A0A077Z468_TRITR Loading...

Dynein light chain

AlphaFold DB , UniProt , Accession A0A077Z468, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 96 aa.

						>A0A077Z468_TRITR|A0A077Z468
MADVQETIKRLQSQENVMGVILLDDIGRSVLSTLNSELTKQFAVVCQPLLEKTRQAMKELDPANSLSFFHVRAKKHEIMVSPDRNFSLLVILTPNE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	62.5	Low	87.6	Confident	185 Å²	185	101.5 Å²	101.5	91%	0.911	51%	0.511	S	S	*	.				0	-45.8	0	-70.7	-54.5	162.9	0	0	112.1	D3 V4 Q5	M1-D3 VanDerWaalsContact C-N 3.29Å; M1-D3 PolarHBondContact O-N 3.22Å; M1-V4 PolarHBondContact O-N 3.35Å; M1-Q5 PolarHBondContact O-N 3.36Å
2	A	76.6	Confident	88.1	Confident	71 Å²	71	100.3 Å²	100.3	59%	0.587	50%	0.501	S	S	*	.	H	α-helix	trans	-51.2	-47.4	175	0	0	0	0	0	112.4	V4 Q5 E6	A2-V4 VanDerWaalsContact C-N 3.31Å; A2-V4 PolarHBondContact O-N 2.92Å; A2-Q5 PolarHBondContact O-N 3.39Å; A2-E6 PolarHBondContact O-N 3Å
3	D	87.2	Confident	88.6	Confident	114 Å²	114	98.9 Å²	98.9	61%	0.61	51%	0.508	S	S	*	.	H	α-helix	trans	-62	-35.3	-178.1	-42	-29.8	0	0	0	113.5	M1 T7	M1-D3 VanDerWaalsContact C-N 3.29Å; M1-D3 PolarHBondContact O-N 3.22Å; D3-T7 WeakPolarHBondContact O-CB 3.38Å; D3-T7 PolarHBondContact O-N 3.07Å; D3-T7 PolarHBondContact O-OG1 3.31Å
4	V	86.2	Confident	89	Confident	66 Å²	66	99.1 Å²	99.1	40%	0.4	51%	0.505	S	S	.	.	H	α-helix	trans	-69	-45.7	179	177.1	0	0	0	0	109.8	M1 A2 T7 I8	M1-V4 PolarHBondContact O-N 3.35Å; A2-V4 VanDerWaalsContact C-N 3.31Å; A2-V4 PolarHBondContact O-N 2.92Å; V4-T7 PolarHBondContact O-N 3.16Å; V4-I8 HydrophobicContact CG1-CD1 3.74Å; V4-I8 WeakPolarHBondContact O-CD1 3.48Å; V4-I8 VanDerWaalsContact O-CG1 3.25Å; V4-I8 WeakPolarHBondContact O-CG1 3.5Å; V4-I8 PolarHBondContact O-N 2.88Å
5	Q	88.9	Confident	89	Confident	115 Å²	115	106.4 Å²	106.4	54%	0.537	54%	0.536	S	S	.	.	H	α-helix	trans	-65.8	-38.7	177.9	-70	-170.4	-26.7	0	0	112.2	M1 A2 I8 K9	M1-Q5 PolarHBondContact O-N 3.36Å; A2-Q5 PolarHBondContact O-N 3.39Å; Q5-I8 PolarHBondContact O-N 3.13Å; Q5-K9 WeakPolarHBondContact O-CB 3.36Å; Q5-K9 VanDerWaalsContact O-CG 3.31Å; Q5-K9 WeakPolarHBondContact O-CG 3.48Å; Q5-K9 PolarHBondContact O-N 3.36Å
6	E	92.7	Very high	89.3	Confident	137 Å²	137	102.8 Å²	102.8	64%	0.64	52%	0.519	S	S	*	.	H	α-helix	trans	-63.1	-44.2	174.4	-173.6	177.7	178.9	0	0	111.4	A2 I8 K9 R10	A2-E6 PolarHBondContact O-N 3Å; E6-I8 VanDerWaalsContact C-N 3.34Å; E6-I8 PolarHBondContact O-N 2.94Å; E6-K9 PolarHBondContact O-N 3.26Å; E6-R10 WeakPolarHBondContact O-CB 3.41Å; E6-R10 PolarHBondContact O-N 2.95Å
7	T	92.3	Very high	89.7	Confident	60 Å²	60	98.1 Å²	98.1	37%	0.368	50%	0.497	S	S	.	.	H	α-helix	trans	-61.6	-43.2	176.3	-59.9	0	0	0	0	111.5	D3 V4 R10 L11	D3-T7 WeakPolarHBondContact O-CB 3.38Å; D3-T7 PolarHBondContact O-N 3.07Å; D3-T7 PolarHBondContact O-OG1 3.31Å; V4-T7 PolarHBondContact O-N 3.16Å; T7-R10 WeakPolarHBondContact O-CB 3.39Å; T7-R10 PolarHBondContact O-N 3.32Å; T7-L11 HydrophobicContact CG2-CD1 4.47Å; T7-L11 WeakPolarHBondContact O-CG 3.36Å; T7-L11 PolarHBondContact O-N 2.92Å
8	I	93.7	Very high	90	Very high	14 Å²	14	96 Å²	96	7%	0.072	49%	0.486	C	S	.	.	H	α-helix	trans	-63.1	-45.1	176.7	-69.6	159.8	0	0	0	110.7	V4 Q5 E6 R10 L11 Q12 V20 L31 T33	V4-I8 HydrophobicContact CG1-CD1 3.74Å; V4-I8 WeakPolarHBondContact O-CD1 3.48Å; V4-I8 VanDerWaalsContact O-CG1 3.25Å; V4-I8 WeakPolarHBondContact O-CG1 3.5Å; V4-I8 PolarHBondContact O-N 2.88Å; Q5-I8 PolarHBondContact O-N 3.13Å; E6-I8 VanDerWaalsContact C-N 3.34Å; E6-I8 PolarHBondContact O-N 2.94Å; I8-R10 VanDerWaalsContact C-N 3.28Å; I8-R10 PolarHBondContact O-N 3.26Å; I8-L11 WeakPolarHBondContact O-CB 3.42Å; I8-L11 PolarHBondContact O-N 3.44Å; I8-L11 VanDerWaalsContact O-N 3.13Å; I8-Q12 HydrophobicContact CG2-CG 4.37Å; I8-Q12 WeakPolarHBondContact O-CG 3.38Å; I8-Q12 PolarHBondContact O-N 2.92Å; I8-V20 HydrophobicContact CG1-CG1 4.44Å; I8-V20 HydrophobicContact CG2-CB 4.4Å; I8-L31 HydrophobicContact CD1-CD1 3.49Å; I8-L31 VanDerWaalsContact CD1-CD1 3.49Å; I8-L31 HydrophobicContact CD1-CD2 3.57Å; I8-L31 HydrophobicContact CD1-CG 4.17Å; I8-L31 HydrophobicContact CG2-CD2 4.47Å; I8-T33 HydrophobicContact CG2-CG2 3.59Å
9	K	93.5	Very high	90.3	Very high	143 Å²	143	90.9 Å²	90.9	62%	0.622	46%	0.46	S	S	*	.	H	α-helix	trans	-58.8	-40.5	175.4	-75.7	176.3	-180	-178.9	0	111.9	Q5 E6 Q12 S13	Q5-K9 WeakPolarHBondContact O-CB 3.36Å; Q5-K9 VanDerWaalsContact O-CG 3.31Å; Q5-K9 WeakPolarHBondContact O-CG 3.48Å; Q5-K9 PolarHBondContact O-N 3.36Å; E6-K9 PolarHBondContact O-N 3.26Å; K9-Q12 PolarHBondContact O-N 2.91Å; K9-S13 PolarHBondContact O-N 2.79Å
10	R	94.9	Very high	90.7	Very high	165 Å²	165	86.5 Å²	86.5	62%	0.623	44%	0.437	S	S	*	.	H	α-helix	trans	-66.1	-36	176	-174.7	176.9	66.9	178.2	-0.8	112.9	E6 T7 I8 S13 Q14	E6-R10 WeakPolarHBondContact O-CB 3.41Å; E6-R10 PolarHBondContact O-N 2.95Å; T7-R10 WeakPolarHBondContact O-CB 3.39Å; T7-R10 PolarHBondContact O-N 3.32Å; I8-R10 VanDerWaalsContact C-N 3.28Å; I8-R10 PolarHBondContact O-N 3.26Å; R10-S13 PolarHBondContact O-OG 2.96Å; R10-Q14 PolarHBondContact O-NE2 3.33Å
11	L	95	Very high	90.9	Very high	47 Å²	47	82.3 Å²	82.3	25%	0.246	42%	0.417	C	S	.	.	H	α-helix	trans	-68.4	-43.7	173.5	-72.5	172.2	0	0	0	111	T7 I8 S13 Q14 V17 V20 L88 V90	T7-L11 HydrophobicContact CG2-CD1 4.47Å; T7-L11 WeakPolarHBondContact O-CG 3.36Å; T7-L11 PolarHBondContact O-N 2.92Å; I8-L11 WeakPolarHBondContact O-CB 3.42Å; I8-L11 PolarHBondContact O-N 3.44Å; I8-L11 VanDerWaalsContact O-N 3.13Å; L11-S13 PolarHBondContact O-N 3.4Å; L11-Q14 WeakPolarHBondContact O-CB 3.36Å; L11-Q14 WeakPolarHBondContact O-CG 3.31Å; L11-Q14 PolarHBondContact O-N 3.28Å; L11-V17 WeakPolarHBondContact O-CB 3.5Å; L11-V17 WeakPolarHBondContact O-CG2 3.25Å; L11-V20 HydrophobicContact CB-CG2 3.97Å; L11-V20 HydrophobicContact CD1-CG1 4.42Å; L11-V20 HydrophobicContact CD1-CG2 4.36Å; L11-L88 HydrophobicContact CD1-CD2 4.13Å; L11-V90 HydrophobicContact CD1-CG2 4.25Å
12	Q	94	Very high	92.5	Very high	86 Å²	86	75.2 Å²	75.2	40%	0.402	38%	0.382	S	S	.	.	H	α-helix	trans	-67.1	-21.6	177.7	-69.8	-173.7	-82.8	0	0	113.7	I8 K9 Q14 V20 T33	I8-Q12 HydrophobicContact CG2-CG 4.37Å; I8-Q12 WeakPolarHBondContact O-CG 3.38Å; I8-Q12 PolarHBondContact O-N 2.92Å; K9-Q12 PolarHBondContact O-N 2.91Å; Q12-Q14 PolarHBondContact O-N 3.2Å; Q12-V20 HydrophobicContact CG-CG2 4.27Å; Q12-T33 VanDerWaalsContact CD-CG2 3.44Å; Q12-T33 HydrophobicContact CG-CG2 4.16Å
13	S	93.9	Very high	93.4	Very high	83 Å²	83	71.9 Å²	71.9	58%	0.58	35%	0.354	S	S	*	.	T	Hydrogen-bonded Turn	trans	-76	-4	176.7	79.2	0	0	0	0	113.3	K9 R10 L11	K9-S13 PolarHBondContact O-N 2.79Å; R10-S13 PolarHBondContact O-OG 2.96Å; L11-S13 PolarHBondContact O-N 3.4Å
