A0A077Z458_TRITR Loading...

Synaptobrevin-1

AlphaFold DB , UniProt , Accession A0A077Z458, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 115 aa.

						>A0A077Z458_TRITR|A0A077Z458
MNLHSVGSQPTLGASDGSMGQGRPQSKRLQQTQAQVDEVVGIMKVNVEKVLERDAKLSQLDDRADALQEGASQFEKSAATLKRKYWWKNCKMIIIICAIVLVIIIIIVVWVSTSN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.4	Very low	48.1	Very low	240 Å²	240	142.5 Å²	142.5	100%	1.182	82%	0.823	S	S	*	*				0	99.9	0	-121.8	89.3	143.2	0	0	107.9
2	N	41.3	Very low	47.7	Very low	168 Å²	168	144.7 Å²	144.7	90%	0.898	83%	0.828	S	S	*	*			trans	-140.2	141.3	151.6	-156.3	11.2	0	0	0	108.4
3	L	44.4	Very low	47.5	Very low	150 Å²	150	138.1 Å²	138.1	79%	0.785	81%	0.811	S	S	*	*			trans	-92.8	149.8	-141.4	-145.4	68.8	0	0	0	111.5
4	H	43.6	Very low	47.6	Very low	188 Å²	188	135.9 Å²	135.9	87%	0.87	82%	0.816	S	S	*	*			trans	-40.7	138.2	154.2	-88.4	170.4	0	0	0	112.4
5	S	55.1	Low	47.9	Very low	106 Å²	106	134.3 Å²	134.3	74%	0.741	81%	0.814	S	S	*	*				-174.3	100.5	125.9	-159.6	0	0	0	0	107.8
6	V	54.6	Low	47.6	Very low	134 Å²	134	135.7 Å²	135.7	81%	0.812	82%	0.815	S	S	*	*				79.6	114.6	100.8	112.1	0	0	0	0	113
7	G	52.5	Low	47.3	Very low	78 Å²	78	131.3 Å²	131.3	80%	0.804	81%	0.805	S	S	*	*			trans	-159.3	88.9	169.5	0	0	0	0	0	106.6
8	S	54.8	Low	47.3	Very low	111 Å²	111	130.3 Å²	130.3	78%	0.776	80%	0.804	S	S	*	*			trans	-57.9	135.4	-176.6	-56.4	0	0	0	0	112.6
9	Q	46.3	Very low	47.5	Very low	181 Å²	181	133.6 Å²	133.6	85%	0.846	81%	0.812	S	S	*	*			trans	-55.7	154.3	141.8	-75.7	176.8	28.9	0	0	108.2
10	P	45	Very low	47.4	Very low	97 Å²	97	130.1 Å²	130.1	63%	0.63	80%	0.803	S	S	*	*			cis	-155	-174.8	44	39.8	-16.6	0	0	0	116.4
11	T	44.3	Very low	47.7	Very low	115 Å²	115	133.6 Å²	133.6	71%	0.706	81%	0.81	S	S	*	*			trans	70.4	138.6	145.3	60.9	0	0	0	0	117.7
12	L	43.8	Very low	47.8	Very low	168 Å²	168	125.4 Å²	125.4	88%	0.88	79%	0.788	S	S	*	*			cis	-171.8	153.4	26.8	-119.2	150.5	0	0	0	106.6
13	G	44.2	Very low	48.7	Very low	59 Å²	59	125.2 Å²	125.2	61%	0.608	77%	0.774	S	S	*	*			trans	99.5	70.5	146.2	0	0	0	0	0	115.2	S15	G13-S15 PolarHBondContact O-N 2.91Å
14	A	49.2	Very low	49.4	Very low	107 Å²	107	123.7 Å²	123.7	88%	0.884	77%	0.774	S	S	*	*			trans	-57.1	89.4	136.9	0	0	0	0	0	108.1	D16	A14-D16 PolarHBondContact O-N 3.27Å
15	S	52.9	Low	50.3	Low	113 Å²	113	119.6 Å²	119.6	79%	0.79	76%	0.755	S	S	*	*			trans	-87.5	73.5	161.6	60.2	0	0	0	0	107.8	G13	G13-S15 PolarHBondContact O-N 2.91Å
16	D	42	Very low	50.7	Low	156 Å²	156	117.3 Å²	117.3	83%	0.834	74%	0.739	S	S	*	*			trans	-61.8	126.2	149.3	-179.9	26.4	0	0	0	107.3	A14	A14-D16 PolarHBondContact O-N 3.27Å
17	G	43	Very low	51.6	Low	61 Å²	61	118.3 Å²	118.3	63%	0.629	73%	0.732	S	S	*	*			trans	179.4	47.3	-169.1	0	0	0	0	0	109.8	M19	G17-M19 PolarHBondContact O-N 2.8Å
18	S	47.8	Very low	52.5	Low	113 Å²	113	123.5 Å²	123.5	79%	0.79	73%	0.727	S	S	*	*			trans	-47.3	121.1	168.7	-176.4	0	0	0	0	109.5	G20	S18-G20 PolarHBondContact O-N 3.18Å
19	M	50	Low	53.2	Low	194 Å²	194	123 Å²	123	96%	0.956	72%	0.716	S	S	*	*			trans	-54.4	91.1	-176.6	-80.1	-167.2	-93	0	0	112	G17	G17-M19 PolarHBondContact O-N 2.8Å
20	G	46.8	Very low	54.5	Low	62 Å²	62	120.6 Å²	120.6	64%	0.639	70%	0.704	S	S	*	*			trans	-97.7	88.4	162.2	0	0	0	0	0	109.8	S18	S18-G20 PolarHBondContact O-N 3.18Å
21	Q	53.6	Low	56	Low	204 Å²	204	122 Å²	122	95%	0.953	70%	0.703	S	S	*	*			trans	178.5	96.5	144.8	-100.5	166.4	65.2	0	0	112
22	G	49.3	Very low	57.5	Low	69 Å²	69	120.3 Å²	120.3	71%	0.711	69%	0.692	S	S	*	*			trans	168.4	127.6	163.1	0	0	0	0	0	110.2
23	R	58.8	Low	59.1	Low	163 Å²	163	118.8 Å²	118.8	62%	0.615	68%	0.68	S	S	*	*			cis	-157.1	127.4	1.7	-59.1	163.3	83.4	134.3	-2.7	104.6	Q25 S26	R23-Q25 HydrophobicContact CB-CB 3.88Å; R23-Q25 VanDerWaalsContact NE-OE1 3.09Å; R23-Q25 PolarHBondContact O-N 2.9Å; R23-S26 PolarHBondContact O-N 3.39Å; R23-S26 PolarHBondContact O-OG 3.39Å
24	P	59.9	Low	60.9	Low	119 Å²	119	118.8 Å²	118.8	77%	0.773	68%	0.675	S	S	*	*	H	α-helix	trans	-55.3	-19.3	166.3	20.2	-29.7	0	0	0	112.5	S26 K27 R28	P24-S26 VanDerWaalsContact C-N 3.32Å; P24-S26 PolarHBondContact O-N 3.04Å; P24-K27 PolarHBondContact O-N 2.91Å; P24-R28 PolarHBondContact O-N 3.44Å
25	Q	61.8	Low	62.4	Low	102 Å²	102	119.6 Å²	119.6	48%	0.477	66%	0.661	S	S	.	*	H	α-helix	trans	-56.4	-36.3	171.8	-164.3	175.8	12.9	0	0	113.7	R23 K27 R28 L29	R23-Q25 HydrophobicContact CB-CB 3.88Å; R23-Q25 VanDerWaalsContact NE-OE1 3.09Å; R23-Q25 PolarHBondContact O-N 2.9Å; Q25-K27 PolarHBondContact O-N 3.26Å; Q25-R28 PolarHBondContact O-N 2.87Å; Q25-L29 HydrophobicContact CG-CD1 4.24Å; Q25-L29 WeakPolarHBondContact O-CG 3.44Å; Q25-L29 PolarHBondContact O-N 3.49Å
26	S	64.9	Low	63.9	Low	57 Å²	57	118.1 Å²	118.1	40%	0.399	65%	0.646	S	S	.	*	H	α-helix	trans	-68.1	-36.1	-178.8	58.7	0	0	0	0	112.4	R23 P24 L29 Q30	R23-S26 PolarHBondContact O-N 3.39Å; R23-S26 PolarHBondContact O-OG 3.39Å; P24-S26 VanDerWaalsContact C-N 3.32Å; P24-S26 PolarHBondContact O-N 3.04Å; S26-L29 PolarHBondContact O-N 3.01Å; S26-Q30 WeakPolarHBondContact O-CB 3.33Å; S26-Q30 PolarHBondContact O-N 2.93Å
27	K	73.1	Confident	66	Low	155 Å²	155	116 Å²	116	67%	0.674	64%	0.635	S	S	*	*	H	α-helix	trans	-65.2	-42.6	175.5	-66.6	-173.4	-179.9	-178.6	0	111.9	P24 Q25 Q30 Q31	P24-K27 PolarHBondContact O-N 2.91Å; Q25-K27 PolarHBondContact O-N 3.26Å; K27-Q30 PolarHBondContact O-N 3.17Å; K27-Q31 WeakPolarHBondContact O-CG 3.49Å; K27-Q31 PolarHBondContact O-N 2.92Å
28	R	71	Confident	68.3	Low	187 Å²	187	119.5 Å²	119.5	71%	0.706	64%	0.635	S	S	*	*	H	α-helix	trans	-62.2	-44.3	175.2	-72.9	-77	-170.5	170.3	0.7	111.2	P24 Q25 Q31 T32	P24-R28 PolarHBondContact O-N 3.44Å; Q25-R28 PolarHBondContact O-N 2.87Å; R28-Q31 PolarHBondContact O-N 3.04Å; R28-T32 PolarHBondContact O-N 3.39Å; R28-T32 PolarHBondContact O-OG1 3.33Å; R28-T32 VanDerWaalsContact O-OG1 3.1Å
29	L	70.1	Confident	70.1	Confident	102 Å²	102	117.8 Å²	117.8	53%	0.534	62%	0.62	S	S	.	*	H	α-helix	trans	-65.1	-41.4	177.5	-69	172.6	0	0	0	112.5	Q25 S26 T32 Q33	Q25-L29 HydrophobicContact CG-CD1 4.24Å; Q25-L29 WeakPolarHBondContact O-CG 3.44Å; Q25-L29 PolarHBondContact O-N 3.49Å; S26-L29 PolarHBondContact O-N 3.01Å; L29-T32 PolarHBondContact O-N 3.44Å; L29-Q33 PolarHBondContact O-N 3.36Å
