å; N66-I70 VanDerWaalsContact O-CG1 3.25Å; N66-I70 WeakPolarHBondContact O-CG1 3.07Å; N66-I70 PolarHBondContact O-N 2.91Å; N66-I70 VanDerWaalsContact O-N 3.12Å; S67-I70 PolarHBondContact O-N 3.21Å; L68-I70 VanDerWaalsContact C-N 3.3Å; L68-I70 PolarHBondContact O-N 3.05Å; I70-K73 CarbonylContact O-C 3.47Å; I70-K73 WeakPolarHBondContact O-CA 3.34Å; I70-K73 WeakPolarHBondContact O-CB 3.3Å; I70-K73 PolarHBondContact O-N 2.8Å; I70-L74 WeakPolarHBondContact O-CB 3.42Å; I70-L74 PolarHBondContact O-N 3.17Å
71	L	78.7	Confident	75.6	Confident	74 Å²	74	87.9 Å²	87.9	39%	0.387	50%	0.495	S	S	.	.	H	α-helix	trans	-62.1	-44	171.7	-74.1	172.4	0	0	0	112	S67 L68 K73 L74 F75	S67-L71 WeakPolarHBondContact O-CG 3.28Å; S67-L71 PolarHBondContact O-N 3.31Å; L68-L71 PolarHBondContact O-N 3.41Å; L71-K73 VanDerWaalsContact C-N 3.29Å; L71-K73 PolarHBondContact O-N 2.77Å; L71-L74 HydrophobicContact CD2-CD2 4.42Å; L71-L74 WeakPolarHBondContact O-CA 3.39Å; L71-L74 WeakPolarHBondContact O-CB 3.35Å; L71-L74 PolarHBondContact O-N 3.44Å; L71-F75 VanDerWaalsContact O-CD2 3.28Å; L71-F75 WeakPolarHBondContact O-CD2 3.48Å; L71-F75 PolarHBondContact O-N 3.45Å
72	M	78.5	Confident	76	Confident	102 Å²	102	90 Å²	90	50%	0.502	50%	0.504	S	S	.	.	H	α-helix	trans	-60.1	-42	172.6	-74.9	-69.6	-154.2	0	0	110.3	L68 L74 F75 I76	L68-M72 HydrophobicContact CD2-CE 4.17Å; L68-M72 HydrophobicContact CD2-CG 3.71Å; L68-M72 WeakPolarHBondContact O-CB 3.33Å; L68-M72 VanDerWaalsContact O-CG 3.3Å; L68-M72 WeakPolarHBondContact O-CG 3.46Å; L68-M72 PolarHBondContact O-N 2.92Å; M72-L74 VanDerWaalsContact C-N 3.28Å; M72-L74 PolarHBondContact O-N 2.8Å; M72-F75 PolarHBondContact O-N 3.27Å; M72-I76 HydrophobicContact CB-CD1 4.33Å; M72-I76 WeakPolarHBondContact O-CB 3.32Å; M72-I76 WeakPolarHBondContact O-CG1 3.19Å; M72-I76 PolarHBondContact O-N 2.8Å
73	K	79.2	Confident	76.1	Confident	152 Å²	152	88.2 Å²	88.2	66%	0.661	50%	0.496	S	S	*	.	H	α-helix	trans	-63.3	-29.8	171.7	-82.1	-176.7	168.4	-176.2	0	113.5	V69 I70 L71 G77	V69-K73 WeakPolarHBondContact O-CB 3.45Å; V69-K73 WeakPolarHBondContact O-CG 3.24Å; V69-K73 PolarHBondContact O-N 2.82Å; I70-K73 CarbonylContact O-C 3.47Å; I70-K73 WeakPolarHBondContact O-CA 3.34Å; I70-K73 WeakPolarHBondContact O-CB 3.3Å; I70-K73 PolarHBondContact O-N 2.8Å; L71-K73 VanDerWaalsContact C-N 3.29Å; L71-K73 PolarHBondContact O-N 2.77Å; K73-G77 WeakPolarHBondContact O-CA 3.18Å; K73-G77 PolarHBondContact O-N 3.3Å
74	L	71.1	Confident	76.6	Confident	62 Å²	62	91.2 Å²	91.2	33%	0.325	52%	0.515	S	S	.	.	H	α-helix	trans	-74.5	-34.3	175.6	177.5	69.7	0	0	0	112.3	T7 I70 L71 M72	T7-L74 HydrophobicContact CG2-CD1 3.79Å; I70-L74 WeakPolarHBondContact O-CB 3.42Å; I70-L74 PolarHBondContact O-N 3.17Å; L71-L74 HydrophobicContact CD2-CD2 4.42Å; L71-L74 WeakPolarHBondContact O-CA 3.39Å; L71-L74 WeakPolarHBondContact O-CB 3.35Å; L71-L74 PolarHBondContact O-N 3.44Å; M72-L74 VanDerWaalsContact C-N 3.28Å; M72-L74 PolarHBondContact O-N 2.8Å
75	F	74	Confident	76.5	Confident	174 Å²	174	94.4 Å²	94.4	76%	0.763	52%	0.523	S	S	*	.	H	α-helix	trans	-82.9	-32.1	176.5	-83.9	-73.1	0	0	0	113.4	L71 M72	L71-F75 VanDerWaalsContact O-CD2 3.28Å; L71-F75 WeakPolarHBondContact O-CD2 3.48Å; L71-F75 PolarHBondContact O-N 3.45Å; M72-F75 PolarHBondContact O-N 3.27Å
76	I	76	Confident	76.3	Confident	141 Å²	141	95.4 Å²	95.4	72%	0.723	53%	0.525	S	S	*	.	H	α-helix	trans	-89.1	-27	178.8	-63.6	167.2	0	0	0	111.3	M72	M72-I76 HydrophobicContact CB-CD1 4.33Å; M72-I76 WeakPolarHBondContact O-CB 3.32Å; M72-I76 WeakPolarHBondContact O-CG1 3.19Å; M72-I76 PolarHBondContact O-N 2.8Å
77	G	60.6	Low	75.9	Confident	108 Å²	108	95.5 Å²	95.5	100%	1.113	53%	0.527	S	S	*	.			trans	-63.3	0	158.5	0	0	0	0	0	110.2	K73	K73-G77 WeakPolarHBondContact O-CA 3.18Å; K73-G77 PolarHBondContact O-N 3.3Å

Retrieved 77 of 77 residues in 32.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).