14	Q	94.6	Very high	93.7	Very high	101 Å²	101	67 Å²	67	47%	0.472	33%	0.328	S	S	.	.	S	Bend	trans	-80.8	133.8	174.3	-55.3	-56.9	-61.5	0	0	109.6	R10 L11 Q12 N16 V17	R10-Q14 PolarHBondContact O-NE2 3.33Å; L11-Q14 WeakPolarHBondContact O-CB 3.36Å; L11-Q14 WeakPolarHBondContact O-CG 3.31Å; L11-Q14 PolarHBondContact O-N 3.28Å; Q12-Q14 PolarHBondContact O-N 3.2Å; Q14-N16 VanDerWaalsContact C-N 3.26Å; Q14-N16 PolarHBondContact O-N 3.2Å; Q14-N16 VanDerWaalsContact O-N 3.16Å; Q14-V17 HydrophobicContact CB-CB 4.29Å; Q14-V17 HydrophobicContact CB-CG2 3.73Å; Q14-V17 HydrophobicContact CG-CG2 4.4Å; Q14-V17 PolarHBondContact O-N 2.73Å
15	E	89.4	Confident	94	Very high	209 Å²	209	68.5 Å²	68.5	98%	0.977	33%	0.334	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59	-33.1	-170.1	-64.5	-175.2	163	0	0	114.2
16	N	93.4	Very high	94	Very high	49 Å²	49	68 Å²	68	26%	0.262	33%	0.334	S	S	.	.	T	Hydrogen-bonded Turn	trans	-90.8	-4.2	-177.8	62.1	-12.4	0	0	0	113.7	Q14 M18 L92 T93	Q14-N16 VanDerWaalsContact C-N 3.26Å; Q14-N16 PolarHBondContact O-N 3.2Å; Q14-N16 VanDerWaalsContact O-N 3.16Å; N16-M18 PolarHBondContact O-N 3.25Å; N16-L92 HydrophobicContact CB-CD2 4.49Å; N16-L92 WeakPolarHBondContact ND2-CD2 3.38Å; N16-L92 CarbonylContact O-C 3.56Å; N16-L92 WeakPolarHBondContact O-CA 3.42Å; N16-L92 VanDerWaalsContact O-CB 3.29Å; N16-L92 WeakPolarHBondContact O-CB 3.08Å; N16-T93 PolarHBondContact O-N 2.95Å
17	V	96.1	Very high	94	Very high	22 Å²	22	62.1 Å²	62.1	13%	0.133	31%	0.31	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.2	109.7	-178	174.3	0	0	0	0	110.1	L11 Q14 V20 V90 L92	L11-V17 WeakPolarHBondContact O-CB 3.5Å; L11-V17 WeakPolarHBondContact O-CG2 3.25Å; Q14-V17 HydrophobicContact CB-CB 4.29Å; Q14-V17 HydrophobicContact CB-CG2 3.73Å; Q14-V17 HydrophobicContact CG-CG2 4.4Å; Q14-V17 PolarHBondContact O-N 2.73Å; V17-V20 HydrophobicContact CG1-CG2 4.14Å; V17-V90 HydrophobicContact CB-CG1 4.49Å; V17-V90 HydrophobicContact CG1-CG1 3.87Å; V17-V90 HydrophobicContact CG2-CG1 3.82Å; V17-L92 HydrophobicContact CG2-CD2 4.3Å; V17-L92 HydrophobicContact CG2-CG 4.33Å
18	M	95.1	Very high	94	Very high	61 Å²	61	66.8 Å²	66.8	30%	0.3	32%	0.321	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.7	-35.3	174.6	-170.7	-172.9	80.7	0	0	111.6	N16 L34 F42 I91	N16-M18 PolarHBondContact O-N 3.25Å; M18-L34 HydrophobicContact CE-CD1 4.05Å; M18-L34 HydrophobicContact CE-CD2 4.12Å; M18-L34 HydrophobicContact CG-CD2 4.43Å; M18-L34 WeakPolarHBondContact O-CD2 3.28Å; M18-F42 HydrophobicContact CE-CE2 3.66Å; M18-F42 HydrophobicContact CE-CZ 3.84Å; M18-I91 WeakPolarHBondContact CA-O 3.45Å; M18-I91 HydrophobicContact CB-CG2 4.48Å; M18-I91 WeakPolarHBondContact CB-O 3.27Å; M18-I91 HydrophobicContact CE-CB 4.1Å; M18-I91 HydrophobicContact CE-CG2 3.41Å; M18-I91 VanDerWaalsContact CE-CG2 3.41Å; M18-I91 PolarHBondContact N-O 3.45Å; M18-I91 HydrophobicContact SD-CG2 4.46Å
19	G	96.2	Very high	94.1	Very high	0 Å²	0	69 Å²	69	0%	0	34%	0.338	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-179.6	172.2	176.2	0	0	0	0	0	114.5	T33 I91	G19-T33 VanDerWaalsContact CA-OG1 3.28Å; G19-T33 WeakPolarHBondContact CA-OG1 3.42Å; G19-I91 PolarHBondContact N-O 3.07Å; G19-I91 VanDerWaalsContact N-O 3.14Å; G19-I91 WeakPolarHBondContact O-CD1 3.09Å; G19-I91 PolarHBondContact O-N 3.3Å
20	V	97.1	Very high	94.1	Very high	1 Å²	1	66.3 Å²	66.3	1%	0.006	33%	0.333	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.8	134.1	-177.8	-175.6	0	0	0	0	108.9	I8 L11 Q12 V17 S32 T33 L88 L89	I8-V20 HydrophobicContact CG1-CG1 4.44Å; I8-V20 HydrophobicContact CG2-CB 4.4Å; L11-V20 HydrophobicContact CB-CG2 3.97Å; L11-V20 HydrophobicContact CD1-CG1 4.42Å; L11-V20 HydrophobicContact CD1-CG2 4.36Å; Q12-V20 HydrophobicContact CG-CG2 4.27Å; V17-V20 HydrophobicContact CG1-CG2 4.14Å; V20-S32 WeakPolarHBondContact O-CA 3.44Å; V20-T33 HydrophobicContact CB-CG2 4.22Å; V20-T33 PolarHBondContact N-OG1 3.43Å; V20-T33 PolarHBondContact O-N 2.9Å; V20-L88 HydrophobicContact CG1-CD1 3.46Å; V20-L88 VanDerWaalsContact CG1-CD1 3.46Å; V20-L88 HydrophobicContact CG1-CG 4.42Å; V20-L89 CarbonylContact C-O 3.6Å; V20-L89 WeakPolarHBondContact CA-O 3.37Å
21	I	96.4	Very high	94.1	Very high	0 Å²	0	60.8 Å²	60.8	0%	0	32%	0.316	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.5	132.5	176.3	-51.2	171.7	0	0	0	108.7	L23 L31 L34 T39 F42 L89 I91	I21-L23 HydrophobicContact CG2-CD2 3.58Å; I21-L23 HydrophobicContact CG2-CG 4.12Å; I21-L31 CarbonylContact C-O 3.48Å; I21-L31 WeakPolarHBondContact CA-O 3.29Å; I21-L34 HydrophobicContact CD1-CD1 4.16Å; I21-L34 HydrophobicContact CG1-CD1 4.38Å; I21-T39 HydrophobicContact CD1-CG2 4.23Å; I21-T39 HydrophobicContact CG1-CG2 4.46Å; I21-T39 HydrophobicContact CG2-CG2 4.1Å; I21-F42 HydrophobicContact CD1-CB 3.64Å; I21-F42 HydrophobicContact CD1-CD2 4.31Å; I21-F42 HydrophobicContact CD1-CG 4.31Å; I21-L89 HydrophobicContact CB-CB 4.2Å; I21-L89 PolarHBondContact N-O 2.91Å; I21-L89 PolarHBondContact O-N 3.09Å; I21-I91 HydrophobicContact CD1-CD1 3.86Å; I21-I91 HydrophobicContact CG1-CD1 3.84Å
22	L	95.5	Very high	94.1	Very high	35 Å²	35	60.4 Å²	60.4	18%	0.183	32%	0.317	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.3	114.2	167.6	-171.3	68.3	0	0	0	108.5	S29 V30 L31 F86 L88	L22-S29 CarbonylContact O-C 3.59Å; L22-S29 WeakPolarHBondContact O-CA 3.08Å; L22-V30 HydrophobicContact CD2-CB 4.31Å; L22-V30 HydrophobicContact CD2-CG1 4.41Å; L22-V30 PolarHBondContact O-N 2.79Å; L22-L31 HydrophobicContact CB-CB 4.1Å; L22-L31 PolarHBondContact N-O 2.93Å; L22-L31 PolarHBondContact O-N 2.88Å; L22-F86 HydrophobicContact CD1-CB 3.81Å; L22-F86 HydrophobicContact CD1-CG 4.47Å; L22-F86 HydrophobicContact CD2-CD1 4.35Å; L22-F86 HydrophobicContact CG-CB 4.32Å; L22-F86 HydrophobicContact CG-CD1 4.32Å; L22-L88 HydrophobicContact CD1-CD1 4.41Å
23	L	95.6	Very high	94.2	Very high	1 Å²	1	58.3 Å²	58.3	1%	0.005	31%	0.31	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97	145	174.3	-59	-177.8	0	0	0	110.3	I21 R28 A43 F86 S87 L89	I21-L23 HydrophobicContact CG2-CD2 3.58Å; I21-L23 HydrophobicContact CG2-CG 4.12Å; L23-R28 CarbonylContact C-O 3.56Å; L23-R28 WeakPolarHBondContact CA-O 3.46Å; L23-A43 HydrophobicContact CD1-CB 4.27Å; L23-A43 HydrophobicContact CD2-CB 3.71Å; L23-F86 CarbonylContact O-C 3.57Å; L23-F86 WeakPolarHBondContact O-CA 3.46Å; L23-S87 PolarHBondContact N-O 3.16Å; L23-S87 PolarHBondContact O-N 3.38Å; L23-L89 HydrophobicContact CD1-CD1 3.73Å; L23-L89 HydrophobicContact CD1-CD2 3.78Å; L23-L89 HydrophobicContact CD1-CG 4.44Å; L23-L89 HydrophobicContact CG-CD1 3.92Å; L23-L89 HydrophobicContact CG-CD2 4.33Å
