A0A077Z4A0_TRITR Loading...

E1 DerP2 DerF2 domain containing protein

AlphaFold DB , UniProt , Accession A0A077Z4A0, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 146 aa.

						>A0A077Z4A0_TRITR|A0A077Z4A0
MKVWQPHRGANYPAGTTEYLRKRISGGPDSTVRVDHLQAEPSPLEVPGILRLTLRVNISVPPPEEVYVKLFLRKRIADTRWVRIPCIFGFGSCDYAHLPVCLLTHELFGCPIKASYYSIDETFLLKNPETSLSRLLQQVWAKRANQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	26.5	Very low	29	Very low	239 Å²	239	161.4 Å²	161.4	100%	1.177	83%	0.828	S	S	*	*				0	97.5	0	-163.2	163.7	158.5	0	0	108.1
2	K	24.2	Very low	29.6	Very low	210 Å²	210	162.6 Å²	162.6	91%	0.913	82%	0.817	S	S	*	*	P	Polyproline II helix	trans	-95.7	119.2	-178.9	-84.7	-177.2	177.9	177.9	0	109.7
3	V	25.8	Very low	29.6	Very low	128 Å²	128	158 Å²	158	78%	0.776	81%	0.805	S	S	*	*	P	Polyproline II helix	trans	-81	129.5	179.8	176	0	0	0	0	109.2
4	W	26.8	Very low	29.6	Very low	158 Å²	158	152.4 Å²	152.4	60%	0.598	80%	0.795	S	S	*	*	P	Polyproline II helix	trans	-84.2	116.4	173.6	-90.3	101.1	0	0	0	110.7	R23	W4-R23 HydrophobicContact CZ2-CG 4.43Å
5	Q	24.8	Very low	29.7	Very low	166 Å²	166	146.9 Å²	146.9	78%	0.776	79%	0.79	S	S	*	*	P	Polyproline II helix	trans	-89.5	138.3	166.7	-74.9	173.3	-23.5	0	0	110.2
6	P	31.7	Very low	29.5	Very low	123 Å²	123	141.9 Å²	141.9	80%	0.799	77%	0.767	S	S	*	*	P	Polyproline II helix	trans	-80	125.4	170.3	28.1	-24.2	0	0	0	110.2	R8	P6-R8 PolarHBondContact O-N 2.77Å
7	H	34.5	Very low	29.6	Very low	185 Å²	185	138 Å²	138	86%	0.856	75%	0.749	S	S	*	*	P	Polyproline II helix	trans	-62.6	118.9	167.7	-104.4	-84.2	0	0	0	109.6
8	R	28.1	Very low	29.6	Very low	248 Å²	248	134.4 Å²	134.4	94%	0.936	73%	0.726	S	S	*	*	P	Polyproline II helix	trans	-72.6	124.3	162.7	-80.3	-175.5	-79	-159.3	-4	108.4	P6	P6-R8 PolarHBondContact O-N 2.77Å
9	G	30.8	Very low	29.8	Very low	77 Å²	77	136.9 Å²	136.9	79%	0.794	73%	0.725	S	S	*	*			trans	149.4	78.6	170.7	0	0	0	0	0	113.2
10	A	35	Very low	30.2	Very low	68 Å²	68	137.6 Å²	137.6	56%	0.562	73%	0.729	S	S	*	*			trans	168.5	116	141.7	0	0	0	0	0	108.7	Y12	A10-Y12 HydrophobicContact CB-CD2 3.79Å; A10-Y12 HydrophobicContact CB-CE2 3.33Å; A10-Y12 PolarHBondContact O-N 3.36Å
11	N	30.6	Very low	30.7	Very low	173 Å²	173	141.6 Å²	141.6	93%	0.925	73%	0.734	S	S	*	*			trans	-56.5	116.6	165.6	-83.4	-25.9	0	0	0	108.8
12	Y	37.1	Very low	31.6	Very low	176 Å²	176	134.5 Å²	134.5	69%	0.69	70%	0.696	S	S	*	*			trans	-126.6	130.1	164.6	-74.6	-75.6	0	0	0	109.2	A10	A10-Y12 HydrophobicContact CB-CD2 3.79Å; A10-Y12 HydrophobicContact CB-CE2 3.33Å; A10-Y12 PolarHBondContact O-N 3.36Å
13	P	29.3	Very low	32.8	Very low	103 Å²	103	131.7 Å²	131.7	67%	0.669	68%	0.68	S	S	*	*			trans	-64.3	146.6	-178.8	26	-32.1	0	0	0	111.3	G15 T16	P13-G15 PolarHBondContact O-N 3.37Å; P13-T16 PolarHBondContact O-OG1 2.83Å