30	Q	73.4	Confident	71.9	Confident	129 Å²	129	111.6 Å²	111.6	60%	0.603	59%	0.593	S	S	*	*	H	α-helix	trans	-63.4	-40.6	174.6	-82.3	175.9	21.9	0	0	112.2	S26 K27 T32 Q33 A34	S26-Q30 WeakPolarHBondContact O-CB 3.33Å; S26-Q30 PolarHBondContact O-N 2.93Å; K27-Q30 PolarHBondContact O-N 3.17Å; Q30-T32 VanDerWaalsContact C-N 3.33Å; Q30-T32 PolarHBondContact O-N 3.38Å; Q30-Q33 PolarHBondContact O-N 3.01Å; Q30-A34 WeakPolarHBondContact O-CB 3.36Å; Q30-A34 PolarHBondContact O-N 3.36Å
31	Q	75.5	Confident	74	Confident	128 Å²	128	110.2 Å²	110.2	60%	0.598	58%	0.578	S	S	*	*	H	α-helix	trans	-61.3	-42.2	173.6	-76	178	-29	0	0	111.7	K27 R28 Q35	K27-Q31 WeakPolarHBondContact O-CG 3.49Å; K27-Q31 PolarHBondContact O-N 2.92Å; R28-Q31 PolarHBondContact O-N 3.04Å; Q31-Q35 WeakPolarHBondContact O-CB 3.23Å; Q31-Q35 PolarHBondContact O-N 3.49Å
32	T	77	Confident	75.8	Confident	79 Å²	79	104.4 Å²	104.4	49%	0.485	55%	0.553	S	S	.	*	H	α-helix	trans	-66.3	-40.3	175.9	-56.6	0	0	0	0	112.1	R28 L29 Q30 Q35 V36	R28-T32 PolarHBondContact O-N 3.39Å; R28-T32 PolarHBondContact O-OG1 3.33Å; R28-T32 VanDerWaalsContact O-OG1 3.1Å; L29-T32 PolarHBondContact O-N 3.44Å; Q30-T32 VanDerWaalsContact C-N 3.33Å; Q30-T32 PolarHBondContact O-N 3.38Å; T32-Q35 PolarHBondContact O-N 2.99Å; T32-V36 VanDerWaalsContact O-CG2 3.31Å; T32-V36 WeakPolarHBondContact O-CG2 3.31Å; T32-V36 PolarHBondContact O-N 3.49Å
33	Q	77.4	Confident	77.6	Confident	135 Å²	135	106 Å²	106	63%	0.631	54%	0.543	S	S	*	.	H	α-helix	trans	-63	-46.2	175.4	-77.1	-167.8	-13.3	0	0	111.9	L29 Q30 Q35 V36 D37	L29-Q33 PolarHBondContact O-N 3.36Å; Q30-Q33 PolarHBondContact O-N 3.01Å; Q33-Q35 VanDerWaalsContact C-N 3.31Å; Q33-Q35 PolarHBondContact O-N 3.41Å; Q33-V36 PolarHBondContact O-N 3.1Å; Q33-V36 VanDerWaalsContact O-N 3.17Å; Q33-D37 PolarHBondContact O-N 3Å
34	A	82.2	Confident	79.1	Confident	60 Å²	60	104.7 Å²	104.7	50%	0.496	54%	0.542	S	S	.	.	H	α-helix	trans	-61.4	-39.4	177.5	0	0	0	0	0	112.4	Q30 D37 E38	Q30-A34 WeakPolarHBondContact O-CB 3.36Å; Q30-A34 PolarHBondContact O-N 3.36Å; A34-D37 PolarHBondContact O-N 3.32Å; A34-E38 PolarHBondContact O-N 3.17Å
35	Q	80.9	Confident	80.6	Confident	124 Å²	124	102 Å²	102	58%	0.579	52%	0.523	S	S	*	.	H	α-helix	trans	-66.1	-38.9	175.9	-176.5	174.5	68.1	0	0	112.1	Q31 T32 Q33 E38 V39	Q31-Q35 WeakPolarHBondContact O-CB 3.23Å; Q31-Q35 PolarHBondContact O-N 3.49Å; T32-Q35 PolarHBondContact O-N 2.99Å; Q33-Q35 VanDerWaalsContact C-N 3.31Å; Q33-Q35 PolarHBondContact O-N 3.41Å; Q35-E38 PolarHBondContact O-N 3.19Å; Q35-V39 VanDerWaalsContact O-CG2 3.3Å; Q35-V39 WeakPolarHBondContact O-CG2 3.41Å; Q35-V39 PolarHBondContact O-N 2.93Å
36	V	83.3	Confident	82	Confident	81 Å²	81	100.4 Å²	100.4	49%	0.491	52%	0.518	S	S	.	.	H	α-helix	trans	-66.5	-43	175.5	173.2	0	0	0	0	110.5	T32 Q33 E38 V39 V40	T32-V36 VanDerWaalsContact O-CG2 3.31Å; T32-V36 WeakPolarHBondContact O-CG2 3.31Å; T32-V36 PolarHBondContact O-N 3.49Å; Q33-V36 PolarHBondContact O-N 3.1Å; Q33-V36 VanDerWaalsContact O-N 3.17Å; V36-E38 VanDerWaalsContact C-N 3.31Å; V36-E38 PolarHBondContact O-N 3.38Å; V36-V39 PolarHBondContact O-N 3.34Å; V36-V40 HydrophobicContact CG1-CG2 4.15Å; V36-V40 WeakPolarHBondContact O-CB 3.35Å; V36-V40 VanDerWaalsContact O-CG2 3.23Å; V36-V40 WeakPolarHBondContact O-CG2 3.45Å; V36-V40 PolarHBondContact O-N 2.93Å
37	D	87.3	Confident	83.2	Confident	113 Å²	113	101.2 Å²	101.2	60%	0.604	52%	0.52	S	S	*	.	H	α-helix	trans	-61	-40.1	176.8	-74	-30.3	0	0	0	111.9	Q33 A34 V40 G41	Q33-D37 PolarHBondContact O-N 3Å; A34-D37 PolarHBondContact O-N 3.32Å; D37-V40 PolarHBondContact O-N 2.86Å; D37-G41 PolarHBondContact O-N 3.15Å
38	E	89.7	Confident	84	Confident	133 Å²	133	99.5 Å²	99.5	62%	0.621	52%	0.515	S	S	*	.	H	α-helix	trans	-62.9	-48.1	174.1	-175.8	177.4	-171.1	0	0	111.7	A34 Q35 V36 V40 G41 I42	A34-E38 PolarHBondContact O-N 3.17Å; Q35-E38 PolarHBondContact O-N 3.19Å; V36-E38 VanDerWaalsContact C-N 3.31Å; V36-E38 PolarHBondContact O-N 3.38Å; E38-V40 PolarHBondContact O-N 3.26Å; E38-G41 CarbonylContact O-C 3.6Å; E38-G41 WeakPolarHBondContact O-CA 3.44Å; E38-G41 PolarHBondContact O-N 3.5Å; E38-G41 VanDerWaalsContact O-N 3.15Å; E38-I42 HydrophobicContact CG-CD1 4.14Å; E38-I42 WeakPolarHBondContact O-CG1 3.44Å; E38-I42 PolarHBondContact O-N 3.47Å
39	V	86.3	Confident	84.7	Confident	78 Å²	78	95.3 Å²	95.3	47%	0.473	50%	0.501	S	S	.	.	H	α-helix	trans	-64.9	-39	178.4	173.4	0	0	0	0	111.4	Q35 V36 G41 I42 M43	Q35-V39 VanDerWaalsContact O-CG2 3.3Å; Q35-V39 WeakPolarHBondContact O-CG2 3.41Å; Q35-V39 PolarHBondContact O-N 2.93Å; V36-V39 PolarHBondContact O-N 3.34Å; V39-G41 VanDerWaalsContact C-N 3.31Å; V39-G41 PolarHBondContact O-N 2.89Å; V39-I42 PolarHBondContact O-N 3.49Å; V39-M43 HydrophobicContact CG1-CG 4.34Å; V39-M43 WeakPolarHBondContact O-CB 3.3Å; V39-M43 WeakPolarHBondContact O-CG 3.41Å; V39-M43 PolarHBondContact O-N 2.81Å
40	V	87.8	Confident	85.6	Confident	64 Å²	64	94.2 Å²	94.2	39%	0.388	50%	0.499	S	S	.	.	H	α-helix	trans	-62.8	-40.9	173.4	170.1	0	0	0	0	110.3	V36 D37 E38 M43 K44	V36-V40 HydrophobicContact CG1-CG2 4.15Å; V36-V40 WeakPolarHBondContact O-CB 3.35Å; V36-V40 VanDerWaalsContact O-CG2 3.23Å; V36-V40 WeakPolarHBondContact O-CG2 3.45Å; V36-V40 PolarHBondContact O-N 2.93Å; D37-V40 PolarHBondContact O-N 2.86Å; E38-V40 PolarHBondContact O-N 3.26Å; V40-M43 PolarHBondContact O-N 3.45Å; V40-K44 HydrophobicContact CG1-CD 4.5Å; V40-K44 WeakPolarHBondContact O-CG 3.3Å; V40-K44 PolarHBondContact O-N 3.25Å
41	G	91	Very high	86.1	Confident	32 Å²	32	93.4 Å²	93.4	33%	0.33	50%	0.498	S	S	.	.	H	α-helix	trans	-57.8	-49.5	171.5	0	0	0	0	0	112.2	D37 E38 V39 M43 K44 V45	D37-G41 PolarHBondContact O-N 3.15Å; E38-G41 CarbonylContact O-C 3.6Å; E38-G41 WeakPolarHBondContact O-CA 3.44Å; E38-G41 PolarHBondContact O-N 3.5Å; E38-G41 VanDerWaalsContact O-N 3.15Å; V39-G41 VanDerWaalsContact C-N 3.31Å; V39-G41 PolarHBondContact O-N 2.89Å; G41-M43 PolarHBondContact O-N 3.38Å; G41-K44 PolarHBondContact O-N 3.01Å; G41-V45 WeakPolarHBondContact O-CG2 3.36Å; G41-V45 PolarHBondContact O-N 3.41Å
42	I	90.8	Very high	86.5	Confident	83 Å²	83	93 Å²	93	43%	0.426	50%	0.496	S	S	.	.	H	α-helix	trans	-62.2	-41.6	177.4	-66	165.8	0	0	0	111.3	E38 V39 V45 N46	E38-I42 HydrophobicContact CG-CD1 4.14Å; E38-I42 WeakPolarHBondContact O-CG1 3.44Å; E38-I42 PolarHBondContact O-N 3.47Å; V39-I42 PolarHBondContact O-N 3.49Å; I42-V45 PolarHBondContact O-N 3.01Å; I42-N46 WeakPolarHBondContact O-CB 3.44Å; I42-N46 VanDerWaalsContact O-CG 3.23Å; I42-N46 PolarHBondContact O-N 3.22Å