24	D	94.4	Very high	94.3	Very high	11 Å²	11	55.8 Å²	55.8	6%	0.059	29%	0.29	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.9	178	163.2	70.2	8.4	0	0	0	111.8	I26 G27 R28 V30 N85 F86	D24-I26 PolarHBondContact O-N 2.83Å; D24-I26 VanDerWaalsContact OD1-CG1 3.24Å; D24-I26 WeakPolarHBondContact OD1-CG1 3.42Å; D24-I26 PolarHBondContact OD1-N 2.91Å; D24-G27 PolarHBondContact O-N 3.06Å; D24-G27 PolarHBondContact OD1-N 3.23Å; D24-R28 PolarHBondContact N-O 3.35Å; D24-R28 WeakPolarHBondContact OD1-CB 3.45Å; D24-R28 PolarHBondContact OD1-N 3.14Å; D24-R28 IonicContact OD1-NE 2.74Å; D24-R28 IonicContact OD2-CZ 3.18Å; D24-R28 IonicContact OD2-NE 2.76Å; D24-R28 PolarHBondContact OD2-NE 2.77Å; D24-R28 IonicContact OD2-NH2 3.23Å; D24-R28 PolarHBondContact OD2-NH2 2.79Å; D24-V30 HydrophobicContact CB-CG2 4.01Å; D24-N85 CarbonylContact C-O 3.56Å; D24-N85 WeakPolarHBondContact CA-O 3.45Å; D24-F86 HydrophobicContact CB-CD1 4.4Å; D24-F86 HydrophobicContact CB-CE1 4.4Å
25	D	90.8	Very high	94.4	Very high	98 Å²	98	55.4 Å²	55.4	52%	0.524	29%	0.291	S	S	.	.	T	Hydrogen-bonded Turn	trans	-60.5	-22.3	-178.7	64.4	-28.7	0	0	0	114.5	Q47 N85	D25-Q47 PolarHBondContact O-NE2 3.35Å; D25-N85 PolarHBondContact N-O 2.88Å
26	I	90.5	Very high	94.7	Very high	105 Å²	105	50.4 Å²	50.4	54%	0.538	28%	0.28	S	S	.	.	T	Hydrogen-bonded Turn	trans	-100.4	5.6	175.6	69.6	170.7	0	0	0	113.3	D24 R28	D24-I26 PolarHBondContact O-N 2.83Å; D24-I26 VanDerWaalsContact OD1-CG1 3.24Å; D24-I26 WeakPolarHBondContact OD1-CG1 3.42Å; D24-I26 PolarHBondContact OD1-N 2.91Å; I26-R28 HydrophobicContact CD1-CG 4.2Å; I26-R28 VanDerWaalsContact CD1-CZ 3.4Å; I26-R28 HydrophobicContact CG1-CG 4.02Å
27	G	90.9	Very high	94.9	Very high	14 Å²	14	53.1 Å²	53.1	14%	0.144	29%	0.291	C	S	.	.	S	Bend	trans	84.1	17.2	174.8	0	0	0	0	0	115.5	D24	D24-G27 PolarHBondContact O-N 3.06Å; D24-G27 PolarHBondContact OD1-N 3.23Å
28	R	94.1	Very high	94.8	Very high	157 Å²	157	54.7 Å²	54.7	59%	0.592	30%	0.298	S	S	*	.			trans	-83.9	137.1	171.6	-61.8	176.6	-59.5	-165.4	-4.7	110.1	L23 D24 I26 V30	L23-R28 CarbonylContact C-O 3.56Å; L23-R28 WeakPolarHBondContact CA-O 3.46Å; D24-R28 PolarHBondContact N-O 3.35Å; D24-R28 WeakPolarHBondContact OD1-CB 3.45Å; D24-R28 PolarHBondContact OD1-N 3.14Å; D24-R28 IonicContact OD1-NE 2.74Å; D24-R28 IonicContact OD2-CZ 3.18Å; D24-R28 IonicContact OD2-NE 2.76Å; D24-R28 PolarHBondContact OD2-NE 2.77Å; D24-R28 IonicContact OD2-NH2 3.23Å; D24-R28 PolarHBondContact OD2-NH2 2.79Å; I26-R28 HydrophobicContact CD1-CG 4.2Å; I26-R28 VanDerWaalsContact CD1-CZ 3.4Å; I26-R28 HydrophobicContact CG1-CG 4.02Å; R28-V30 PolarHBondContact O-N 3.27Å
29	S	94.7	Very high	94.9	Very high	62 Å²	62	52 Å²	52	43%	0.434	29%	0.285	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.2	114.1	173.7	61	0	0	0	0	111.1	L22 T39	L22-S29 CarbonylContact O-C 3.59Å; L22-S29 WeakPolarHBondContact O-CA 3.08Å; S29-T39 VanDerWaalsContact CB-CG2 3.47Å
30	V	94	Very high	94.9	Very high	86 Å²	86	58.6 Å²	58.6	52%	0.521	31%	0.314	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.1	-36.6	171.8	-179.1	0	0	0	0	110.3	L22 D24 R28 F86	L22-V30 HydrophobicContact CD2-CB 4.31Å; L22-V30 HydrophobicContact CD2-CG1 4.41Å; L22-V30 PolarHBondContact O-N 2.79Å; D24-V30 HydrophobicContact CB-CG2 4.01Å; R28-V30 PolarHBondContact O-N 3.27Å; V30-F86 HydrophobicContact CG2-CD1 4.23Å; V30-F86 HydrophobicContact CG2-CE1 3.98Å
31	L	94.3	Very high	94.8	Very high	49 Å²	49	63.2 Å²	63.2	26%	0.257	34%	0.335	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.9	138.2	176.6	-172.4	155.6	0	0	0	108.3	I8 I21 L22 T33	I8-L31 HydrophobicContact CD1-CD1 3.49Å; I8-L31 VanDerWaalsContact CD1-CD1 3.49Å; I8-L31 HydrophobicContact CD1-CD2 3.57Å; I8-L31 HydrophobicContact CD1-CG 4.17Å; I8-L31 HydrophobicContact CG2-CD2 4.47Å; I21-L31 CarbonylContact C-O 3.48Å; I21-L31 WeakPolarHBondContact CA-O 3.29Å; L22-L31 HydrophobicContact CB-CB 4.1Å; L22-L31 PolarHBondContact N-O 2.93Å; L22-L31 PolarHBondContact O-N 2.88Å; L31-T33 HydrophobicContact CD2-CG2 4.33Å
32	S	95.8	Very high	94.8	Very high	39 Å²	39	64.2 Å²	64.2	27%	0.273	34%	0.339	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.2	143.5	168.8	-179.4	0	0	0	0	110.1	V20 L34 T39	V20-S32 WeakPolarHBondContact O-CA 3.44Å; S32-L34 PolarHBondContact OG-N 2.85Å; S32-T39 VanDerWaalsContact CB-CG2 3.48Å; S32-T39 WeakPolarHBondContact CB-OG1 3.35Å; S32-T39 PolarHBondContact OG-OG1 2.7Å
33	T	96.3	Very high	94.8	Very high	42 Å²	42	63 Å²	63	26%	0.258	33%	0.334	S	S	.	.	S	Bend	trans	-95.4	-3.1	170.8	72.3	0	0	0	0	112.4	I8 Q12 G19 V20 L31	I8-T33 HydrophobicContact CG2-CG2 3.59Å; Q12-T33 VanDerWaalsContact CD-CG2 3.44Å; Q12-T33 HydrophobicContact CG-CG2 4.16Å; G19-T33 VanDerWaalsContact CA-OG1 3.28Å; G19-T33 WeakPolarHBondContact CA-OG1 3.42Å; V20-T33 HydrophobicContact CB-CG2 4.22Å; V20-T33 PolarHBondContact N-OG1 3.43Å; V20-T33 PolarHBondContact O-N 2.9Å; L31-T33 HydrophobicContact CD2-CG2 4.33Å
34	L	96	Very high	94.8	Very high	29 Å²	29	67.4 Å²	67.4	15%	0.152	36%	0.361	C	S	.	.	S	Bend	trans	-94	166.4	176.6	-61.4	178.9	0	0	0	110.7	M18 I21 S32 L38 T39 F42 I91	M18-L34 HydrophobicContact CE-CD1 4.05Å; M18-L34 HydrophobicContact CE-CD2 4.12Å; M18-L34 HydrophobicContact CG-CD2 4.43Å; M18-L34 WeakPolarHBondContact O-CD2 3.28Å; I21-L34 HydrophobicContact CD1-CD1 4.16Å; I21-L34 HydrophobicContact CG1-CD1 4.38Å; S32-L34 PolarHBondContact OG-N 2.85Å; L34-L38 HydrophobicContact CB-CB 4.31Å; L34-L38 HydrophobicContact CD1-CB 4.33Å; L34-T39 PolarHBondContact O-OG1 3.44Å; L34-F42 HydrophobicContact CD1-CD2 3.81Å; L34-F42 HydrophobicContact CD1-CE2 3.92Å; L34-I91 HydrophobicContact CD1-CD1 4.22Å; L34-I91 HydrophobicContact CD1-CG1 4.44Å
35	N	96.3	Very high	94.7	Very high	93 Å²	93	71.4 Å²	71.4	50%	0.497	39%	0.386	S	S	.	.			trans	-62.9	158.2	168.4	68.6	52.6	0	0	0	111.1	E37 L38 T39	N35-E37 VanDerWaalsContact C-N 3.28Å; N35-E37 PolarHBondContact O-N 2.86Å; N35-E37 PolarHBondContact OD1-N 2.85Å; N35-L38 WeakPolarHBondContact ND2-CD1 3.44Å; N35-L38 PolarHBondContact O-N 2.85Å; N35-L38 WeakPolarHBondContact OD1-CB 3.1Å; N35-L38 WeakPolarHBondContact OD1-CG 3.43Å; N35-L38 PolarHBondContact OD1-N 2.8Å; N35-T39 WeakPolarHBondContact O-CB 3.35Å; N35-T39 PolarHBondContact O-N 2.98Å; N35-T39 PolarHBondContact O-OG1 2.65Å
36	S	95.1	Very high	94.9	Very high	105 Å²	105	66.9 Å²	66.9	73%	0.734	36%	0.362	S	S	*	.	H	α-helix	trans	-59.8	-36.4	-173.9	51	0	0	0	0	113.4	K40	S36-K40 WeakPolarHBondContact O-CB 3.33Å; S36-K40 PolarHBondContact O-N 2.96Å
37	E	96.9	Very high	95	Very high	106 Å²	106	63.1 Å²	63.1	50%	0.495	34%	0.342	S	S	.	.	H	α-helix	trans	-66.1	-53.5	-179.9	-177.4	55	-144.9	0	0	111.5	N35 T39 K40 Q41	N35-E37 VanDerWaalsContact C-N 3.28Å; N35-E37 PolarHBondContact O-N 2.86Å; N35-E37 PolarHBondContact OD1-N 2.85Å; E37-T39 VanDerWaalsContact C-N 3.3Å; E37-T39 PolarHBondContact O-N 2.96Å; E37-K40 PolarHBondContact O-N 3.42Å; E37-Q41 WeakPolarHBondContact O-CG 3.41Å; E37-Q41 PolarHBondContact O-N 2.87Å; E37-Q41 PolarHBondContact OE1-NE2 2.81Å