14	A	29.7	Very low	34.2	Very low	79 Å²	79	129.1 Å²	129.1	65%	0.653	66%	0.661	S	S	*	*	T	Hydrogen-bonded Turn	trans	-55	106	178.1	0	0	0	0	0	110.2
15	G	30.4	Very low	35.3	Very low	71 Å²	71	127.2 Å²	127.2	73%	0.732	67%	0.672	S	S	*	*	T	Hydrogen-bonded Turn	trans	154.5	-18	-177.1	0	0	0	0	0	114.8	P13	P13-G15 PolarHBondContact O-N 3.37Å
16	T	27	Very low	36.8	Very low	67 Å²	67	121.2 Å²	121.2	41%	0.411	66%	0.655	S	S	.	*			trans	-84.3	122.1	-178.9	32.3	0	0	0	0	113.8	P13 R75	P13-T16 PolarHBondContact O-OG1 2.83Å; T16-R75 PolarHBondContact O-NH2 2.87Å; T16-R75 VanDerWaalsContact O-NH2 3.11Å
17	T	30.4	Very low	37.7	Very low	75 Å²	75	117.5 Å²	117.5	46%	0.46	64%	0.639	S	S	.	*			trans	-51.4	131.1	176.1	-28.7	0	0	0	0	111.7	Y19 P43	T17-Y19 PolarHBondContact O-N 2.81Å; T17-P43 HydrophobicContact CG2-CB 3.76Å; T17-P43 HydrophobicContact CG2-CG 4.19Å
18	E	30.4	Very low	38.7	Very low	74 Å²	74	114.8 Å²	114.8	35%	0.346	64%	0.638	S	S	.	*			trans	-78.6	105.5	-179.2	-154.4	148.5	-124.7	0	0	109.4	L20 R75 W81	E18-L20 PolarHBondContact O-N 2.93Å; E18-R75 VanDerWaalsContact OE1-CD 3.3Å; E18-R75 WeakPolarHBondContact OE1-CD 3.4Å; E18-R75 IonicContact OE1-CZ 2.77Å; E18-R75 IonicContact OE1-NE 2.87Å; E18-R75 IonicContact OE1-NH1 3.55Å; E18-R75 PolarHBondContact OE1-NH1 3.33Å; E18-R75 VanDerWaalsContact OE2-CB 3.28Å; E18-R75 WeakPolarHBondContact OE2-CB 3.31Å; E18-R75 IonicContact OE2-CZ 3.7Å; E18-R75 IonicContact OE2-NE 3.37Å; E18-R75 IonicContact OE2-NH1 3.79Å; E18-W81 HydrophobicContact CG-CH2 3.76Å; E18-W81 HydrophobicContact CG-CZ2 3.87Å; E18-W81 WeakPolarHBondContact OE1-CH2 3.35Å; E18-W81 WeakPolarHBondContact OE1-CZ2 3.07Å; E18-W81 WeakPolarHBondContact OE2-CH2 3.37Å; E18-W81 VanDerWaalsContact OE2-CZ2 3.24Å; E18-W81 WeakPolarHBondContact OE2-CZ2 3.35Å; E18-W81 WeakPolarHBondContact OE2-CZ3 3.47Å
19	Y	34	Very low	40.3	Very low	181 Å²	181	110.5 Å²	110.5	71%	0.71	63%	0.633	S	S	*	*			trans	-43.5	139	170.7	-58.7	-92.4	0	0	0	110.7	T17 R21	T17-Y19 PolarHBondContact O-N 2.81Å; Y19-R21 PolarHBondContact O-N 2.81Å
20	L	37.2	Very low	42.2	Very low	151 Å²	151	108.3 Å²	108.3	79%	0.791	61%	0.606	S	S	*	*			trans	-63.2	76	154.2	-84	166.4	0	0	0	107.7	E18 K22 A39	E18-L20 PolarHBondContact O-N 2.93Å; L20-K22 VanDerWaalsContact C-N 3.31Å; L20-K22 PolarHBondContact O-N 2.94Å; L20-A39 HydrophobicContact CD1-CB 4.34Å
21	R	40.2	Very low	44.4	Very low	221 Å²	221	108.1 Å²	108.1	83%	0.834	60%	0.598	S	S	*	*			trans	-74.6	90.3	175.8	-176.6	176.8	-85	-171.9	-5.5	107.1	Y19 R23	Y19-R21 PolarHBondContact O-N 2.81Å; R21-R23 PolarHBondContact O-N 3.02Å