43	M	86.8	Confident	86.7	Confident	102 Å²	102	96.7 Å²	96.7	50%	0.502	50%	0.501	S	S	.	.	H	α-helix	trans	-66.4	-38.9	178.5	-77.1	-64	-68.7	0	0	112.3	V39 V40 G41 V45 N46 V47	V39-M43 HydrophobicContact CG1-CG 4.34Å; V39-M43 WeakPolarHBondContact O-CB 3.3Å; V39-M43 WeakPolarHBondContact O-CG 3.41Å; V39-M43 PolarHBondContact O-N 2.81Å; V40-M43 PolarHBondContact O-N 3.45Å; G41-M43 PolarHBondContact O-N 3.38Å; M43-V45 VanDerWaalsContact C-N 3.34Å; M43-V45 PolarHBondContact O-N 2.97Å; M43-N46 CarbonylContact O-C 3.49Å; M43-N46 PolarHBondContact O-N 3.44Å; M43-V47 WeakPolarHBondContact O-CB 3.5Å; M43-V47 VanDerWaalsContact O-CG2 3.3Å; M43-V47 WeakPolarHBondContact O-CG2 3.44Å; M43-V47 PolarHBondContact O-N 3.37Å
44	K	92	Very high	86.9	Confident	135 Å²	135	95.4 Å²	95.4	59%	0.587	50%	0.499	S	S	*	.	H	α-helix	trans	-57.5	-48.9	172.3	-75.8	174.8	-179.6	176.5	0	110.8	V40 G41 N46 V47 E48	V40-K44 HydrophobicContact CG1-CD 4.5Å; V40-K44 WeakPolarHBondContact O-CG 3.3Å; V40-K44 PolarHBondContact O-N 3.25Å; G41-K44 PolarHBondContact O-N 3.01Å; K44-N46 VanDerWaalsContact C-N 3.3Å; K44-N46 PolarHBondContact O-N 3.42Å; K44-V47 PolarHBondContact O-N 3.47Å; K44-E48 WeakPolarHBondContact O-CG 3.36Å; K44-E48 PolarHBondContact O-N 2.99Å
45	V	90.6	Very high	86.9	Confident	63 Å²	63	95 Å²	95	38%	0.382	50%	0.496	S	S	.	.	H	α-helix	trans	-63	-36.8	176.2	176.2	0	0	0	0	111.6	G41 I42 M43 K49	G41-V45 WeakPolarHBondContact O-CG2 3.36Å; G41-V45 PolarHBondContact O-N 3.41Å; I42-V45 PolarHBondContact O-N 3.01Å; M43-V45 VanDerWaalsContact C-N 3.34Å; M43-V45 PolarHBondContact O-N 2.97Å; V45-K49 HydrophobicContact CG1-CD 4.21Å; V45-K49 WeakPolarHBondContact O-CB 3.47Å; V45-K49 VanDerWaalsContact O-CG 3.26Å; V45-K49 WeakPolarHBondContact O-CG 3.46Å; V45-K49 PolarHBondContact O-N 3.44Å
46	N	90.2	Very high	86.7	Confident	69 Å²	69	95.1 Å²	95.1	37%	0.369	49%	0.494	S	S	.	.	H	α-helix	trans	-69.5	-36.2	176.2	-73.5	-16.8	0	0	0	112.3	I42 M43 K44 K49 V50	I42-N46 WeakPolarHBondContact O-CB 3.44Å; I42-N46 VanDerWaalsContact O-CG 3.23Å; I42-N46 PolarHBondContact O-N 3.22Å; M43-N46 CarbonylContact O-C 3.49Å; M43-N46 PolarHBondContact O-N 3.44Å; K44-N46 VanDerWaalsContact C-N 3.3Å; K44-N46 PolarHBondContact O-N 3.42Å; N46-K49 CarbonylContact O-C 3.6Å; N46-K49 PolarHBondContact O-N 3Å; N46-V50 WeakPolarHBondContact O-CB 3.28Å; N46-V50 PolarHBondContact O-N 3.26Å
47	V	90	Very high	86.3	Confident	73 Å²	73	96.3 Å²	96.3	44%	0.442	50%	0.497	S	S	.	.	H	α-helix	trans	-68	-40.9	174.8	169.5	0	0	0	0	110.5	M43 K44 K49 V50 L51	M43-V47 WeakPolarHBondContact O-CB 3.5Å; M43-V47 VanDerWaalsContact O-CG2 3.3Å; M43-V47 WeakPolarHBondContact O-CG2 3.44Å; M43-V47 PolarHBondContact O-N 3.37Å; K44-V47 PolarHBondContact O-N 3.47Å; V47-K49 VanDerWaalsContact C-N 3.33Å; V47-K49 PolarHBondContact O-N 2.95Å; V47-V50 WeakPolarHBondContact O-CG1 3.44Å; V47-V50 PolarHBondContact O-N 2.77Å; V47-L51 HydrophobicContact CG1-CD1 3.96Å; V47-L51 WeakPolarHBondContact O-CB 3.33Å; V47-L51 WeakPolarHBondContact O-CD1 3.42Å; V47-L51 VanDerWaalsContact O-CG 3.28Å; V47-L51 WeakPolarHBondContact O-CG 3.26Å; V47-L51 PolarHBondContact O-N 2.79Å
48	E	90	Very high	85.9	Confident	120 Å²	120	94 Å²	94	56%	0.561	49%	0.49	S	S	*	.	H	α-helix	trans	-60.1	-45.6	171.3	-71	168.3	-170.5	0	0	110.9	K44 V50 L51 E52	K44-E48 WeakPolarHBondContact O-CG 3.36Å; K44-E48 PolarHBondContact O-N 2.99Å; E48-V50 PolarHBondContact O-N 3.47Å; E48-L51 PolarHBondContact O-N 3.17Å; E48-E52 PolarHBondContact O-N 3.39Å
49	K	87.1	Confident	85.3	Confident	98 Å²	98	93 Å²	93	43%	0.426	49%	0.485	S	S	.	.	H	α-helix	trans	-63.2	-37.4	175.2	-74.8	170.7	-175.8	164.9	0	113.1	V45 N46 V47 R53	V45-K49 HydrophobicContact CG1-CD 4.21Å; V45-K49 WeakPolarHBondContact O-CB 3.47Å; V45-K49 VanDerWaalsContact O-CG 3.26Å; V45-K49 WeakPolarHBondContact O-CG 3.46Å; V45-K49 PolarHBondContact O-N 3.44Å; N46-K49 CarbonylContact O-C 3.6Å; N46-K49 PolarHBondContact O-N 3Å; V47-K49 VanDerWaalsContact C-N 3.33Å; V47-K49 PolarHBondContact O-N 2.95Å; K49-R53 WeakPolarHBondContact O-CB 3.45Å; K49-R53 WeakPolarHBondContact O-CG 3.47Å; K49-R53 PolarHBondContact O-N 3.37Å
50	V	87.8	Confident	84.8	Confident	80 Å²	80	94.4 Å²	94.4	49%	0.485	49%	0.49	S	S	.	.	H	α-helix	trans	-73.3	-34.9	-179.8	83.8	0	0	0	0	110.9	N46 V47 E48 R53 D54	N46-V50 WeakPolarHBondContact O-CB 3.28Å; N46-V50 PolarHBondContact O-N 3.26Å; V47-V50 WeakPolarHBondContact O-CG1 3.44Å; V47-V50 PolarHBondContact O-N 2.77Å; E48-V50 PolarHBondContact O-N 3.47Å; V50-R53 CarbonylContact O-C 3.6Å; V50-R53 WeakPolarHBondContact O-CB 3.43Å; V50-R53 PolarHBondContact O-N 3.36Å; V50-D54 WeakPolarHBondContact O-CB 3.42Å; V50-D54 PolarHBondContact O-N 2.83Å
51	L	83.9	Confident	84.4	Confident	111 Å²	111	96.1 Å²	96.1	58%	0.581	50%	0.497	S	S	*	.	H	α-helix	trans	-64.8	-44.1	171.8	-73	162.9	0	0	0	111.7	V47 E48 R53 D54 A55	V47-L51 HydrophobicContact CG1-CD1 3.96Å; V47-L51 WeakPolarHBondContact O-CB 3.33Å; V47-L51 WeakPolarHBondContact O-CD1 3.42Å; V47-L51 VanDerWaalsContact O-CG 3.28Å; V47-L51 WeakPolarHBondContact O-CG 3.26Å; V47-L51 PolarHBondContact O-N 2.79Å; E48-L51 PolarHBondContact O-N 3.17Å; L51-R53 VanDerWaalsContact C-N 3.29Å; L51-R53 PolarHBondContact O-N 2.83Å; L51-D54 WeakPolarHBondContact O-CB 3.39Å; L51-D54 PolarHBondContact O-N 2.8Å; L51-A55 PolarHBondContact O-N 2.94Å
52	E	84.2	Confident	84	Confident	120 Å²	120	99.6 Å²	99.6	56%	0.561	51%	0.508	S	S	*	.	H	α-helix	trans	-63.2	-36.9	173	-75.9	-173.5	-169	0	0	112.5	E48 K56	E48-E52 PolarHBondContact O-N 3.39Å; E52-K56 WeakPolarHBondContact O-CG 3.22Å; E52-K56 PolarHBondContact O-N 2.75Å
53	R	81.3	Confident	83.5	Confident	156 Å²	156	104.1 Å²	104.1	59%	0.589	52%	0.519	S	S	*	.	H	α-helix	trans	-65.8	-39.8	173.8	-76.7	175.7	-160.3	173.2	4.9	111.4	K49 V50 L51 K56 L57	K49-R53 WeakPolarHBondContact O-CB 3.45Å; K49-R53 WeakPolarHBondContact O-CG 3.47Å; K49-R53 PolarHBondContact O-N 3.37Å; V50-R53 CarbonylContact O-C 3.6Å; V50-R53 WeakPolarHBondContact O-CB 3.43Å; V50-R53 PolarHBondContact O-N 3.36Å; L51-R53 VanDerWaalsContact C-N 3.29Å; L51-R53 PolarHBondContact O-N 2.83Å; R53-K56 CarbonylContact O-C 3.6Å; R53-K56 PolarHBondContact O-N 3.25Å; R53-L57 VanDerWaalsContact O-CB 3.28Å; R53-L57 WeakPolarHBondContact O-CB 3.29Å; R53-L57 VanDerWaalsContact O-CG 3.29Å; R53-L57 WeakPolarHBondContact O-CG 3.28Å; R53-L57 PolarHBondContact O-N 3.38Å