38	L	95.4	Very high	95.2	Very high	54 Å²	54	65.5 Å²	65.5	28%	0.283	36%	0.355	S	S	.	.	H	α-helix	trans	-61	-41.7	176.3	-70.3	178.2	0	0	0	111.4	L34 N35 K40 Q41 F42	L34-L38 HydrophobicContact CB-CB 4.31Å; L34-L38 HydrophobicContact CD1-CB 4.33Å; N35-L38 WeakPolarHBondContact ND2-CD1 3.44Å; N35-L38 PolarHBondContact O-N 2.85Å; N35-L38 WeakPolarHBondContact OD1-CB 3.1Å; N35-L38 WeakPolarHBondContact OD1-CG 3.43Å; N35-L38 PolarHBondContact OD1-N 2.8Å; L38-K40 VanDerWaalsContact C-N 3.29Å; L38-K40 PolarHBondContact O-N 3.29Å; L38-Q41 PolarHBondContact O-N 3.31Å; L38-F42 HydrophobicContact CB-CD2 4.47Å; L38-F42 HydrophobicContact CB-CE2 4.42Å; L38-F42 WeakPolarHBondContact O-CD2 3.48Å; L38-F42 PolarHBondContact O-N 3.5Å
39	T	97.4	Very high	95.2	Very high	4 Å²	4	61 Å²	61	3%	0.025	34%	0.343	C	S	.	.	H	α-helix	trans	-55.2	-47.7	177.1	-57.9	0	0	0	0	111.1	I21 S29 S32 L34 N35 E37 F42 A43	I21-T39 HydrophobicContact CD1-CG2 4.23Å; I21-T39 HydrophobicContact CG1-CG2 4.46Å; I21-T39 HydrophobicContact CG2-CG2 4.1Å; S29-T39 VanDerWaalsContact CB-CG2 3.47Å; S32-T39 VanDerWaalsContact CB-CG2 3.48Å; S32-T39 WeakPolarHBondContact CB-OG1 3.35Å; S32-T39 PolarHBondContact OG-OG1 2.7Å; L34-T39 PolarHBondContact O-OG1 3.44Å; N35-T39 WeakPolarHBondContact O-CB 3.35Å; N35-T39 PolarHBondContact O-N 2.98Å; N35-T39 PolarHBondContact O-OG1 2.65Å; E37-T39 VanDerWaalsContact C-N 3.3Å; E37-T39 PolarHBondContact O-N 2.96Å; T39-F42 PolarHBondContact O-N 2.82Å; T39-A43 VanDerWaalsContact O-CB 3.32Å; T39-A43 WeakPolarHBondContact O-CB 3.35Å; T39-A43 PolarHBondContact O-N 3.1Å
40	K	96.3	Very high	95.1	Very high	139 Å²	139	58.2 Å²	58.2	60%	0.604	32%	0.323	S	S	*	.	H	α-helix	trans	-64.6	-43	178.4	-172.7	-179.9	179.4	-176.1	0	111.6	S36 E37 L38 A43 V44	S36-K40 WeakPolarHBondContact O-CB 3.33Å; S36-K40 PolarHBondContact O-N 2.96Å; E37-K40 PolarHBondContact O-N 3.42Å; L38-K40 VanDerWaalsContact C-N 3.29Å; L38-K40 PolarHBondContact O-N 3.29Å; K40-A43 PolarHBondContact O-N 3.16Å; K40-V44 HydrophobicContact CG-CG2 4.33Å; K40-V44 WeakPolarHBondContact O-CB 3.21Å; K40-V44 VanDerWaalsContact O-CG2 3.24Å; K40-V44 WeakPolarHBondContact O-CG2 3.4Å; K40-V44 PolarHBondContact O-N 2.86Å
41	Q	95	Very high	95.1	Very high	99 Å²	99	58 Å²	58	46%	0.463	32%	0.316	S	S	.	.	H	α-helix	trans	-59.8	-48.2	178.1	-70.7	176.9	8.8	0	0	111.8	E37 L38 V45	E37-Q41 WeakPolarHBondContact O-CG 3.41Å; E37-Q41 PolarHBondContact O-N 2.87Å; E37-Q41 PolarHBondContact OE1-NE2 2.81Å; L38-Q41 PolarHBondContact O-N 3.31Å; Q41-V45 WeakPolarHBondContact O-CG2 3.43Å; Q41-V45 PolarHBondContact O-N 3.34Å
42	F	95.3	Very high	95.1	Very high	20 Å²	20	62.6 Å²	62.6	9%	0.088	33%	0.334	C	S	.	.	H	α-helix	trans	-64.5	-42.2	176.8	-75.9	-66.5	0	0	0	112.2	M18 I21 L34 L38 T39 V45 C46 I78 I91	M18-F42 HydrophobicContact CE-CE2 3.66Å; M18-F42 HydrophobicContact CE-CZ 3.84Å; I21-F42 HydrophobicContact CD1-CB 3.64Å; I21-F42 HydrophobicContact CD1-CD2 4.31Å; I21-F42 HydrophobicContact CD1-CG 4.31Å; L34-F42 HydrophobicContact CD1-CD2 3.81Å; L34-F42 HydrophobicContact CD1-CE2 3.92Å; L38-F42 HydrophobicContact CB-CD2 4.47Å; L38-F42 HydrophobicContact CB-CE2 4.42Å; L38-F42 WeakPolarHBondContact O-CD2 3.48Å; L38-F42 PolarHBondContact O-N 3.5Å; T39-F42 PolarHBondContact O-N 2.82Å; F42-V45 PolarHBondContact O-N 2.84Å; F42-C46 VanDerWaalsContact O-CB 3.24Å; F42-C46 WeakPolarHBondContact O-CB 3.45Å; F42-C46 PolarHBondContact O-N 2.98Å; F42-C46 PolarHBondContact O-SG 2.84Å; F42-I78 HydrophobicContact CD1-CD1 3.83Å; F42-I78 HydrophobicContact CE1-CD1 3.89Å; F42-I78 HydrophobicContact CE1-CG1 4.32Å; F42-I91 HydrophobicContact CD1-CG1 4.11Å; F42-I91 HydrophobicContact CD2-CG1 4.18Å; F42-I91 HydrophobicContact CE1-CG1 4.16Å; F42-I91 HydrophobicContact CE1-CG2 3.85Å; F42-I91 HydrophobicContact CE2-CG1 4.26Å; F42-I91 HydrophobicContact CE2-CG2 4.12Å; F42-I91 HydrophobicContact CG-CG1 4.14Å; F42-I91 HydrophobicContact CZ-CG1 4.26Å; F42-I91 HydrophobicContact CZ-CG2 3.59Å
43	A	95.4	Very high	95	Very high	9 Å²	9	62.8 Å²	62.8	7%	0.074	33%	0.333	C	S	.	.	H	α-helix	trans	-60.9	-46.1	178.4	0	0	0	0	0	112.5	L23 T39 K40 V45 C46 Q47	L23-A43 HydrophobicContact CD1-CB 4.27Å; L23-A43 HydrophobicContact CD2-CB 3.71Å; T39-A43 VanDerWaalsContact O-CB 3.32Å; T39-A43 WeakPolarHBondContact O-CB 3.35Å; T39-A43 PolarHBondContact O-N 3.1Å; K40-A43 PolarHBondContact O-N 3.16Å; A43-V45 VanDerWaalsContact C-N 3.28Å; A43-V45 PolarHBondContact O-N 3.5Å; A43-C46 PolarHBondContact O-N 2.94Å; A43-Q47 WeakPolarHBondContact O-CB 3.4Å; A43-Q47 PolarHBondContact O-N 2.89Å
44	V	95.1	Very high	94.8	Very high	95 Å²	95	63.7 Å²	63.7	58%	0.576	33%	0.332	S	S	*	.	H	α-helix	trans	-61.8	-35.3	179.6	168.3	0	0	0	0	112	K40 P48	K40-V44 HydrophobicContact CG-CG2 4.33Å; K40-V44 WeakPolarHBondContact O-CB 3.21Å; K40-V44 VanDerWaalsContact O-CG2 3.24Å; K40-V44 WeakPolarHBondContact O-CG2 3.4Å; K40-V44 PolarHBondContact O-N 2.86Å; V44-P48 WeakPolarHBondContact O-CD 3.42Å; V44-P48 WeakPolarHBondContact O-CG 3.44Å
45	V	93.5	Very high	94.7	Very high	94 Å²	94	67.8 Å²	67.8	57%	0.57	35%	0.35	S	S	*	.	H	α-helix	trans	-81.5	-44	179.1	174.5	0	0	0	0	111.7	Q41 F42 A43 L49	Q41-V45 WeakPolarHBondContact O-CG2 3.43Å; Q41-V45 PolarHBondContact O-N 3.34Å; F42-V45 PolarHBondContact O-N 2.84Å; A43-V45 VanDerWaalsContact C-N 3.28Å; A43-V45 PolarHBondContact O-N 3.5Å; V45-L49 WeakPolarHBondContact O-CB 3.32Å
46	C	94.2	Very high	94.7	Very high	3 Å²	3	65.5 Å²	65.5	2%	0.02	34%	0.344	C	S	.	.	H	α-helix	trans	-77.7	-34.3	-171.3	-65.1	0	0	0	0	113.1	F42 A43 L49 L50 L89	F42-C46 VanDerWaalsContact O-CB 3.24Å; F42-C46 WeakPolarHBondContact O-CB 3.45Å; F42-C46 PolarHBondContact O-N 2.98Å; F42-C46 PolarHBondContact O-SG 2.84Å; A43-C46 PolarHBondContact O-N 2.94Å; C46-L49 PolarHBondContact O-N 2.86Å; C46-L50 WeakPolarHBondContact O-CB 3.37Å; C46-L50 PolarHBondContact O-N 3.36Å; C46-L89 HydrophobicContact CB-CD2 3.53Å; C46-L89 HydrophobicContact CB-CG 4.37Å
47	Q	93.7	Very high	94.6	Very high	26 Å²	26	63.1 Å²	63.1	12%	0.121	32%	0.323	C	S	.	.	H	α-helix	trans	-61.4	-51.6	-177.5	-175.9	67.3	18.1	0	0	112.1	D25 A43 L49 L50 E51	D25-Q47 PolarHBondContact O-NE2 3.35Å; A43-Q47 WeakPolarHBondContact O-CB 3.4Å; A43-Q47 PolarHBondContact O-N 2.89Å; Q47-L49 VanDerWaalsContact C-N 3.27Å; Q47-L49 PolarHBondContact O-N 2.96Å; Q47-L50 PolarHBondContact O-N 3.02Å; Q47-E51 PolarHBondContact O-N 2.84Å; Q47-E51 VanDerWaalsContact O-N 3.16Å