22	K	45.9	Very low	47	Very low	90 Å²	90	103.1 Å²	103.1	39%	0.391	57%	0.573	S	S	.	*			trans	-71.2	112.5	176.3	-160.7	-171.2	-167.4	170.8	0	109.5	L20 I24 L37	L20-K22 VanDerWaalsContact C-N 3.31Å; L20-K22 PolarHBondContact O-N 2.94Å; K22-I24 HydrophobicContact CD-CD1 3.85Å; K22-I24 HydrophobicContact CD-CG1 3.48Å; K22-I24 VanDerWaalsContact CD-CG1 3.48Å; K22-I24 VanDerWaalsContact CE-CG1 3.48Å; K22-I24 HydrophobicContact CG-CD1 4.5Å; K22-I24 HydrophobicContact CG-CG1 3.89Å; K22-L37 HydrophobicContact CD-CB 3.85Å; K22-L37 HydrophobicContact CD-CD2 3.54Å; K22-L37 HydrophobicContact CD-CG 4.3Å; K22-L37 HydrophobicContact CG-CD2 4.33Å
23	R	48.6	Very low	49.4	Very low	152 Å²	152	100.7 Å²	100.7	57%	0.574	56%	0.563	S	S	*	*			trans	-89.8	112.1	150.7	-96.7	-171.8	-156.3	-95.6	3.5	108.1	W4 R21 S25	W4-R23 HydrophobicContact CZ2-CG 4.43Å; R21-R23 PolarHBondContact O-N 3.02Å; R23-S25 PolarHBondContact O-N 3.21Å; R23-S25 VanDerWaalsContact O-N 3.14Å
24	I	55.9	Low	52.1	Low	74 Å²	74	97 Å²	97	38%	0.379	54%	0.538	S	S	.	.			trans	-78.3	97.6	166.9	-61	139.6	0	0	0	105.7	K22 G26 V34	K22-I24 HydrophobicContact CD-CD1 3.85Å; K22-I24 HydrophobicContact CD-CG1 3.48Å; K22-I24 VanDerWaalsContact CD-CG1 3.48Å; K22-I24 VanDerWaalsContact CE-CG1 3.48Å; K22-I24 HydrophobicContact CG-CD1 4.5Å; K22-I24 HydrophobicContact CG-CG1 3.89Å; I24-G26 PolarHBondContact O-N 2.84Å; I24-V34 HydrophobicContact CD1-CB 3.9Å; I24-V34 HydrophobicContact CD1-CG1 4.2Å; I24-V34 WeakPolarHBondContact CD1-O 3.45Å; I24-V34 HydrophobicContact CG1-CB 4.06Å; I24-V34 HydrophobicContact CG2-CB 4.43Å
25	S	49.7	Very low	54.9	Low	117 Å²	117	96.3 Å²	96.3	82%	0.818	52%	0.524	S	S	*	.			trans	-77.3	81.5	170.8	38.4	0	0	0	0	108.7	R23	R23-S25 PolarHBondContact O-N 3.21Å; R23-S25 VanDerWaalsContact O-N 3.14Å
26	G	55.2	Low	57.8	Low	41 Å²	41	95.8 Å²	95.8	42%	0.423	50%	0.502	S	S	.	.			trans	-140.5	134.7	170.4	0	0	0	0	0	109	I24	I24-G26 PolarHBondContact O-N 2.84Å
27	G	51.9	Low	60.7	Low	45 Å²	45	95.9 Å²	95.9	46%	0.464	50%	0.5	S	S	.	.			trans	-76.5	175.5	169.5	0	0	0	0	0	111.2	D29 S30	G27-D29 PolarHBondContact O-N 2.76Å; G27-D29 VanDerWaalsContact O-N 3.12Å; G27-S30 WeakPolarHBondContact O-CB 3.18Å; G27-S30 PolarHBondContact O-N 3.07Å; G27-S30 PolarHBondContact O-OG 3.07Å
28	P	55	Low	63.5	Low	128 Å²	128	96.2 Å²	96.2	83%	0.831	50%	0.496	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54.4	-28.5	172.9	22.2	-31.8	0	0	0	112.6	S30	P28-S30 VanDerWaalsContact C-N 3.3Å; P28-S30 PolarHBondContact O-N 3.18Å
29	D	61.9	Low	66.2	Low	157 Å²	157	94.2 Å²	94.2	84%	0.84	49%	0.492	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88.7	13.7	179.4	-48.3	-47.5	0	0	0	114	G27 T31	G27-D29 PolarHBondContact O-N 2.76Å; G27-D29 VanDerWaalsContact O-N 3.12Å; D29-T31 PolarHBondContact O-N 3.35Å