54	D	82.9	Confident	83.3	Confident	108 Å²	108	101.6 Å²	101.6	58%	0.578	51%	0.514	S	S	*	.	H	α-helix	trans	-63.4	-45	177.7	-160.9	-105.3	0	0	0	111.1	V50 L51 K56 L57 S58	V50-D54 WeakPolarHBondContact O-CB 3.42Å; V50-D54 PolarHBondContact O-N 2.83Å; L51-D54 WeakPolarHBondContact O-CB 3.39Å; L51-D54 PolarHBondContact O-N 2.8Å; D54-K56 VanDerWaalsContact C-N 3.34Å; D54-K56 PolarHBondContact O-N 3.16Å; D54-L57 PolarHBondContact O-N 2.82Å; D54-L57 VanDerWaalsContact O-N 3.16Å; D54-S58 PolarHBondContact O-N 3.28Å
55	A	80.5	Confident	83	Confident	53 Å²	53	99.3 Å²	99.3	44%	0.438	51%	0.509	S	S	.	.	H	α-helix	trans	-61.2	-39.7	173.9	0	0	0	0	0	112.8	L51 Q59	L51-A55 PolarHBondContact O-N 2.94Å; A55-Q59 WeakPolarHBondContact O-CG 3.34Å; A55-Q59 PolarHBondContact O-N 2.93Å
56	K	76.6	Confident	82.7	Confident	125 Å²	125	99.2 Å²	99.2	54%	0.543	52%	0.515	S	S	.	.	H	α-helix	trans	-70	-38.2	174	-73.5	172.6	-177.2	166.2	0	112	E52 R53 D54 Q59 L60	E52-K56 WeakPolarHBondContact O-CG 3.22Å; E52-K56 PolarHBondContact O-N 2.75Å; R53-K56 CarbonylContact O-C 3.6Å; R53-K56 PolarHBondContact O-N 3.25Å; D54-K56 VanDerWaalsContact C-N 3.34Å; D54-K56 PolarHBondContact O-N 3.16Å; K56-Q59 PolarHBondContact O-N 3.27Å; K56-L60 WeakPolarHBondContact O-CB 3.46Å; K56-L60 WeakPolarHBondContact O-CD1 3.44Å; K56-L60 PolarHBondContact O-N 3.18Å
57	L	76.1	Confident	82.3	Confident	106 Å²	106	102 Å²	102	56%	0.555	53%	0.529	S	S	*	.	H	α-helix	trans	-64.9	-45.3	177.5	-84	162	0	0	0	110.8	R53 D54 Q59 L60 D61	R53-L57 VanDerWaalsContact O-CB 3.28Å; R53-L57 WeakPolarHBondContact O-CB 3.29Å; R53-L57 VanDerWaalsContact O-CG 3.29Å; R53-L57 WeakPolarHBondContact O-CG 3.28Å; R53-L57 PolarHBondContact O-N 3.38Å; D54-L57 PolarHBondContact O-N 2.82Å; D54-L57 VanDerWaalsContact O-N 3.16Å; L57-Q59 VanDerWaalsContact C-N 3.3Å; L57-Q59 PolarHBondContact O-N 3.42Å; L57-L60 CarbonylContact O-C 3.55Å; L57-L60 WeakPolarHBondContact O-CA 3.34Å; L57-L60 WeakPolarHBondContact O-CB 3.41Å; L57-L60 PolarHBondContact O-N 3.29Å; L57-D61 WeakPolarHBondContact O-CB 3.23Å; L57-D61 PolarHBondContact O-N 3.01Å
58	S	78	Confident	81.9	Confident	65 Å²	65	105 Å²	105	46%	0.455	54%	0.538	S	S	.	.	H	α-helix	trans	-57.9	-43	174.2	170.2	0	0	0	0	111.5	D54 L60 D61 D62	D54-S58 PolarHBondContact O-N 3.28Å; S58-L60 VanDerWaalsContact C-N 3.32Å; S58-L60 PolarHBondContact O-N 3.05Å; S58-D61 PolarHBondContact O-N 3.31Å; S58-D62 PolarHBondContact O-N 3.44Å
59	Q	76.9	Confident	81.5	Confident	111 Å²	111	105.8 Å²	105.8	52%	0.519	54%	0.542	S	S	.	.	H	α-helix	trans	-66.2	-33	173.5	-71.7	-178.5	23.9	0	0	113.4	A55 K56 L57 R63	A55-Q59 WeakPolarHBondContact O-CG 3.34Å; A55-Q59 PolarHBondContact O-N 2.93Å; K56-Q59 PolarHBondContact O-N 3.27Å; L57-Q59 VanDerWaalsContact C-N 3.3Å; L57-Q59 PolarHBondContact O-N 3.42Å; Q59-R63 WeakPolarHBondContact O-CB 3.14Å; Q59-R63 VanDerWaalsContact O-CG 3.23Å; Q59-R63 WeakPolarHBondContact O-CG 3.48Å; Q59-R63 PolarHBondContact O-N 2.74Å
60	L	75.8	Confident	81.2	Confident	109 Å²	109	102.9 Å²	102.9	57%	0.571	54%	0.54	S	S	*	.	H	α-helix	trans	-72.5	-36.1	175.5	-99.3	73.4	0	0	0	111.5	K56 L57 S58 R63 A64	K56-L60 WeakPolarHBondContact O-CB 3.46Å; K56-L60 WeakPolarHBondContact O-CD1 3.44Å; K56-L60 PolarHBondContact O-N 3.18Å; L57-L60 CarbonylContact O-C 3.55Å; L57-L60 WeakPolarHBondContact O-CA 3.34Å; L57-L60 WeakPolarHBondContact O-CB 3.41Å; L57-L60 PolarHBondContact O-N 3.29Å; S58-L60 VanDerWaalsContact C-N 3.32Å; S58-L60 PolarHBondContact O-N 3.05Å; L60-R63 CarbonylContact O-C 3.57Å; L60-R63 PolarHBondContact O-N 2.89Å; L60-A64 WeakPolarHBondContact O-CA 3.3Å; L60-A64 WeakPolarHBondContact O-CB 3.19Å; L60-A64 PolarHBondContact O-N 3.02Å
61	D	80.4	Confident	81	Confident	100 Å²	100	101.5 Å²	101.5	54%	0.535	54%	0.537	S	S	.	.	H	α-helix	trans	-65.5	-50.4	177.4	-157.9	49.7	0	0	0	109.9	L57 S58 R63 A64 D65	L57-D61 WeakPolarHBondContact O-CB 3.23Å; L57-D61 PolarHBondContact O-N 3.01Å; S58-D61 PolarHBondContact O-N 3.31Å; D61-R63 VanDerWaalsContact C-N 3.28Å; D61-R63 PolarHBondContact O-N 2.79Å; D61-A64 CarbonylContact O-C 3.58Å; D61-A64 PolarHBondContact O-N 2.74Å; D61-D65 PolarHBondContact O-N 2.81Å
62	D	81.6	Confident	80.7	Confident	104 Å²	104	97.9 Å²	97.9	56%	0.556	52%	0.521	S	S	*	.	H	α-helix	trans	-57.2	-41.7	174.2	-70.1	-25.1	0	0	0	112	S58 A66	S58-D62 PolarHBondContact O-N 3.44Å; D62-A66 WeakPolarHBondContact O-CB 3.36Å; D62-A66 PolarHBondContact O-N 3.01Å
63	R	80.2	Confident	80.4	Confident	179 Å²	179	97 Å²	97	68%	0.675	52%	0.517	S	S	*	.	H	α-helix	trans	-71.9	-33.7	176.6	-76.2	-179.6	-176.6	-165.9	3.5	112.3	Q59 L60 D61 L67	Q59-R63 WeakPolarHBondContact O-CB 3.14Å; Q59-R63 VanDerWaalsContact O-CG 3.23Å; Q59-R63 WeakPolarHBondContact O-CG 3.48Å; Q59-R63 PolarHBondContact O-N 2.74Å; L60-R63 CarbonylContact O-C 3.57Å; L60-R63 PolarHBondContact O-N 2.89Å; D61-R63 VanDerWaalsContact C-N 3.28Å; D61-R63 PolarHBondContact O-N 2.79Å; R63-L67 WeakPolarHBondContact O-CB 3.12Å; R63-L67 PolarHBondContact O-N 2.81Å
64	A	84.2	Confident	80.3	Confident	48 Å²	48	97 Å²	97	40%	0.397	52%	0.521	S	S	.	.	H	α-helix	trans	-71.1	-40.7	178.3	0	0	0	0	0	110.5	L60 D61 L67 Q68	L60-A64 WeakPolarHBondContact O-CA 3.3Å; L60-A64 WeakPolarHBondContact O-CB 3.19Å; L60-A64 PolarHBondContact O-N 3.02Å; D61-A64 CarbonylContact O-C 3.58Å; D61-A64 PolarHBondContact O-N 2.74Å; A64-L67 CarbonylContact O-C 3.58Å; A64-L67 PolarHBondContact O-N 3.25Å; A64-Q68 WeakPolarHBondContact O-CB 3.13Å; A64-Q68 PolarHBondContact O-N 3.36Å
65	D	84.7	Confident	80	Confident	88 Å²	88	98.3 Å²	98.3	47%	0.471	52%	0.524	S	S	.	.	H	α-helix	trans	-61.7	-48.8	171.4	-81.7	-12.9	0	0	0	110.7	D61 L67 Q68 E69	D61-D65 PolarHBondContact O-N 2.81Å; D65-L67 VanDerWaalsContact C-N 3.29Å; D65-L67 PolarHBondContact O-N 2.7Å; D65-Q68 PolarHBondContact O-N 3.3Å; D65-E69 VanDerWaalsContact O-CB 3.3Å; D65-E69 WeakPolarHBondContact O-CB 3.49Å; D65-E69 PolarHBondContact O-N 3.02Å
66	A	83.6	Confident	79.7	Confident	61 Å²	61	101.6 Å²	101.6	50%	0.504	53%	0.528	S	S	.	.	H	α-helix	trans	-61.5	-37.9	175.6	0	0	0	0	0	112.3	D62 G70	D62-A66 WeakPolarHBondContact O-CB 3.36Å; D62-A66 PolarHBondContact O-N 3.01Å; A66-G70 PolarHBondContact O-N 2.85Å
67	L	82.1	Confident	79.5	Confident	128 Å²	128	98.4 Å²	98.4	67%	0.67	52%	0.522	S	S	*	.	H	α-helix	trans	-73.2	-37.2	177.2	-172.6	66.5	0	0	0	111.6	R63 A64 D65 A71	R63-L67 WeakPolarHBondContact O-CB 3.12Å; R63-L67 PolarHBondContact O-N 2.81Å; A64-L67 CarbonylContact O-C 3.58Å; A64-L67 PolarHBondContact O-N 3.25Å; D65-L67 VanDerWaalsContact C-N 3.29Å; D65-L67 PolarHBondContact O-N 2.7Å; L67-A71 WeakPolarHBondContact O-CA 3.42Å; L67-A71 WeakPolarHBondContact O-CB 3.3Å; L67-A71 PolarHBondContact O-N 2.79Å