48	P	94	Very high	94.4	Very high	65 Å²	65	64.5 Å²	64.5	42%	0.422	33%	0.327	S	S	.	.	H	α-helix	trans	-66.5	-30.7	177	-19.3	33.8	0	0	0	112.8	V44 K52	V44-P48 WeakPolarHBondContact O-CD 3.42Å; V44-P48 WeakPolarHBondContact O-CG 3.44Å; P48-K52 WeakPolarHBondContact O-CB 3.49Å; P48-K52 VanDerWaalsContact O-CG 3.27Å; P48-K52 WeakPolarHBondContact O-CG 3.32Å; P48-K52 PolarHBondContact O-N 3.17Å; P48-K52 VanDerWaalsContact O-N 3.07Å
49	L	94.1	Very high	94.5	Very high	63 Å²	63	68.5 Å²	68.5	33%	0.33	34%	0.344	S	S	.	.	H	α-helix	trans	-67.2	-43.6	177.3	179.8	60.2	0	0	0	111.5	V45 C46 Q47 K52 T53 F69 V71	V45-L49 WeakPolarHBondContact O-CB 3.32Å; C46-L49 PolarHBondContact O-N 2.86Å; Q47-L49 VanDerWaalsContact C-N 3.27Å; Q47-L49 PolarHBondContact O-N 2.96Å; L49-K52 PolarHBondContact O-N 3.18Å; L49-T53 WeakPolarHBondContact O-CB 3.4Å; L49-T53 PolarHBondContact O-N 3Å; L49-T53 PolarHBondContact O-OG1 3.25Å; L49-F69 HydrophobicContact CD2-CE2 4.01Å; L49-F69 HydrophobicContact CD2-CZ 4.49Å; L49-F69 HydrophobicContact CG-CE2 4.18Å; L49-F69 HydrophobicContact CG-CZ 4.34Å; L49-V71 HydrophobicContact CD2-CG2 3.99Å
50	L	93.3	Very high	94.4	Very high	3 Å²	3	75.1 Å²	75.1	2%	0.016	38%	0.378	C	S	.	.	H	α-helix	trans	-59.9	-49	176	170.8	62.7	0	0	0	110.9	C46 Q47 K52 T53 R54 L66 F69 V80 P82 S87	C46-L50 WeakPolarHBondContact O-CB 3.37Å; C46-L50 PolarHBondContact O-N 3.36Å; Q47-L50 PolarHBondContact O-N 3.02Å; L50-K52 PolarHBondContact O-N 3.23Å; L50-T53 PolarHBondContact O-N 3.4Å; L50-R54 HydrophobicContact CD1-CG 4.06Å; L50-R54 WeakPolarHBondContact O-CB 3.4Å; L50-R54 WeakPolarHBondContact O-CG 3.24Å; L50-R54 PolarHBondContact O-N 3.44Å; L50-L66 HydrophobicContact CD1-CD2 3.63Å; L50-F69 HydrophobicContact CB-CE1 4.37Å; L50-F69 HydrophobicContact CB-CZ 4.46Å; L50-F69 HydrophobicContact CD1-CE1 3.73Å; L50-V80 HydrophobicContact CD1-CG1 4.48Å; L50-P82 HydrophobicContact CD1-CB 3.53Å; L50-P82 HydrophobicContact CD1-CG 3.72Å; L50-P82 HydrophobicContact CD2-CB 4.15Å; L50-P82 HydrophobicContact CG-CB 4.47Å; L50-S87 WeakPolarHBondContact CD2-OG 3.38Å
51	E	93.3	Very high	94.3	Very high	81 Å²	81	71.2 Å²	71.2	38%	0.379	36%	0.364	S	S	.	.	H	α-helix	trans	-62.8	-43.1	-179.2	-70.9	-53.7	125.1	0	0	112.2	Q47 T53 R54 Q55	Q47-E51 PolarHBondContact O-N 2.84Å; Q47-E51 VanDerWaalsContact O-N 3.16Å; E51-T53 VanDerWaalsContact C-N 3.34Å; E51-T53 PolarHBondContact O-N 2.82Å; E51-R54 PolarHBondContact O-N 2.68Å; E51-R54 IonicContact OE1-NH1 3.72Å; E51-R54 PolarHBondContact OE1-NH1 2.71Å; E51-Q55 WeakPolarHBondContact O-CB 3.43Å; E51-Q55 PolarHBondContact O-N 3.2Å
52	K	94.5	Very high	94.3	Very high	146 Å²	146	71.9 Å²	71.9	64%	0.635	38%	0.377	S	S	*	.	H	α-helix	trans	-62.1	-41.2	173.9	-73.6	175.6	-178.9	-176.2	0	112.5	P48 L49 L50 Q55 A56	P48-K52 WeakPolarHBondContact O-CB 3.49Å; P48-K52 VanDerWaalsContact O-CG 3.27Å; P48-K52 WeakPolarHBondContact O-CG 3.32Å; P48-K52 PolarHBondContact O-N 3.17Å; P48-K52 VanDerWaalsContact O-N 3.07Å; L49-K52 PolarHBondContact O-N 3.18Å; L50-K52 PolarHBondContact O-N 3.23Å; K52-Q55 PolarHBondContact O-N 2.91Å; K52-A56 WeakPolarHBondContact O-CB 3.16Å; K52-A56 PolarHBondContact O-N 3.47Å
53	T	94	Very high	94.3	Very high	42 Å²	42	75.3 Å²	75.3	26%	0.258	41%	0.409	S	S	.	.	H	α-helix	trans	-67.6	-41	179.5	-54	0	0	0	0	110.9	L49 L50 E51 A56 M57 L66	L49-T53 WeakPolarHBondContact O-CB 3.4Å; L49-T53 PolarHBondContact O-N 3Å; L49-T53 PolarHBondContact O-OG1 3.25Å; L50-T53 PolarHBondContact O-N 3.4Å; E51-T53 VanDerWaalsContact C-N 3.34Å; E51-T53 PolarHBondContact O-N 2.82Å; T53-A56 PolarHBondContact O-N 2.85Å; T53-M57 WeakPolarHBondContact O-CB 3.37Å; T53-M57 PolarHBondContact O-N 2.84Å; T53-L66 HydrophobicContact CG2-CD1 3.87Å; T53-L66 HydrophobicContact CG2-CD2 3.69Å; T53-L66 HydrophobicContact CG2-CG 4.43Å
54	R	92.7	Very high	94	Very high	61 Å²	61	79.1 Å²	79.1	23%	0.23	43%	0.428	C	S	.	.	H	α-helix	trans	-60.9	-45	173.4	-77.1	176.5	160	-174.1	-8.1	111.6	L50 E51 M57 K58 L66 D83	L50-R54 HydrophobicContact CD1-CG 4.06Å; L50-R54 WeakPolarHBondContact O-CB 3.4Å; L50-R54 WeakPolarHBondContact O-CG 3.24Å; L50-R54 PolarHBondContact O-N 3.44Å; E51-R54 PolarHBondContact O-N 2.68Å; E51-R54 IonicContact OE1-NH1 3.72Å; E51-R54 PolarHBondContact OE1-NH1 2.71Å; R54-M57 PolarHBondContact O-N 3.35Å; R54-K58 WeakPolarHBondContact O-CG 3.14Å; R54-K58 PolarHBondContact O-N 3.44Å; R54-K58 VanDerWaalsContact O-N 3.09Å; R54-L66 HydrophobicContact CG-CB 4.08Å; R54-L66 HydrophobicContact CG-CD2 3.75Å; R54-D83 PolarHBondContact NH2-O 3.06Å
55	Q	94.3	Very high	93.7	Very high	115 Å²	115	79 Å²	79	54%	0.537	43%	0.432	S	S	.	.	H	α-helix	trans	-63.1	-49.3	177.6	-179.1	172.8	0.9	0	0	111.3	E51 K52 M57 K58 E59	E51-Q55 WeakPolarHBondContact O-CB 3.43Å; E51-Q55 PolarHBondContact O-N 3.2Å; K52-Q55 PolarHBondContact O-N 2.91Å; Q55-M57 VanDerWaalsContact C-N 3.3Å; Q55-M57 PolarHBondContact O-N 3.02Å; Q55-K58 PolarHBondContact O-N 3.34Å; Q55-K58 VanDerWaalsContact O-N 3.13Å; Q55-E59 WeakPolarHBondContact CG-OE1 3.43Å; Q55-E59 PolarHBondContact NE2-OE1 2.81Å; Q55-E59 WeakPolarHBondContact O-CG 3.32Å; Q55-E59 PolarHBondContact O-N 3.26Å
56	A	94.9	Very high	93.6	Very high	45 Å²	45	75.9 Å²	75.9	37%	0.372	41%	0.412	S	S	.	.	H	α-helix	trans	-58.9	-40.7	178.1	0	0	0	0	0	112.1	K52 T53 K58 E59 L60	K52-A56 WeakPolarHBondContact O-CB 3.16Å; K52-A56 PolarHBondContact O-N 3.47Å; T53-A56 PolarHBondContact O-N 2.85Å; A56-K58 PolarHBondContact O-N 2.94Å; A56-E59 PolarHBondContact O-N 3.48Å; A56-L60 WeakPolarHBondContact O-CG 3.31Å; A56-L60 PolarHBondContact O-N 3.33Å
57	M	93.8	Very high	93.5	Very high	56 Å²	56	80 Å²	80	28%	0.276	44%	0.44	S	S	.	.	H	α-helix	trans	-64.2	-41.2	176.6	-169.7	63.1	-128.3	0	0	112	T53 R54 Q55 E59 L60 D61 N64	T53-M57 WeakPolarHBondContact O-CB 3.37Å; T53-M57 PolarHBondContact O-N 2.84Å; R54-M57 PolarHBondContact O-N 3.35Å; Q55-M57 VanDerWaalsContact C-N 3.3Å; Q55-M57 PolarHBondContact O-N 3.02Å; M57-E59 VanDerWaalsContact C-N 3.33Å; M57-E59 PolarHBondContact O-N 3.26Å; M57-L60 HydrophobicContact CE-CB 4.48Å; M57-L60 PolarHBondContact O-N 3.04Å; M57-D61 HydrophobicContact CE-CB 4Å; M57-D61 PolarHBondContact O-N 2.95Å; M57-N64 HydrophobicContact CE-CB 3.71Å
58	K	93.3	Very high	93.5	Very high	135 Å²	135	83.3 Å²	83.3	59%	0.587	46%	0.455	S	S	*	.	H	α-helix	trans	-66.1	-34.1	176.1	-73.6	176.9	178.6	-179.5	0	112.9	R54 Q55 A56 D61 P62	R54-K58 WeakPolarHBondContact O-CG 3.14Å; R54-K58 PolarHBondContact O-N 3.44Å; R54-K58 VanDerWaalsContact O-N 3.09Å; Q55-K58 PolarHBondContact O-N 3.34Å; Q55-K58 VanDerWaalsContact O-N 3.13Å; A56-K58 PolarHBondContact O-N 2.94Å; K58-D61 CarbonylContact O-C 3.47Å; K58-P62 WeakPolarHBondContact O-CA 3.47Å; K58-P62 WeakPolarHBondContact O-CD 3.33Å; K58-P62 WeakPolarHBondContact O-CG 3.36Å