30	S	71.4	Confident	68.9	Low	31 Å²	31	89.2 Å²	89.2	22%	0.217	48%	0.475	C	S	.	.			trans	-71.9	130.1	177.6	53.6	0	0	0	0	111.3	G27 P28 V32	G27-S30 WeakPolarHBondContact O-CB 3.18Å; G27-S30 PolarHBondContact O-N 3.07Å; G27-S30 PolarHBondContact O-OG 3.07Å; P28-S30 VanDerWaalsContact C-N 3.3Å; P28-S30 PolarHBondContact O-N 3.18Å; S30-V32 PolarHBondContact O-N 3.07Å
31	T	81.2	Confident	71.4	Confident	65 Å²	65	84.7 Å²	84.7	40%	0.399	46%	0.455	S	S	.	.	S	Bend	trans	-57	-30.9	176.3	-53.9	0	0	0	0	112.9	D29 I58 S59 V60	D29-T31 PolarHBondContact O-N 3.35Å; T31-I58 WeakPolarHBondContact O-CA 3.5Å; T31-S59 WeakPolarHBondContact CA-OG 3.37Å; T31-S59 PolarHBondContact O-N 2.78Å; T31-S59 PolarHBondContact O-OG 2.94Å; T31-V60 HydrophobicContact CG2-CB 3.9Å; T31-V60 WeakPolarHBondContact CG2-O 3.4Å
32	V	84.7	Confident	73.1	Confident	68 Å²	68	78.4 Å²	78.4	41%	0.412	45%	0.445	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.8	109.6	179.5	-178.1	0	0	0	0	108.4	S30 V34 V56 N57 I58	S30-V32 PolarHBondContact O-N 3.07Å; V32-V34 HydrophobicContact CG1-CG2 4.46Å; V32-V56 HydrophobicContact CG1-CG2 3.47Å; V32-V56 VanDerWaalsContact CG1-CG2 3.47Å; V32-N57 WeakPolarHBondContact CA-O 3.35Å; V32-I58 HydrophobicContact CG1-CG1 4.48Å; V32-I58 HydrophobicContact CG2-CG1 4.37Å
33	R	86.3	Confident	74.8	Confident	124 Å²	124	78 Å²	78	47%	0.468	45%	0.451	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.2	114.1	175.8	-168.2	-173.6	77	162.6	2.1	109.3	D35 V56 N57	R33-D35 IonicContact CZ-OD1 3.62Å; R33-D35 IonicContact CZ-OD2 3.65Å; R33-D35 IonicContact NE-OD1 3.72Å; R33-D35 PolarHBondContact NE-OD1 3.24Å; R33-D35 IonicContact NE-OD2 3.85Å; R33-D35 VanDerWaalsContact NH2-CG 3.32Å; R33-D35 IonicContact NH2-OD1 2.92Å; R33-D35 PolarHBondContact NH2-OD1 3.49Å; R33-D35 VanDerWaalsContact NH2-OD1 3.14Å; R33-D35 IonicContact NH2-OD2 3.89Å; R33-D35 PolarHBondContact NH2-OD2 3.4Å; R33-V56 CarbonylContact O-C 3.22Å; R33-V56 WeakPolarHBondContact O-CA 2.97Å; R33-V56 WeakPolarHBondContact O-CG2 3.31Å; R33-N57 HydrophobicContact CB-CB 4.37Å; R33-N57 PolarHBondContact N-O 2.89Å; R33-N57 PolarHBondContact O-N 2.86Å
34	V	87.7	Confident	76.3	Confident	25 Å²	25	74.6 Å²	74.6	15%	0.152	44%	0.444	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.2	116.7	175.5	-176.7	0	0	0	0	109	I24 V32 H36 L37 L54 V56	I24-V34 HydrophobicContact CD1-CB 3.9Å; I24-V34 HydrophobicContact CD1-CG1 4.2Å; I24-V34 WeakPolarHBondContact CD1-O 3.45Å; I24-V34 HydrophobicContact CG1-CB 4.06Å; I24-V34 HydrophobicContact CG2-CB 4.43Å; V32-V34 HydrophobicContact CG1-CG2 4.46Å; V34-H36 WeakPolarHBondContact CG1-O 3.5Å; V34-L37 HydrophobicContact CG1-CB 4.38Å; V34-L54 HydrophobicContact CG1-CD1 3.61Å; V34-V56 HydrophobicContact CG2-CB 4.39Å; V34-V56 HydrophobicContact CG2-CG2 3.91Å