68	Q	81.7	Confident	79.6	Confident	136 Å²	136	95 Å²	95	64%	0.636	51%	0.508	S	S	*	.	H	α-helix	trans	-69	-42.7	176.2	179.6	172.1	11.7	0	0	110.3	A64 D65 A71 S72	A64-Q68 WeakPolarHBondContact O-CB 3.13Å; A64-Q68 PolarHBondContact O-N 3.36Å; D65-Q68 PolarHBondContact O-N 3.3Å; Q68-A71 PolarHBondContact O-N 2.87Å; Q68-S72 VanDerWaalsContact O-CB 3.23Å; Q68-S72 WeakPolarHBondContact O-CB 3.2Å; Q68-S72 PolarHBondContact O-N 2.8Å; Q68-S72 PolarHBondContact O-OG 3.28Å
69	E	81.5	Confident	79.6	Confident	135 Å²	135	94.4 Å²	94.4	63%	0.631	51%	0.508	S	S	*	.	H	α-helix	trans	-62.4	-50.1	173.5	-168.4	174.7	-167.6	0	0	109.8	D65 A71 S72 Q73	D65-E69 VanDerWaalsContact O-CB 3.3Å; D65-E69 WeakPolarHBondContact O-CB 3.49Å; D65-E69 PolarHBondContact O-N 3.02Å; E69-A71 PolarHBondContact O-N 3.43Å; E69-S72 PolarHBondContact O-N 3.39Å; E69-S72 PolarHBondContact O-OG 2.78Å; E69-Q73 WeakPolarHBondContact O-CB 3.41Å; E69-Q73 WeakPolarHBondContact O-CG 3.17Å; E69-Q73 PolarHBondContact O-N 3.45Å
70	G	81.8	Confident	79.5	Confident	38 Å²	38	93.1 Å²	93.1	39%	0.392	51%	0.508	S	S	.	.	H	α-helix	trans	-59.7	-41.4	175.3	0	0	0	0	0	113.7	A66 Q73 F74	A66-G70 PolarHBondContact O-N 2.85Å; G70-Q73 PolarHBondContact O-N 3.49Å; G70-F74 VanDerWaalsContact O-CB 3.3Å; G70-F74 WeakPolarHBondContact O-CB 3.23Å; G70-F74 PolarHBondContact O-N 2.69Å
71	A	83	Confident	79.4	Confident	51 Å²	51	92.3 Å²	92.3	42%	0.421	50%	0.504	S	S	.	.	H	α-helix	trans	-69.9	-39.2	177.2	0	0	0	0	0	111.4	L67 Q68 E69 Q73 F74 E75	L67-A71 WeakPolarHBondContact O-CA 3.42Å; L67-A71 WeakPolarHBondContact O-CB 3.3Å; L67-A71 PolarHBondContact O-N 2.79Å; Q68-A71 PolarHBondContact O-N 2.87Å; E69-A71 PolarHBondContact O-N 3.43Å; A71-Q73 VanDerWaalsContact C-N 3.33Å; A71-F74 CarbonylContact O-C 3.59Å; A71-F74 PolarHBondContact O-N 2.69Å; A71-E75 VanDerWaalsContact O-CB 3.27Å; A71-E75 WeakPolarHBondContact O-CB 3.01Å; A71-E75 PolarHBondContact O-N 3.36Å
72	S	77.6	Confident	79.4	Confident	34 Å²	34	94.9 Å²	94.9	24%	0.238	51%	0.51	C	S	.	.	H	α-helix	trans	-66.1	-37.5	173.8	80.9	0	0	0	0	111.2	Q68 E69 E75 K76	Q68-S72 VanDerWaalsContact O-CB 3.23Å; Q68-S72 WeakPolarHBondContact O-CB 3.2Å; Q68-S72 PolarHBondContact O-N 2.8Å; Q68-S72 PolarHBondContact O-OG 3.28Å; E69-S72 PolarHBondContact O-N 3.39Å; E69-S72 PolarHBondContact O-OG 2.78Å; S72-E75 PolarHBondContact O-N 3.4Å; S72-K76 VanDerWaalsContact O-CB 3.25Å; S72-K76 WeakPolarHBondContact O-CB 3.15Å; S72-K76 WeakPolarHBondContact O-CG 3.22Å; S72-K76 PolarHBondContact O-N 2.83Å
73	Q	78.2	Confident	79.3	Confident	102 Å²	102	98 Å²	98	48%	0.477	51%	0.514	S	S	.	.	H	α-helix	trans	-69.3	-39.3	174.4	-70.3	-71.5	86.2	0	0	110.9	E69 G70 A71 S77	E69-Q73 WeakPolarHBondContact O-CB 3.41Å; E69-Q73 WeakPolarHBondContact O-CG 3.17Å; E69-Q73 PolarHBondContact O-N 3.45Å; G70-Q73 PolarHBondContact O-N 3.49Å; A71-Q73 VanDerWaalsContact C-N 3.33Å; Q73-S77 WeakPolarHBondContact O-CB 3.27Å; Q73-S77 PolarHBondContact O-N 3.38Å; Q73-S77 PolarHBondContact O-OG 3.31Å
74	F	79.3	Confident	79.2	Confident	157 Å²	157	96.6 Å²	96.6	69%	0.689	51%	0.513	S	S	*	.	H	α-helix	trans	-66.3	-42.1	173.6	-175.7	-98.4	0	0	0	111.6	G70 A71 S77 A78	G70-F74 VanDerWaalsContact O-CB 3.3Å; G70-F74 WeakPolarHBondContact O-CB 3.23Å; G70-F74 PolarHBondContact O-N 2.69Å; A71-F74 CarbonylContact O-C 3.59Å; A71-F74 PolarHBondContact O-N 2.69Å; F74-S77 PolarHBondContact O-N 2.73Å; F74-A78 WeakPolarHBondContact O-CB 3.25Å; F74-A78 PolarHBondContact O-N 2.83Å
75	E	76.5	Confident	79	Confident	135 Å²	135	100.9 Å²	100.9	63%	0.631	52%	0.52	S	S	*	.	H	α-helix	trans	-62.7	-52.1	175.4	-172	-156.5	166.2	0	0	110.4	A71 S72 S77 A78 A79	A71-E75 VanDerWaalsContact O-CB 3.27Å; A71-E75 WeakPolarHBondContact O-CB 3.01Å; A71-E75 PolarHBondContact O-N 3.36Å; S72-E75 PolarHBondContact O-N 3.4Å; E75-S77 VanDerWaalsContact C-N 3.28Å; E75-S77 PolarHBondContact O-N 2.75Å; E75-A78 PolarHBondContact O-N 2.82Å; E75-A79 WeakPolarHBondContact O-CB 3.27Å; E75-A79 PolarHBondContact O-N 2.71Å
76	K	74.7	Confident	78.9	Confident	121 Å²	121	106.2 Å²	106.2	53%	0.526	53%	0.533	S	S	.	.	H	α-helix	trans	-57.7	-43.1	175.6	-74.8	170.5	-175.1	168	0	110.9	S72 T80	S72-K76 VanDerWaalsContact O-CB 3.25Å; S72-K76 WeakPolarHBondContact O-CB 3.15Å; S72-K76 WeakPolarHBondContact O-CG 3.22Å; S72-K76 PolarHBondContact O-N 2.83Å; K76-T80 VanDerWaalsContact O-CB 3.27Å; K76-T80 WeakPolarHBondContact O-CB 3.19Å; K76-T80 WeakPolarHBondContact O-CG2 3.34Å; K76-T80 PolarHBondContact O-N 3.38Å; K76-T80 PolarHBondContact O-OG1 3.27Å
77	S	71.6	Confident	78.9	Confident	58 Å²	58	110.7 Å²	110.7	41%	0.406	54%	0.537	S	S	.	.	H	α-helix	trans	-64.2	-51.6	177	-62.7	0	0	0	0	110.7	Q73 F74 E75 A79 T80 L81	Q73-S77 WeakPolarHBondContact O-CB 3.27Å; Q73-S77 PolarHBondContact O-N 3.38Å; Q73-S77 PolarHBondContact O-OG 3.31Å; F74-S77 PolarHBondContact O-N 2.73Å; E75-S77 VanDerWaalsContact C-N 3.28Å; E75-S77 PolarHBondContact O-N 2.75Å; S77-A79 PolarHBondContact O-N 3.4Å; S77-T80 PolarHBondContact O-N 2.79Å; S77-T80 PolarHBondContact O-OG1 2.97Å; S77-T80 VanDerWaalsContact O-OG1 3.14Å; S77-L81 VanDerWaalsContact O-CB 3.23Å; S77-L81 WeakPolarHBondContact O-CB 3.18Å; S77-L81 WeakPolarHBondContact O-CD1 3.23Å; S77-L81 PolarHBondContact O-N 2.84Å
78	A	77.5	Confident	79.1	Confident	34 Å²	34	110.3 Å²	110.3	28%	0.281	53%	0.53	S	S	.	.	H	α-helix	trans	-61.5	-41	179.8	0	0	0	0	0	112.4	F74 E75 K82	F74-A78 WeakPolarHBondContact O-CB 3.25Å; F74-A78 PolarHBondContact O-N 2.83Å; E75-A78 PolarHBondContact O-N 2.82Å; A78-K82 WeakPolarHBondContact O-CG 2.98Å; A78-K82 PolarHBondContact O-N 3.14Å
79	A	78.5	Confident	79.4	Confident	54 Å²	54	108.1 Å²	108.1	45%	0.446	52%	0.523	S	S	.	.	H	α-helix	trans	-69.3	-46.1	178.8	0	0	0	0	0	112	E75 S77 K82 R83	E75-A79 WeakPolarHBondContact O-CB 3.27Å; E75-A79 PolarHBondContact O-N 2.71Å; S77-A79 PolarHBondContact O-N 3.4Å; A79-K82 PolarHBondContact O-N 2.9Å; A79-R83 PolarHBondContact O-N 3.45Å