59	E	96.2	Very high	93.5	Very high	137 Å²	137	81.4 Å²	81.4	64%	0.64	44%	0.44	S	S	*	.	H	α-helix	trans	-69.7	-36.2	175.5	-72.9	173.4	-169.3	0	0	111.8	Q55 A56 M57	Q55-E59 WeakPolarHBondContact CG-OE1 3.43Å; Q55-E59 PolarHBondContact NE2-OE1 2.81Å; Q55-E59 WeakPolarHBondContact O-CG 3.32Å; Q55-E59 PolarHBondContact O-N 3.26Å; A56-E59 PolarHBondContact O-N 3.48Å; M57-E59 VanDerWaalsContact C-N 3.33Å; M57-E59 PolarHBondContact O-N 3.26Å
60	L	95.8	Very high	93.6	Very high	143 Å²	143	82.7 Å²	82.7	75%	0.749	44%	0.444	S	S	*	.	H	α-helix	trans	-72.7	-43.4	175.9	-71.6	170.4	0	0	0	112.4	A56 M57	A56-L60 WeakPolarHBondContact O-CG 3.31Å; A56-L60 PolarHBondContact O-N 3.33Å; M57-L60 HydrophobicContact CE-CB 4.48Å; M57-L60 PolarHBondContact O-N 3.04Å
61	D	94.9	Very high	93.6	Very high	57 Å²	57	85 Å²	85	31%	0.305	46%	0.458	S	S	.	.			trans	-152.9	104.5	177.6	-176.5	-8.6	0	0	0	110.9	M57 K58 A63 N64	M57-D61 HydrophobicContact CE-CB 4Å; M57-D61 PolarHBondContact O-N 2.95Å; K58-D61 CarbonylContact O-C 3.47Å; D61-A63 PolarHBondContact O-N 3.01Å; D61-A63 VanDerWaalsContact O-N 3.16Å; D61-A63 WeakPolarHBondContact OD1-CB 3.17Å; D61-A63 PolarHBondContact OD1-N 3.03Å; D61-N64 HydrophobicContact CB-CB 4.1Å; D61-N64 PolarHBondContact O-N 3.19Å; D61-N64 PolarHBondContact OD2-ND2 3.2Å
62	P	94.1	Very high	93.7	Very high	113 Å²	113	88.9 Å²	88.9	73%	0.734	47%	0.469	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.7	-20.9	179.5	-24.6	33.8	0	0	0	114.9	K58 N64	K58-P62 WeakPolarHBondContact O-CA 3.47Å; K58-P62 WeakPolarHBondContact O-CD 3.33Å; K58-P62 WeakPolarHBondContact O-CG 3.36Å; P62-N64 VanDerWaalsContact C-N 3.32Å
63	A	94.7	Very high	93.5	Very high	93 Å²	93	84.5 Å²	84.5	77%	0.769	46%	0.461	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82.5	-14	178.4	0	0	0	0	0	112.6	D61	D61-A63 PolarHBondContact O-N 3.01Å; D61-A63 VanDerWaalsContact O-N 3.16Å; D61-A63 WeakPolarHBondContact OD1-CB 3.17Å; D61-A63 PolarHBondContact OD1-N 3.03Å
64	N	90.6	Very high	93.4	Very high	88 Å²	88	92.4 Å²	92.4	47%	0.471	49%	0.491	S	S	.	.			trans	-101.6	151.1	-178.4	-86.6	-38.4	0	0	0	112.5	M57 D61 P62	M57-N64 HydrophobicContact CE-CB 3.71Å; D61-N64 HydrophobicContact CB-CB 4.1Å; D61-N64 PolarHBondContact O-N 3.19Å; D61-N64 PolarHBondContact OD2-ND2 3.2Å; P62-N64 VanDerWaalsContact C-N 3.32Å
65	S	88.8	Confident	93.3	Very high	93 Å²	93	97 Å²	97	65%	0.65	51%	0.513	S	S	*	.			trans	-127	145.4	177.2	61.2	0	0	0	0	111.4	S67	S65-S67 PolarHBondContact O-N 2.76Å; S65-S67 VanDerWaalsContact O-N 3.1Å
66	L	91.3	Very high	93.2	Very high	29 Å²	29	94.4 Å²	94.4	15%	0.152	50%	0.501	C	S	.	.			trans	-64	113	176.7	-179.4	64.2	0	0	0	109.4	L50 T53 R54 F69 P82	L50-L66 HydrophobicContact CD1-CD2 3.63Å; T53-L66 HydrophobicContact CG2-CD1 3.87Å; T53-L66 HydrophobicContact CG2-CD2 3.69Å; T53-L66 HydrophobicContact CG2-CG 4.43Å; R54-L66 HydrophobicContact CG-CB 4.08Å; R54-L66 HydrophobicContact CG-CD2 3.75Å; L66-F69 HydrophobicContact CD1-CB 4.31Å; L66-F69 HydrophobicContact CD1-CD1 4.25Å; L66-F69 HydrophobicContact CD2-CD1 3.79Å; L66-F69 HydrophobicContact CD2-CE1 4.07Å; L66-F69 HydrophobicContact CG-CD1 4.33Å; L66-P82 HydrophobicContact CB-CG 4.49Å; L66-P82 HydrophobicContact CD2-CG 4.01Å; L66-P82 HydrophobicContact CG-CG 3.93Å
67	S	91.5	Very high	93.2	Very high	88 Å²	88	93.2 Å²	93.2	62%	0.615	49%	0.487	S	S	*	.			trans	-90	-46.5	179	-61.2	0	0	0	0	112	S65 P82	S65-S67 PolarHBondContact O-N 2.76Å; S65-S67 VanDerWaalsContact O-N 3.1Å; S67-P82 WeakPolarHBondContact O-CD 3.41Å
68	F	94.4	Very high	93.3	Very high	96 Å²	96	91.6 Å²	91.6	42%	0.421	48%	0.48	S	S	.	.			trans	-158.8	146.6	-176.2	176.7	-97.4	0	0	0	109.3	H70 M79 V80	F68-H70 HydrophobicContact CE1-CB 4.01Å; F68-H70 HydrophobicContact CZ-CB 4.35Å; F68-M79 HydrophobicContact CE1-CE 4.23Å; F68-M79 HydrophobicContact CE2-CB 3.77Å; F68-M79 HydrophobicContact CE2-CE 3.97Å; F68-M79 HydrophobicContact CE2-CG 4.44Å; F68-M79 HydrophobicContact CZ-CB 3.57Å; F68-M79 HydrophobicContact CZ-CE 3.37Å; F68-M79 HydrophobicContact CZ-CG 3.76Å; F68-M79 HydrophobicContact CZ-SD 4.4Å; F68-V80 WeakPolarHBondContact CA-O 3.45Å; F68-V80 WeakPolarHBondContact CD2-O 3.37Å
69	F	93.7	Very high	93.4	Very high	26 Å²	26	88.4 Å²	88.4	11%	0.114	47%	0.468	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.7	155.3	165.9	72.2	-83.9	0	0	0	112.2	L49 L50 L66 V71 V80	L49-F69 HydrophobicContact CD2-CE2 4.01Å; L49-F69 HydrophobicContact CD2-CZ 4.49Å; L49-F69 HydrophobicContact CG-CE2 4.18Å; L49-F69 HydrophobicContact CG-CZ 4.34Å; L50-F69 HydrophobicContact CB-CE1 4.37Å; L50-F69 HydrophobicContact CB-CZ 4.46Å; L50-F69 HydrophobicContact CD1-CE1 3.73Å; L66-F69 HydrophobicContact CD1-CB 4.31Å; L66-F69 HydrophobicContact CD1-CD1 4.25Å; L66-F69 HydrophobicContact CD2-CD1 3.79Å; L66-F69 HydrophobicContact CD2-CE1 4.07Å; L66-F69 HydrophobicContact CG-CD1 4.33Å; F69-V71 HydrophobicContact CD2-CG2 3.68Å; F69-V71 HydrophobicContact CE2-CG2 3.63Å; F69-V80 HydrophobicContact CD1-CB 3.82Å; F69-V80 HydrophobicContact CD1-CG1 4.26Å; F69-V80 HydrophobicContact CD2-CB 4.47Å; F69-V80 HydrophobicContact CD2-CG2 4.48Å; F69-V80 HydrophobicContact CE1-CB 3.39Å; F69-V80 HydrophobicContact CE1-CG1 3.51Å; F69-V80 HydrophobicContact CE1-CG2 3.95Å; F69-V80 HydrophobicContact CE2-CB 4.09Å; F69-V80 HydrophobicContact CE2-CG2 3.81Å; F69-V80 HydrophobicContact CG-CB 4.36Å; F69-V80 HydrophobicContact CZ-CB 3.54Å; F69-V80 HydrophobicContact CZ-CG1 3.84Å; F69-V80 HydrophobicContact CZ-CG2 3.52Å; F69-V80 PolarHBondContact N-O 2.74Å; F69-V80 PolarHBondContact O-N 2.76Å
70	H	95.1	Very high	93.4	Very high	90 Å²	90	82 Å²	82	42%	0.417	44%	0.438	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.1	131.3	-179.2	174.4	-141.9	0	0	0	109.8	F68 E77 I78	F68-H70 HydrophobicContact CE1-CB 4.01Å; F68-H70 HydrophobicContact CZ-CB 4.35Å; H70-E77 IonicContact CE1-OE2 3.95Å; H70-E77 WeakPolarHBondContact NE2-CB 3.34Å; H70-E77 WeakPolarHBondContact NE2-CG 3.44Å; H70-E77 IonicContact NE2-OE2 3.33Å; H70-I78 CarbonylContact C-O 3.54Å; H70-I78 WeakPolarHBondContact CA-O 3.45Å; H70-I78 PolarHBondContact CD2-O 2.95Å
71	V	94.2	Very high	93.3	Very high	52 Å²	52	77.8 Å²	77.8	32%	0.315	42%	0.42	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.6	115.6	176.6	-174.9	0	0	0	0	108.9	L49 F69 E77 I78	L49-V71 HydrophobicContact CD2-CG2 3.99Å; F69-V71 HydrophobicContact CD2-CG2 3.68Å; F69-V71 HydrophobicContact CE2-CG2 3.63Å; V71-E77 CarbonylContact O-C 3.59Å; V71-E77 WeakPolarHBondContact O-CA 3.37Å; V71-I78 PolarHBondContact N-O 3.34Å; V71-I78 PolarHBondContact O-N 2.91Å
72	R	94.3	Very high	93.2	Very high	161 Å²	161	75.7 Å²	75.7	61%	0.608	41%	0.41	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-95.4	120.7	171.7	-177.9	172.6	-176.2	138.2	-6.8	110.3	E77	R72-E77 HydrophobicContact CB-CG 3.87Å; R72-E77 WeakPolarHBondContact CD-OE1 3.47Å; R72-E77 HydrophobicContact CG-CG 3.67Å; R72-E77 WeakPolarHBondContact CG-OE1 3.24Å; R72-E77 IonicContact CZ-OE1 3.15Å; R72-E77 IonicContact NE-OE1 3.57Å; R72-E77 PolarHBondContact NE-OE1 2.89Å; R72-E77 IonicContact NH1-OE1 2.73Å; R72-E77 PolarHBondContact NH1-OE1 3.32Å