80	T	75.6	Confident	79.7	Confident	84 Å²	84	105.1 Å²	105.1	52%	0.515	52%	0.516	S	S	.	.	H	α-helix	trans	-68.6	-35.8	177.6	57.6	0	0	0	0	111.7	K76 S77 R83 K84	K76-T80 VanDerWaalsContact O-CB 3.27Å; K76-T80 WeakPolarHBondContact O-CB 3.19Å; K76-T80 WeakPolarHBondContact O-CG2 3.34Å; K76-T80 PolarHBondContact O-N 3.38Å; K76-T80 PolarHBondContact O-OG1 3.27Å; S77-T80 PolarHBondContact O-N 2.79Å; S77-T80 PolarHBondContact O-OG1 2.97Å; S77-T80 VanDerWaalsContact O-OG1 3.14Å; T80-R83 PolarHBondContact O-N 3.02Å; T80-K84 WeakPolarHBondContact O-CB 3.3Å; T80-K84 PolarHBondContact O-N 3.37Å
81	L	73.6	Confident	80.2	Confident	92 Å²	92	109.8 Å²	109.8	48%	0.482	53%	0.525	S	S	.	.	H	α-helix	trans	-57.7	-55.7	170.9	-94.1	67.1	0	0	0	109.6	S77 R83 K84 Y85	S77-L81 VanDerWaalsContact O-CB 3.23Å; S77-L81 WeakPolarHBondContact O-CB 3.18Å; S77-L81 WeakPolarHBondContact O-CD1 3.23Å; S77-L81 PolarHBondContact O-N 2.84Å; L81-R83 VanDerWaalsContact C-N 3.32Å; L81-R83 PolarHBondContact O-N 3.02Å; L81-K84 PolarHBondContact O-N 3.48Å; L81-Y85 HydrophobicContact CB-CD2 4.39Å; L81-Y85 HydrophobicContact CB-CE2 4.47Å; L81-Y85 HydrophobicContact CG-CE2 4.35Å; L81-Y85 WeakPolarHBondContact O-CD2 3.15Å; L81-Y85 PolarHBondContact O-N 3.05Å
82	K	79.3	Confident	80.6	Confident	154 Å²	154	112.5 Å²	112.5	67%	0.67	53%	0.531	S	S	*	.	H	α-helix	trans	-52.9	-48.9	179.1	-76.7	179.6	-179.6	-177.4	0	112	A78 A79 Y85 W86	A78-K82 WeakPolarHBondContact O-CG 2.98Å; A78-K82 PolarHBondContact O-N 3.14Å; A79-K82 PolarHBondContact O-N 2.9Å; K82-Y85 PolarHBondContact O-N 3.37Å; K82-W86 VanDerWaalsContact O-CD1 3.28Å; K82-W86 PolarHBondContact O-N 3.2Å
83	R	80.3	Confident	81.3	Confident	170 Å²	170	115.9 Å²	115.9	64%	0.642	55%	0.545	S	S	*	.	H	α-helix	trans	-66.2	-42.9	-179.3	-167.7	174	178.3	-179.6	0.8	112.5	A79 T80 L81 W86 W87	A79-R83 PolarHBondContact O-N 3.45Å; T80-R83 PolarHBondContact O-N 3.02Å; L81-R83 VanDerWaalsContact C-N 3.32Å; L81-R83 PolarHBondContact O-N 3.02Å; R83-W86 PolarHBondContact O-N 3.29Å; R83-W87 PolarHBondContact O-N 3.42Å; R83-W87 VanDerWaalsContact O-N 3.13Å
84	K	79	Confident	82.1	Confident	148 Å²	148	116.2 Å²	116.2	64%	0.643	55%	0.549	S	S	*	.	H	α-helix	trans	-65.4	-39.9	179.2	-167.4	174.6	-175.2	178	0	111.4	T80 L81 K88	T80-K84 WeakPolarHBondContact O-CB 3.3Å; T80-K84 PolarHBondContact O-N 3.37Å; L81-K84 PolarHBondContact O-N 3.48Å; K84-K88 HydrophobicContact CG-CD 4.38Å; K84-K88 WeakPolarHBondContact O-CB 3.39Å; K84-K88 VanDerWaalsContact O-CG 3.3Å; K84-K88 WeakPolarHBondContact O-CG 3.36Å; K84-K88 PolarHBondContact O-N 2.89Å
85	Y	79.6	Confident	82.9	Confident	139 Å²	139	113.1 Å²	113.1	55%	0.545	54%	0.539	S	S	.	.	H	α-helix	trans	-66.3	-41.3	174.8	-82.9	-75.8	0	0	0	112.3	L81 K82 W87 K88 N89	L81-Y85 HydrophobicContact CB-CD2 4.39Å; L81-Y85 HydrophobicContact CB-CE2 4.47Å; L81-Y85 HydrophobicContact CG-CE2 4.35Å; L81-Y85 WeakPolarHBondContact O-CD2 3.15Å; L81-Y85 PolarHBondContact O-N 3.05Å; K82-Y85 PolarHBondContact O-N 3.37Å; Y85-W87 VanDerWaalsContact C-N 3.35Å; Y85-W87 PolarHBondContact O-N 3.35Å; Y85-K88 PolarHBondContact O-N 3.48Å; Y85-N89 VanDerWaalsContact O-CB 3.27Å; Y85-N89 WeakPolarHBondContact O-CB 3.22Å; Y85-N89 PolarHBondContact O-N 2.84Å; Y85-N89 PolarHBondContact O-ND2 3.04Å; Y85-N89 PolarHBondContact O-OD1 3.4Å
86	W	81.4	Confident	83.8	Confident	200 Å²	200	111.2 Å²	111.2	76%	0.758	53%	0.532	S	S	*	.	H	α-helix	trans	-58.7	-45.7	175.5	-88.3	43.9	0	0	0	112.5	K82 R83 N89 C90	K82-W86 VanDerWaalsContact O-CD1 3.28Å; K82-W86 PolarHBondContact O-N 3.2Å; R83-W86 PolarHBondContact O-N 3.29Å; W86-N89 PolarHBondContact O-N 2.99Å; W86-C90 WeakPolarHBondContact O-CB 3.27Å; W86-C90 PolarHBondContact O-N 3.13Å
87	W	84.2	Confident	84.8	Confident	154 Å²	154	108.6 Å²	108.6	58%	0.583	53%	0.528	S	S	*	.	H	α-helix	trans	-69.6	-40.2	-179.9	-74.4	38.6	0	0	0	112	R83 Y85 K91	R83-W87 PolarHBondContact O-N 3.42Å; R83-W87 VanDerWaalsContact O-N 3.13Å; Y85-W87 VanDerWaalsContact C-N 3.35Å; Y85-W87 PolarHBondContact O-N 3.35Å; W87-K91 WeakPolarHBondContact O-CG 3.14Å; W87-K91 PolarHBondContact O-N 3.46Å
88	K	85.3	Confident	86	Confident	121 Å²	121	108.2 Å²	108.2	53%	0.526	53%	0.529	S	S	.	.	H	α-helix	trans	-64.1	-45.3	174.5	-75.4	-177.2	69.3	178.2	0	111.4	K84 Y85 C90 K91 M92	K84-K88 HydrophobicContact CG-CD 4.38Å; K84-K88 WeakPolarHBondContact O-CB 3.39Å; K84-K88 VanDerWaalsContact O-CG 3.3Å; K84-K88 WeakPolarHBondContact O-CG 3.36Å; K84-K88 PolarHBondContact O-N 2.89Å; Y85-K88 PolarHBondContact O-N 3.48Å; K88-C90 PolarHBondContact O-N 2.82Å; K88-K91 PolarHBondContact O-N 3.27Å; K88-M92 WeakPolarHBondContact O-CB 3.4Å; K88-M92 VanDerWaalsContact O-CG 3.22Å; K88-M92 WeakPolarHBondContact O-CG 3.47Å; K88-M92 PolarHBondContact O-N 3.48Å
89	N	88.8	Confident	86.9	Confident	89 Å²	89	111.2 Å²	111.2	48%	0.476	54%	0.539	S	S	.	.	H	α-helix	trans	-62.7	-43.3	179	-70.4	-10.6	0	0	0	111.4	Y85 W86 K91 M92 I93	Y85-N89 VanDerWaalsContact O-CB 3.27Å; Y85-N89 WeakPolarHBondContact O-CB 3.22Å; Y85-N89 PolarHBondContact O-N 2.84Å; Y85-N89 PolarHBondContact O-ND2 3.04Å; Y85-N89 PolarHBondContact O-OD1 3.4Å; W86-N89 PolarHBondContact O-N 2.99Å; N89-K91 PolarHBondContact O-N 3.06Å; N89-M92 PolarHBondContact O-N 3.27Å; N89-I93 VanDerWaalsContact O-CG1 3.3Å; N89-I93 WeakPolarHBondContact O-CG1 3.48Å; N89-I93 PolarHBondContact O-N 3.44Å
90	C	88.5	Confident	87.8	Confident	72 Å²	72	112.1 Å²	112.1	49%	0.486	54%	0.539	S	S	.	.	H	α-helix	trans	-60	-46.3	174.7	-176.1	0	0	0	0	111.9	W86 K88 M92 I93 I94	W86-C90 WeakPolarHBondContact O-CB 3.27Å; W86-C90 PolarHBondContact O-N 3.13Å; K88-C90 PolarHBondContact O-N 2.82Å; C90-M92 VanDerWaalsContact C-N 3.34Å; C90-M92 PolarHBondContact O-N 2.91Å; C90-I93 PolarHBondContact O-N 3.23Å; C90-I94 WeakPolarHBondContact O-CG1 3.3Å; C90-I94 PolarHBondContact O-N 3.34Å; C90-I94 VanDerWaalsContact O-N 3.09Å
91	K	91.6	Very high	88.8	Confident	136 Å²	136	113.1 Å²	113.1	59%	0.591	54%	0.54	S	S	*	.	H	α-helix	trans	-60.3	-41.7	174.1	-74.2	177.3	177.8	-176.9	0	112.5	W87 K88 N89 I94 I95	W87-K91 WeakPolarHBondContact O-CG 3.14Å; W87-K91 PolarHBondContact O-N 3.46Å; K88-K91 PolarHBondContact O-N 3.27Å; N89-K91 PolarHBondContact O-N 3.06Å; K91-I94 PolarHBondContact O-N 3.42Å; K91-I95 VanDerWaalsContact O-CG1 3.3Å; K91-I95 WeakPolarHBondContact O-CG1 3.36Å; K91-I95 PolarHBondContact O-N 3.01Å
92	M	90.8	Very high	90	Very high	108 Å²	108	112.8 Å²	112.8	53%	0.532	54%	0.542	S	S	.	.	H	α-helix	trans	-63	-41.7	177	-71.2	-63.9	-68.2	0	0	111.6	K88 N89 C90 I95 I96	K88-M92 WeakPolarHBondContact O-CB 3.4Å; K88-M92 VanDerWaalsContact O-CG 3.22Å; K88-M92 WeakPolarHBondContact O-CG 3.47Å; K88-M92 PolarHBondContact O-N 3.48Å; N89-M92 PolarHBondContact O-N 3.27Å; C90-M92 VanDerWaalsContact C-N 3.34Å; C90-M92 PolarHBondContact O-N 2.91Å; M92-I95 PolarHBondContact O-N 3.26Å; M92-I96 WeakPolarHBondContact O-CB 3.3Å; M92-I96 WeakPolarHBondContact O-CD1 3.22Å; M92-I96 WeakPolarHBondContact O-CG1 3.47Å; M92-I96 PolarHBondContact O-N 2.91Å
93	I	93.6	Very high	90.8	Very high	105 Å²	105	109.7 Å²	109.7	54%	0.538	53%	0.532	S	S	.	.	H	α-helix	trans	-60.8	-46.4	176.3	-69.7	164.3	0	0	0	110.7	N89 C90 I95 I96 C97	N89-I93 VanDerWaalsContact O-CG1 3.3Å; N89-I93 WeakPolarHBondContact O-CG1 3.48Å; N89-I93 PolarHBondContact O-N 3.44Å; C90-I93 PolarHBondContact O-N 3.23Å; I93-I95 VanDerWaalsContact C-N 3.34Å; I93-I95 PolarHBondContact O-N 3.4Å; I93-I96 PolarHBondContact O-N 3.37Å; I93-C97 PolarHBondContact O-N 3.49Å; I93-C97 PolarHBondContact O-SG 3.09Å
94	I	94.8	Very high	91.6	Very high	109 Å²	109	105.7 Å²	105.7	56%	0.559	52%	0.522	S	S	*	.	H	α-helix	trans	-60.3	-44.4	178.5	-66.4	167	0	0	0	111.2	C90 K91 C97 A98	C90-I94 WeakPolarHBondContact O-CG1 3.3Å; C90-I94 PolarHBondContact O-N 3.34Å; C90-I94 VanDerWaalsContact O-N 3.09Å; K91-I94 PolarHBondContact O-N 3.42Å; I94-C97 PolarHBondContact O-N 3.32Å; I94-A98 PolarHBondContact O-N 2.99Å
95	I	95	Very high	92.5	Very high	93 Å²	93	103.7 Å²	103.7	48%	0.477	52%	0.517	S	S	.	.	H	α-helix	trans	-63.3	-43.8	177.8	-67.6	166.1	0	0	0	110.8	K91 M92 I93 A98 I99	K91-I95 VanDerWaalsContact O-CG1 3.3Å; K91-I95 WeakPolarHBondContact O-CG1 3.36Å; K91-I95 PolarHBondContact O-N 3.01Å; M92-I95 PolarHBondContact O-N 3.26Å; I93-I95 VanDerWaalsContact C-N 3.34Å; I93-I95 PolarHBondContact O-N 3.4Å; I95-A98 PolarHBondContact O-N 3.35Å; I95-I99 HydrophobicContact CG2-CD1 3.92Å; I95-I99 WeakPolarHBondContact O-CG1 3.43Å; I95-I99 PolarHBondContact O-N 2.97Å
96	I	95.3	Very high	93.3	Very high	94 Å²	94	102.2 Å²	102.2	48%	0.482	52%	0.518	S	S	.	.	H	α-helix	trans	-60.8	-46.1	176.4	-70.3	164.5	0	0	0	110.5	M92 I93 A98 I99 V100	M92-I96 WeakPolarHBondContact O-CB 3.3Å; M92-I96 WeakPolarHBondContact O-CD1 3.22Å; M92-I96 WeakPolarHBondContact O-CG1 3.47Å; M92-I96 PolarHBondContact O-N 2.91Å; I93-I96 PolarHBondContact O-N 3.37Å; I96-A98 VanDerWaalsContact C-N 3.32Å; I96-A98 PolarHBondContact O-N 3.28Å; I96-I99 PolarHBondContact O-N 3Å; I96-V100 HydrophobicContact CG2-CG2 4.43Å; I96-V100 WeakPolarHBondContact O-CG2 3.33Å; I96-V100 PolarHBondContact O-N 3.36Å
97	C	95.9	Very high	94	Very high	66 Å²	66	97.1 Å²	97.1	45%	0.446	51%	0.505	S	S	.	.	H	α-helix	trans	-58.7	-42.7	176.1	-69.9	0	0	0	0	111.9	I93 I94 V100 L101	I93-C97 PolarHBondContact O-N 3.49Å; I93-C97 PolarHBondContact O-SG 3.09Å; I94-C97 PolarHBondContact O-N 3.32Å; C97-V100 PolarHBondContact O-N 3.24Å; C97-L101 WeakPolarHBondContact O-CG 3.32Å; C97-L101 PolarHBondContact O-N 3.47Å
98	A	96.9	Very high	94.5	Very high	51 Å²	51	94.1 Å²	94.1	42%	0.421	50%	0.503	S	S	.	.	H	α-helix	trans	-62.5	-43.5	177	0	0	0	0	0	112.1	I94 I95 I96 L101 V102	I94-A98 PolarHBondContact O-N 2.99Å; I95-A98 PolarHBondContact O-N 3.35Å; I96-A98 VanDerWaalsContact C-N 3.32Å; I96-A98 PolarHBondContact O-N 3.28Å; A98-L101 PolarHBondContact O-N 2.88Å; A98-V102 WeakPolarHBondContact O-CG2 3.33Å; A98-V102 PolarHBondContact O-N 3.25Å
99	I	97.1	Very high	95.1	Very high	97 Å²	97	92.6 Å²	92.6	50%	0.497	50%	0.503	S	S	.	.	H	α-helix	trans	-61.6	-45.6	176.3	-66.9	165.2	0	0	0	110.7	I95 I96 L101 V102 I103	I95-I99 HydrophobicContact CG2-CD1 3.92Å; I95-I99 WeakPolarHBondContact O-CG1 3.43Å; I95-I99 PolarHBondContact O-N 2.97Å; I96-I99 PolarHBondContact O-N 3Å; I99-L101 VanDerWaalsContact C-N 3.34Å; I99-L101 PolarHBondContact O-N 3.27Å; I99-V102 PolarHBondContact O-N 3.45Å; I99-I103 HydrophobicContact CG2-CD1 3.9Å; I99-I103 WeakPolarHBondContact O-CG1 3.34Å; I99-I103 PolarHBondContact O-N 2.95Å
100	V	97.5	Very high	95.4	Very high	73 Å²	73	96.8 Å²	96.8	44%	0.442	51%	0.513	S	S	.	.	H	α-helix	trans	-61	-43	177.6	172.1	0	0	0	0	111.1	I96 C97 V102 I103 I104	I96-V100 HydrophobicContact CG2-CG2 4.43Å; I96-V100 WeakPolarHBondContact O-CG2 3.33Å; I96-V100 PolarHBondContact O-N 3.36Å; C97-V100 PolarHBondContact O-N 3.24Å; V100-V102 PolarHBondContact O-N 2.95Å; V100-I103 PolarHBondContact O-N 3.27Å; V100-I104 HydrophobicContact CG1-CD1 3.89Å; V100-I104 HydrophobicContact CG1-CG1 4.49Å; V100-I104 VanDerWaalsContact O-CG1 3.3Å; V100-I104 WeakPolarHBondContact O-CG1 3.33Å; V100-I104 PolarHBondContact O-N 2.96Å
101	L	97.2	Very high	95.8	Very high	105 Å²	105	97.1 Å²	97.1	55%	0.55	51%	0.513	S	S	.	.	H	α-helix	trans	-61.7	-42.9	176.2	-74.6	174.2	0	0	0	112.4	C97 A98 I99 I103 I104 I105	C97-L101 WeakPolarHBondContact O-CG 3.32Å; C97-L101 PolarHBondContact O-N 3.47Å; A98-L101 PolarHBondContact O-N 2.88Å; I99-L101 VanDerWaalsContact C-N 3.34Å; I99-L101 PolarHBondContact O-N 3.27Å; L101-I103 VanDerWaalsContact C-N 3.34Å; L101-I103 PolarHBondContact O-N 2.98Å; L101-I104 PolarHBondContact O-N 2.93Å; L101-I105 WeakPolarHBondContact O-CG1 3.33Å; L101-I105 PolarHBondContact O-N 3.28Å
102	V	97.5	Very high	96	Very high	84 Å²	84	94.9 Å²	94.9	51%	0.509	51%	0.514	S	S	.	.	H	α-helix	trans	-61.9	-43.5	176.3	171.6	0	0	0	0	111	A98 I99 V100 I104 I105 I106	A98-V102 WeakPolarHBondContact O-CG2 3.33Å; A98-V102 PolarHBondContact O-N 3.25Å; I99-V102 PolarHBondContact O-N 3.45Å; V100-V102 PolarHBondContact O-N 2.95Å; V102-I104 VanDerWaalsContact C-N 3.34Å; V102-I104 PolarHBondContact O-N 2.95Å; V102-I105 PolarHBondContact O-N 3.49Å; V102-I106 HydrophobicContact CG1-CD1 3.92Å; V102-I106 WeakPolarHBondContact O-CG1 3.3Å; V102-I106 PolarHBondContact O-N 3.3Å
103	I	97.1	Very high	96.2	Very high	89 Å²	89	94.9 Å²	94.9	46%	0.456	52%	0.52	S	S	.	.	H	α-helix	trans	-61	-44.2	176.3	-67.8	167.3	0	0	0	110.7	I99 V100 L101 I105 I106 I107	I99-I103 HydrophobicContact CG2-CD1 3.9Å; I99-I103 WeakPolarHBondContact O-CG1 3.34Å; I99-I103 PolarHBondContact O-N 2.95Å; V100-I103 PolarHBondContact O-N 3.27Å; L101-I103 VanDerWaalsContact C-N 3.34Å; L101-I103 PolarHBondContact O-N 2.98Å; I103-I105 VanDerWaalsContact C-N 3.35Å; I103-I105 PolarHBondContact O-N 3.45Å; I103-I106 PolarHBondContact O-N 3.45Å; I103-I107 HydrophobicContact CG2-CD1 3.77Å; I103-I107 HydrophobicContact CG2-CG1 4.43Å; I103-I107 VanDerWaalsContact O-CG1 3.3Å; I103-I107 WeakPolarHBondContact O-CG1 3.3Å; I103-I107 PolarHBondContact O-N 3.49Å