73	A	91.4	Very high	93.1	Very high	55 Å²	55	75.4 Å²	75.4	46%	0.455	40%	0.402	S	S	.	.			trans	-113.4	172.8	168.8	0	0	0	0	0	110.2	K75 H76	A73-K75 VanDerWaalsContact C-N 3.28Å; A73-K75 PolarHBondContact O-N 3.01Å; A73-H76 CarbonylContact C-O 3.49Å; A73-H76 WeakPolarHBondContact CA-O 3.36Å; A73-H76 WeakPolarHBondContact CB-O 3.42Å; A73-H76 PolarHBondContact N-O 3.49Å
74	K	91	Very high	92.7	Very high	207 Å²	207	81.3 Å²	81.3	90%	0.9	41%	0.405	S	S	*	.	S	Bend	trans	-59.2	-36.4	-177.2	-174.7	173.8	-178.7	176.6	0	113.6
75	K	90.2	Very high	92.8	Very high	159 Å²	159	82 Å²	82	69%	0.691	41%	0.409	S	S	*	.	S	Bend	trans	-107.4	-21	-175.4	-67.1	-173.3	177.4	-176.4	0	114	A73 P94	A73-K75 VanDerWaalsContact C-N 3.28Å; A73-K75 PolarHBondContact O-N 3.01Å; K75-P94 VanDerWaalsContact C-CD 3.43Å; K75-P94 WeakPolarHBondContact O-CD 3.34Å
76	H	92.7	Very high	93	Very high	59 Å²	59	82.1 Å²	82.1	27%	0.273	40%	0.397	S	S	.	.			trans	-144.8	143.5	-170.9	-60.9	-56.8	0	0	0	110.3	A73 I91 L92	A73-H76 CarbonylContact C-O 3.49Å; A73-H76 WeakPolarHBondContact CA-O 3.36Å; A73-H76 WeakPolarHBondContact CB-O 3.42Å; A73-H76 PolarHBondContact N-O 3.49Å; H76-I91 HydrophobicContact CB-CG2 4.48Å; H76-L92 WeakPolarHBondContact CA-O 3.41Å
77	E	95	Very high	93.1	Very high	20 Å²	20	80.9 Å²	80.9	9%	0.093	39%	0.391	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.1	136.9	163.1	-83	-179.7	-174.3	0	0	108.3	H70 V71 R72 I91 L92 P94	H70-E77 IonicContact CE1-OE2 3.95Å; H70-E77 WeakPolarHBondContact NE2-CB 3.34Å; H70-E77 WeakPolarHBondContact NE2-CG 3.44Å; H70-E77 IonicContact NE2-OE2 3.33Å; V71-E77 CarbonylContact O-C 3.59Å; V71-E77 WeakPolarHBondContact O-CA 3.37Å; R72-E77 HydrophobicContact CB-CG 3.87Å; R72-E77 WeakPolarHBondContact CD-OE1 3.47Å; R72-E77 HydrophobicContact CG-CG 3.67Å; R72-E77 WeakPolarHBondContact CG-OE1 3.24Å; R72-E77 IonicContact CZ-OE1 3.15Å; R72-E77 IonicContact NE-OE1 3.57Å; R72-E77 PolarHBondContact NE-OE1 2.89Å; R72-E77 IonicContact NH1-OE1 2.73Å; R72-E77 PolarHBondContact NH1-OE1 3.32Å; E77-I91 WeakPolarHBondContact O-CA 3.24Å; E77-L92 HydrophobicContact CB-CB 3.97Å; E77-L92 HydrophobicContact CB-CD1 4.37Å; E77-L92 PolarHBondContact N-O 3.35Å; E77-L92 PolarHBondContact O-N 3.16Å; E77-P94 HydrophobicContact CG-CG 4.35Å
78	I	95.6	Very high	93.3	Very high	22 Å²	22	79.2 Å²	79.2	11%	0.113	38%	0.375	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.5	114.4	-179	-50.4	175.2	0	0	0	108.4	F42 H70 V71 V80	F42-I78 HydrophobicContact CD1-CD1 3.83Å; F42-I78 HydrophobicContact CE1-CD1 3.89Å; F42-I78 HydrophobicContact CE1-CG1 4.32Å; H70-I78 CarbonylContact C-O 3.54Å; H70-I78 WeakPolarHBondContact CA-O 3.45Å; H70-I78 PolarHBondContact CD2-O 2.95Å; V71-I78 PolarHBondContact N-O 3.34Å; V71-I78 PolarHBondContact O-N 2.91Å; I78-V80 HydrophobicContact CG2-CG2 3.77Å
79	M	95.9	Very high	93.4	Very high	68 Å²	68	74.7 Å²	74.7	34%	0.335	36%	0.355	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97	123.7	172.6	-68.1	179	74.6	0	0	108.4	F68 L89 V90 L92	F68-M79 HydrophobicContact CE1-CE 4.23Å; F68-M79 HydrophobicContact CE2-CB 3.77Å; F68-M79 HydrophobicContact CE2-CE 3.97Å; F68-M79 HydrophobicContact CE2-CG 4.44Å; F68-M79 HydrophobicContact CZ-CB 3.57Å; F68-M79 HydrophobicContact CZ-CE 3.37Å; F68-M79 HydrophobicContact CZ-CG 3.76Å; F68-M79 HydrophobicContact CZ-SD 4.4Å; M79-L89 CarbonylContact O-C 3.55Å; M79-L89 WeakPolarHBondContact O-CA 3.49Å; M79-V90 HydrophobicContact CB-CB 4.2Å; M79-V90 PolarHBondContact N-O 3.47Å; M79-V90 PolarHBondContact O-N 3.37Å; M79-L92 HydrophobicContact CB-CD1 4.21Å; M79-L92 HydrophobicContact CG-CD1 3.64Å; M79-L92 HydrophobicContact SD-CD1 3.69Å; M79-L92 HydrophobicContact SD-CD2 4.1Å
80	V	95.8	Very high	93.6	Very high	2 Å²	2	74.1 Å²	74.1	1%	0.012	35%	0.354	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.8	120.4	-177.3	-172.2	0	0	0	0	109.5	L50 F68 F69 I78 P82 L88 L89	L50-V80 HydrophobicContact CD1-CG1 4.48Å; F68-V80 WeakPolarHBondContact CA-O 3.45Å; F68-V80 WeakPolarHBondContact CD2-O 3.37Å; F69-V80 HydrophobicContact CD1-CB 3.82Å; F69-V80 HydrophobicContact CD1-CG1 4.26Å; F69-V80 HydrophobicContact CD2-CB 4.47Å; F69-V80 HydrophobicContact CD2-CG2 4.48Å; F69-V80 HydrophobicContact CE1-CB 3.39Å; F69-V80 HydrophobicContact CE1-CG1 3.51Å; F69-V80 HydrophobicContact CE1-CG2 3.95Å; F69-V80 HydrophobicContact CE2-CB 4.09Å; F69-V80 HydrophobicContact CE2-CG2 3.81Å; F69-V80 HydrophobicContact CG-CB 4.36Å; F69-V80 HydrophobicContact CZ-CB 3.54Å; F69-V80 HydrophobicContact CZ-CG1 3.84Å; F69-V80 HydrophobicContact CZ-CG2 3.52Å; F69-V80 PolarHBondContact N-O 2.74Å; F69-V80 PolarHBondContact O-N 2.76Å; I78-V80 HydrophobicContact CG2-CG2 3.77Å; V80-P82 WeakPolarHBondContact O-CD 3.45Å; V80-L88 WeakPolarHBondContact CA-O 3.32Å; V80-L89 HydrophobicContact CG1-CD1 4.2Å; V80-L89 HydrophobicContact CG2-CG 4.28Å
81	S	94.4	Very high	93.7	Very high	55 Å²	55	69.8 Å²	69.8	39%	0.385	33%	0.334	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.1	93.5	173.8	-168.8	0	0	0	0	109	L88	S81-L88 PolarHBondContact N-O 3.31Å; S81-L88 PolarHBondContact O-N 3.13Å
82	P	93	Very high	93.7	Very high	13 Å²	13	67.8 Å²	67.8	8%	0.084	32%	0.321	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.9	140.6	175.5	27.2	-32.4	0	0	0	113	L50 L66 S67 V80	L50-P82 HydrophobicContact CD1-CB 3.53Å; L50-P82 HydrophobicContact CD1-CG 3.72Å; L50-P82 HydrophobicContact CD2-CB 4.15Å; L50-P82 HydrophobicContact CG-CB 4.47Å; L66-P82 HydrophobicContact CB-CG 4.49Å; L66-P82 HydrophobicContact CD2-CG 4.01Å; L66-P82 HydrophobicContact CG-CG 3.93Å; S67-P82 WeakPolarHBondContact O-CD 3.41Å; V80-P82 WeakPolarHBondContact O-CD 3.45Å
83	D	91.4	Very high	93.6	Very high	107 Å²	107	63.5 Å²	63.5	57%	0.572	31%	0.313	S	S	*	.			trans	-127	-176.8	165.7	-165	2.5	0	0	0	109.4	R54 N85 F86	R54-D83 PolarHBondContact NH2-O 3.06Å; D83-N85 PolarHBondContact O-N 3.46Å; D83-F86 CarbonylContact C-O 3.6Å; D83-F86 WeakPolarHBondContact CA-O 3.39Å; D83-F86 VanDerWaalsContact CB-O 3.31Å; D83-F86 WeakPolarHBondContact CB-O 3.36Å; D83-F86 PolarHBondContact N-O 3.5Å
84	R	87.4	Confident	93.4	Very high	217 Å²	217	62.1 Å²	62.1	82%	0.819	30%	0.299	S	S	*	.	S	Bend	trans	-57.1	-48.7	-174.9	-65.2	-176.2	-176.2	-173.4	0.9	112.9
85	N	91.2	Very high	92.7	Very high	104 Å²	104	57.6 Å²	57.6	56%	0.556	29%	0.285	S	S	*	.	S	Bend	trans	-114.6	-17.6	-172.4	-60.8	-14.4	0	0	0	113.2	D24 D25 D83	D24-N85 CarbonylContact C-O 3.56Å; D24-N85 WeakPolarHBondContact CA-O 3.45Å; D25-N85 PolarHBondContact N-O 2.88Å; D83-N85 PolarHBondContact O-N 3.46Å