104	I	97.1	Very high	96.1	Very high	87 Å²	87	94 Å²	94	45%	0.446	52%	0.524	S	S	.	.	H	α-helix	trans	-60.1	-45	176.8	-69.6	167.1	0	0	0	110.8	V100 L101 V102 I106 I107 V108	V100-I104 HydrophobicContact CG1-CD1 3.89Å; V100-I104 HydrophobicContact CG1-CG1 4.49Å; V100-I104 VanDerWaalsContact O-CG1 3.3Å; V100-I104 WeakPolarHBondContact O-CG1 3.33Å; V100-I104 PolarHBondContact O-N 2.96Å; L101-I104 PolarHBondContact O-N 2.93Å; V102-I104 VanDerWaalsContact C-N 3.34Å; V102-I104 PolarHBondContact O-N 2.95Å; I104-I106 VanDerWaalsContact C-N 3.35Å; I104-I106 PolarHBondContact O-N 3.31Å; I104-I107 PolarHBondContact O-N 2.92Å; I104-V108 HydrophobicContact CG2-CG2 4.29Å; I104-V108 VanDerWaalsContact O-CG2 3.3Å; I104-V108 WeakPolarHBondContact O-CG2 3.3Å; I104-V108 PolarHBondContact O-N 3.48Å
105	I	96.5	Very high	95.6	Very high	105 Å²	105	97.9 Å²	97.9	54%	0.538	55%	0.545	S	S	.	.	H	α-helix	trans	-61	-44.7	177.9	-68.3	165.4	0	0	0	110.8	L101 V102 I103 I107 V108 V109	L101-I105 WeakPolarHBondContact O-CG1 3.33Å; L101-I105 PolarHBondContact O-N 3.28Å; V102-I105 PolarHBondContact O-N 3.49Å; I103-I105 VanDerWaalsContact C-N 3.35Å; I103-I105 PolarHBondContact O-N 3.45Å; I105-I107 VanDerWaalsContact C-N 3.33Å; I105-I107 PolarHBondContact O-N 3.28Å; I105-V108 PolarHBondContact O-N 3.46Å; I105-V109 HydrophobicContact CG2-CG2 4.38Å; I105-V109 WeakPolarHBondContact O-CB 3.27Å; I105-V109 VanDerWaalsContact O-CG2 3.31Å; I105-V109 WeakPolarHBondContact O-CG2 3.48Å; I105-V109 PolarHBondContact O-N 2.89Å
106	I	96.3	Very high	95.7	Very high	108 Å²	108	98.1 Å²	98.1	55%	0.554	55%	0.549	S	S	*	.	H	α-helix	trans	-60.4	-44.4	177.4	-68.3	167.3	0	0	0	110.7	V102 I103 I104 V109 W110	V102-I106 HydrophobicContact CG1-CD1 3.92Å; V102-I106 WeakPolarHBondContact O-CG1 3.3Å; V102-I106 PolarHBondContact O-N 3.3Å; I103-I106 PolarHBondContact O-N 3.45Å; I104-I106 VanDerWaalsContact C-N 3.35Å; I104-I106 PolarHBondContact O-N 3.31Å; I106-V109 PolarHBondContact O-N 3.26Å; I106-W110 VanDerWaalsContact O-CB 3.27Å; I106-W110 WeakPolarHBondContact O-CB 3.34Å; I106-W110 PolarHBondContact O-N 2.88Å
107	I	96.2	Very high	95.7	Very high	94 Å²	94	98.3 Å²	98.3	48%	0.482	55%	0.552	S	S	.	*	H	α-helix	trans	-63.2	-45.7	178	-68.3	167.4	0	0	0	110.8	I103 I104 I105 V109 W110 V111	I103-I107 HydrophobicContact CG2-CD1 3.77Å; I103-I107 HydrophobicContact CG2-CG1 4.43Å; I103-I107 VanDerWaalsContact O-CG1 3.3Å; I103-I107 WeakPolarHBondContact O-CG1 3.3Å; I103-I107 PolarHBondContact O-N 3.49Å; I104-I107 PolarHBondContact O-N 2.92Å; I105-I107 VanDerWaalsContact C-N 3.33Å; I105-I107 PolarHBondContact O-N 3.28Å; I107-V109 PolarHBondContact O-N 3.29Å; I107-W110 PolarHBondContact O-N 3.11Å; I107-V111 HydrophobicContact CG2-CG2 4.36Å; I107-V111 WeakPolarHBondContact O-CB 3.31Å; I107-V111 WeakPolarHBondContact O-CG2 3.49Å; I107-V111 PolarHBondContact O-N 3.46Å
108	V	96.3	Very high	95.7	Very high	90 Å²	90	100.1 Å²	100.1	55%	0.545	56%	0.558	S	S	.	*	H	α-helix	trans	-61.7	-44.5	179.1	169.5	0	0	0	0	111.1	I104 I105 S112	I104-V108 HydrophobicContact CG2-CG2 4.29Å; I104-V108 VanDerWaalsContact O-CG2 3.3Å; I104-V108 WeakPolarHBondContact O-CG2 3.3Å; I104-V108 PolarHBondContact O-N 3.48Å; I105-V108 PolarHBondContact O-N 3.46Å; V108-S112 VanDerWaalsContact O-CB 3.27Å; V108-S112 WeakPolarHBondContact O-CB 3.28Å; V108-S112 PolarHBondContact O-N 2.9Å
109	V	96.4	Very high	95.6	Very high	89 Å²	89	103 Å²	103	54%	0.539	57%	0.566	S	S	.	*	H	α-helix	trans	-64.2	-44	176.7	171.7	0	0	0	0	110.8	I105 I106 I107 S112 T113	I105-V109 HydrophobicContact CG2-CG2 4.38Å; I105-V109 WeakPolarHBondContact O-CB 3.27Å; I105-V109 VanDerWaalsContact O-CG2 3.31Å; I105-V109 WeakPolarHBondContact O-CG2 3.48Å; I105-V109 PolarHBondContact O-N 2.89Å; I106-V109 PolarHBondContact O-N 3.26Å; I107-V109 PolarHBondContact O-N 3.29Å; V109-S112 PolarHBondContact O-N 2.89Å; V109-T113 WeakPolarHBondContact O-CB 3.49Å; V109-T113 VanDerWaalsContact O-CG2 3.28Å; V109-T113 WeakPolarHBondContact O-CG2 3.24Å; V109-T113 PolarHBondContact O-N 3.45Å
110	W	96.5	Very high	95.5	Very high	177 Å²	177	103.4 Å²	103.4	67%	0.67	57%	0.57	S	S	*	*	H	α-helix	trans	-63.7	-42.1	179.4	-172.9	77.4	0	0	0	112.6	I106 I107 T113 S114	I106-W110 VanDerWaalsContact O-CB 3.27Å; I106-W110 WeakPolarHBondContact O-CB 3.34Å; I106-W110 PolarHBondContact O-N 2.88Å; I107-W110 PolarHBondContact O-N 3.11Å; W110-T113 WeakPolarHBondContact O-CG2 3.27Å; W110-S114 VanDerWaalsContact O-CB 3.24Å; W110-S114 WeakPolarHBondContact O-CB 3.32Å; W110-S114 PolarHBondContact O-N 2.92Å; W110-S114 VanDerWaalsContact O-N 3.11Å
111	V	96.7	Very high	95.4	Very high	80 Å²	80	105.4 Å²	105.4	49%	0.485	58%	0.579	S	S	.	*	H	α-helix	trans	-66.4	-43.8	174.4	170.9	0	0	0	0	111	I107 T113 S114 N115	I107-V111 HydrophobicContact CG2-CG2 4.36Å; I107-V111 WeakPolarHBondContact O-CB 3.31Å; I107-V111 WeakPolarHBondContact O-CG2 3.49Å; I107-V111 PolarHBondContact O-N 3.46Å; V111-T113 VanDerWaalsContact C-N 3.35Å; V111-T113 PolarHBondContact O-N 3.32Å; V111-S114 PolarHBondContact O-N 3.23Å; V111-N115 PolarHBondContact O-N 3.36Å
112	S	95	Very high	95.3	Very high	89 Å²	89	105.4 Å²	105.4	62%	0.622	58%	0.581	S	S	*	*	H	α-helix	trans	-70.2	-26.7	-179	-174.1	0	0	0	0	114	V108 V109	V108-S112 VanDerWaalsContact O-CB 3.27Å; V108-S112 WeakPolarHBondContact O-CB 3.28Å; V108-S112 PolarHBondContact O-N 2.9Å; V109-S112 PolarHBondContact O-N 2.89Å
113	T	95.1	Very high	95.1	Very high	107 Å²	107	107.1 Å²	107.1	66%	0.656	59%	0.586	S	S	*	*	H	α-helix	trans	-86.7	-21.5	175.2	-172.2	0	0	0	0	112.9	V109 W110 V111	V109-T113 WeakPolarHBondContact O-CB 3.49Å; V109-T113 VanDerWaalsContact O-CG2 3.28Å; V109-T113 WeakPolarHBondContact O-CG2 3.24Å; V109-T113 PolarHBondContact O-N 3.45Å; W110-T113 WeakPolarHBondContact O-CG2 3.27Å; V111-T113 VanDerWaalsContact C-N 3.35Å; V111-T113 PolarHBondContact O-N 3.32Å
114	S	92.2	Very high	94.9	Very high	88 Å²	88	108.6 Å²	108.6	62%	0.615	60%	0.597	S	S	*	*	H	α-helix	trans	-85.5	-18.9	178.9	-176.5	0	0	0	0	113.1	W110 V111	W110-S114 VanDerWaalsContact O-CB 3.24Å; W110-S114 WeakPolarHBondContact O-CB 3.32Å; W110-S114 PolarHBondContact O-N 2.92Å; W110-S114 VanDerWaalsContact O-N 3.11Å; V111-S114 PolarHBondContact O-N 3.23Å
115	N	84.8	Confident	94.7	Very high	189 Å²	189	110.5 Å²	110.5	100%	1.011	61%	0.611	S	S	*	*			trans	-94.6	0	176.4	-167	107.9	0	0	0	111	V111	V111-N115 PolarHBondContact O-N 3.36Å

Retrieved 115 of 115 residues in 67.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).