86	F	93.4	Very high	91.4	Very high	94 Å²	94	62.7 Å²	62.7	41%	0.412	31%	0.312	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.2	147.6	-176.4	-57.9	-74.6	0	0	0	110.6	L22 L23 D24 V30 D83	L22-F86 HydrophobicContact CD1-CB 3.81Å; L22-F86 HydrophobicContact CD1-CG 4.47Å; L22-F86 HydrophobicContact CD2-CD1 4.35Å; L22-F86 HydrophobicContact CG-CB 4.32Å; L22-F86 HydrophobicContact CG-CD1 4.32Å; L23-F86 CarbonylContact O-C 3.57Å; L23-F86 WeakPolarHBondContact O-CA 3.46Å; D24-F86 HydrophobicContact CB-CD1 4.4Å; D24-F86 HydrophobicContact CB-CE1 4.4Å; V30-F86 HydrophobicContact CG2-CD1 4.23Å; V30-F86 HydrophobicContact CG2-CE1 3.98Å; D83-F86 CarbonylContact C-O 3.6Å; D83-F86 WeakPolarHBondContact CA-O 3.39Å; D83-F86 VanDerWaalsContact CB-O 3.31Å; D83-F86 WeakPolarHBondContact CB-O 3.36Å; D83-F86 PolarHBondContact N-O 3.5Å
87	S	94.7	Very high	91.3	Very high	4 Å²	4	62.9 Å²	62.9	3%	0.028	31%	0.314	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.7	125.9	172	-61.2	0	0	0	0	109.5	L23 L50	L23-S87 PolarHBondContact N-O 3.16Å; L23-S87 PolarHBondContact O-N 3.38Å; L50-S87 WeakPolarHBondContact CD2-OG 3.38Å
88	L	95.4	Very high	91.1	Very high	52 Å²	52	65.2 Å²	65.2	27%	0.272	33%	0.325	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90	124.2	175.4	-175.7	70	0	0	0	109.3	L11 V20 L22 V80 S81 V90	L11-L88 HydrophobicContact CD1-CD2 4.13Å; V20-L88 HydrophobicContact CG1-CD1 3.46Å; V20-L88 VanDerWaalsContact CG1-CD1 3.46Å; V20-L88 HydrophobicContact CG1-CG 4.42Å; L22-L88 HydrophobicContact CD1-CD1 4.41Å; V80-L88 WeakPolarHBondContact CA-O 3.32Å; S81-L88 PolarHBondContact N-O 3.31Å; S81-L88 PolarHBondContact O-N 3.13Å; L88-V90 HydrophobicContact CD2-CG2 4.37Å; L88-V90 HydrophobicContact CG-CG2 4.35Å
89	L	96.4	Very high	90.9	Very high	1 Å²	1	67.6 Å²	67.6	1%	0.005	34%	0.337	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.5	125.2	172.8	-73.6	60.9	0	0	0	107.9	V20 I21 L23 C46 M79 V80 I91	V20-L89 CarbonylContact C-O 3.6Å; V20-L89 WeakPolarHBondContact CA-O 3.37Å; I21-L89 HydrophobicContact CB-CB 4.2Å; I21-L89 PolarHBondContact N-O 2.91Å; I21-L89 PolarHBondContact O-N 3.09Å; L23-L89 HydrophobicContact CD1-CD1 3.73Å; L23-L89 HydrophobicContact CD1-CD2 3.78Å; L23-L89 HydrophobicContact CD1-CG 4.44Å; L23-L89 HydrophobicContact CG-CD1 3.92Å; L23-L89 HydrophobicContact CG-CD2 4.33Å; C46-L89 HydrophobicContact CB-CD2 3.53Å; C46-L89 HydrophobicContact CB-CG 4.37Å; M79-L89 CarbonylContact O-C 3.55Å; M79-L89 WeakPolarHBondContact O-CA 3.49Å; V80-L89 HydrophobicContact CG1-CD1 4.2Å; V80-L89 HydrophobicContact CG2-CG 4.28Å; L89-I91 HydrophobicContact CB-CD1 4.21Å
90	V	97	Very high	90.6	Very high	14 Å²	14	67.5 Å²	67.5	9%	0.085	34%	0.337	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.6	122.6	169	-174.9	0	0	0	0	107.1	L11 V17 M79 L88 L92	L11-V90 HydrophobicContact CD1-CG2 4.25Å; V17-V90 HydrophobicContact CB-CG1 4.49Å; V17-V90 HydrophobicContact CG1-CG1 3.87Å; V17-V90 HydrophobicContact CG2-CG1 3.82Å; M79-V90 HydrophobicContact CB-CB 4.2Å; M79-V90 PolarHBondContact N-O 3.47Å; M79-V90 PolarHBondContact O-N 3.37Å; L88-V90 HydrophobicContact CD2-CG2 4.37Å; L88-V90 HydrophobicContact CG-CG2 4.35Å; V90-L92 HydrophobicContact CB-CD1 4.41Å; V90-L92 HydrophobicContact CG1-CD1 4.03Å; V90-L92 HydrophobicContact CG1-CG 4.3Å; V90-L92 WeakPolarHBondContact O-CD1 3.44Å
91	I	96.7	Very high	90.3	Very high	0 Å²	0	71.6 Å²	71.6	0%	0	36%	0.357	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105	125.4	-177.6	-54.1	77.6	0	0	0	107	M18 G19 I21 L34 F42 H76 E77 L89	M18-I91 WeakPolarHBondContact CA-O 3.45Å; M18-I91 HydrophobicContact CB-CG2 4.48Å; M18-I91 WeakPolarHBondContact CB-O 3.27Å; M18-I91 HydrophobicContact CE-CB 4.1Å; M18-I91 HydrophobicContact CE-CG2 3.41Å; M18-I91 VanDerWaalsContact CE-CG2 3.41Å; M18-I91 PolarHBondContact N-O 3.45Å; M18-I91 HydrophobicContact SD-CG2 4.46Å; G19-I91 PolarHBondContact N-O 3.07Å; G19-I91 VanDerWaalsContact N-O 3.14Å; G19-I91 WeakPolarHBondContact O-CD1 3.09Å; G19-I91 PolarHBondContact O-N 3.3Å; I21-I91 HydrophobicContact CD1-CD1 3.86Å; I21-I91 HydrophobicContact CG1-CD1 3.84Å; L34-I91 HydrophobicContact CD1-CD1 4.22Å; L34-I91 HydrophobicContact CD1-CG1 4.44Å; F42-I91 HydrophobicContact CD1-CG1 4.11Å; F42-I91 HydrophobicContact CD2-CG1 4.18Å; F42-I91 HydrophobicContact CE1-CG1 4.16Å; F42-I91 HydrophobicContact CE1-CG2 3.85Å; F42-I91 HydrophobicContact CE2-CG1 4.26Å; F42-I91 HydrophobicContact CE2-CG2 4.12Å; F42-I91 HydrophobicContact CG-CG1 4.14Å; F42-I91 HydrophobicContact CZ-CG1 4.26Å; F42-I91 HydrophobicContact CZ-CG2 3.59Å; H76-I91 HydrophobicContact CB-CG2 4.48Å; E77-I91 WeakPolarHBondContact O-CA 3.24Å; L89-I91 HydrophobicContact CB-CD1 4.21Å
92	L	95.6	Very high	90	Very high	9 Å²	9	72.7 Å²	72.7	5%	0.047	36%	0.356	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.8	151.1	-176.3	-53	89.6	0	0	0	110.4	N16 V17 H76 E77 M79 V90	N16-L92 HydrophobicContact CB-CD2 4.49Å; N16-L92 WeakPolarHBondContact ND2-CD2 3.38Å; N16-L92 CarbonylContact O-C 3.56Å; N16-L92 WeakPolarHBondContact O-CA 3.42Å; N16-L92 VanDerWaalsContact O-CB 3.29Å; N16-L92 WeakPolarHBondContact O-CB 3.08Å; V17-L92 HydrophobicContact CG2-CD2 4.3Å; V17-L92 HydrophobicContact CG2-CG 4.33Å; H76-L92 WeakPolarHBondContact CA-O 3.41Å; E77-L92 HydrophobicContact CB-CB 3.97Å; E77-L92 HydrophobicContact CB-CD1 4.37Å; E77-L92 PolarHBondContact N-O 3.35Å; E77-L92 PolarHBondContact O-N 3.16Å; M79-L92 HydrophobicContact CB-CD1 4.21Å; M79-L92 HydrophobicContact CG-CD1 3.64Å; M79-L92 HydrophobicContact SD-CD1 3.69Å; M79-L92 HydrophobicContact SD-CD2 4.1Å; V90-L92 HydrophobicContact CB-CD1 4.41Å; V90-L92 HydrophobicContact CG1-CD1 4.03Å; V90-L92 HydrophobicContact CG1-CG 4.3Å; V90-L92 WeakPolarHBondContact O-CD1 3.44Å
93	T	92.7	Very high	89.8	Confident	72 Å²	72	77 Å²	77	44%	0.442	38%	0.375	S	S	.	.	P	Polyproline II helix	trans	-84	126.1	164.9	-50	0	0	0	0	107.1	N16 N95	N16-T93 PolarHBondContact O-N 2.95Å; T93-N95 PolarHBondContact O-N 2.99Å
94	P	85.2	Confident	89.6	Confident	25 Å²	25	74.7 Å²	74.7	16%	0.162	36%	0.36	C	S	.	.	P	Polyproline II helix	trans	-59.2	129.8	175.1	-18.2	29.6	0	0	0	109	K75 E77	K75-P94 VanDerWaalsContact C-CD 3.43Å; K75-P94 WeakPolarHBondContact O-CD 3.34Å; E77-P94 HydrophobicContact CG-CG 4.35Å
95	N	77.4	Confident	89.8	Confident	113 Å²	113	62.8 Å²	62.8	60%	0.604	32%	0.321	S	S	*	.	P	Polyproline II helix	trans	-71.8	129.7	166.3	-67.6	-14.2	0	0	0	107.7	T93	T93-N95 PolarHBondContact O-N 2.99Å
96	E	62.2	Low	89.7	Confident	266 Å²	266	59.1 Å²	59.1	100%	1.243	30%	0.3	S	S	*	.			trans	-60.5	0	171.4	-71.8	-168.3	160.5	0	0	111.6

Retrieved 96 of 96 residues in 91 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).