35	D	88.7	Confident	77.4	Confident	66 Å²	66	77.3 Å²	77.3	35%	0.353	46%	0.455	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.7	-31.3	-177.6	-64.9	-16.3	0	0	0	111.5	R33 R55 Y116	R33-D35 IonicContact CZ-OD1 3.62Å; R33-D35 IonicContact CZ-OD2 3.65Å; R33-D35 IonicContact NE-OD1 3.72Å; R33-D35 PolarHBondContact NE-OD1 3.24Å; R33-D35 IonicContact NE-OD2 3.85Å; R33-D35 VanDerWaalsContact NH2-CG 3.32Å; R33-D35 IonicContact NH2-OD1 2.92Å; R33-D35 PolarHBondContact NH2-OD1 3.49Å; R33-D35 VanDerWaalsContact NH2-OD1 3.14Å; R33-D35 IonicContact NH2-OD2 3.89Å; R33-D35 PolarHBondContact NH2-OD2 3.4Å; D35-R55 HydrophobicContact CB-CB 4.39Å; D35-R55 PolarHBondContact N-O 2.91Å; D35-Y116 WeakPolarHBondContact OD2-CE2 3.4Å
36	H	89.3	Confident	78.9	Confident	60 Å²	60	75.1 Å²	75.1	28%	0.278	44%	0.437	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-147.4	139	179.4	-172.2	77.4	0	0	0	110.7	V34 Q38 L54 R55	V34-H36 WeakPolarHBondContact CG1-O 3.5Å; H36-Q38 PolarHBondContact NE2-OE1 3.42Å; H36-L54 WeakPolarHBondContact O-CA 2.87Å; H36-L54 WeakPolarHBondContact O-CD1 3.45Å; H36-R55 HydrophobicContact CB-CB 3.82Å; H36-R55 HydrophobicContact CB-CG 3.95Å; H36-R55 PolarHBondContact N-O 2.02Å; H36-R55 PolarHBondContact O-N 2.82Å
37	L	89	Confident	80.4	Confident	69 Å²	69	77.5 Å²	77.5	36%	0.361	45%	0.445	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.6	121.3	169.1	178.8	77.9	0	0	0	108.1	K22 V34 L52 T53 L54	K22-L37 HydrophobicContact CD-CB 3.85Å; K22-L37 HydrophobicContact CD-CD2 3.54Å; K22-L37 HydrophobicContact CD-CG 4.3Å; K22-L37 HydrophobicContact CG-CD2 4.33Å; V34-L37 HydrophobicContact CG1-CB 4.38Å; L37-L52 HydrophobicContact CD1-CD1 3.67Å; L37-T53 CarbonylContact C-O 3.53Å; L37-T53 WeakPolarHBondContact CA-O 3.34Å; L37-L54 HydrophobicContact CD1-CB 4.33Å; L37-L54 HydrophobicContact CD1-CD1 3.95Å
38	Q	89.5	Confident	82.1	Confident	82 Å²	82	76.2 Å²	76.2	38%	0.383	43%	0.432	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.4	139.6	173.4	178.7	166.7	-5.2	0	0	109	H36 E40 L52 T53	H36-Q38 PolarHBondContact NE2-OE1 3.42Å; Q38-E40 HydrophobicContact CG-CG 4.22Å; Q38-E40 PolarHBondContact NE2-OE1 3.16Å; Q38-L52 WeakPolarHBondContact O-CA 3.48Å; Q38-T53 PolarHBondContact N-O 2.81Å; Q38-T53 PolarHBondContact O-N 2.72Å
39	A	87.8	Confident	83.7	Confident	31 Å²	31	75 Å²	75	26%	0.256	42%	0.417	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.4	124.4	-178.8	0	0	0	0	0	108	L20 L50 R51	L20-A39 HydrophobicContact CD1-CB 4.34Å; A39-L50 HydrophobicContact CB-CD1 3.82Å; A39-R51 CarbonylContact C-O 3.56Å; A39-R51 WeakPolarHBondContact CA-O 3.42Å
40	E	88.9	Confident	85	Confident	77 Å²	77	68.8 Å²	68.8	36%	0.36	38%	0.384	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128	143.7	-178	-62	-179.2	162.8	0	0	110.4	Q38 L50 R51	Q38-E40 HydrophobicContact CG-CG 4.22Å; Q38-E40 PolarHBondContact NE2-OE1 3.16Å; E40-L50 CarbonylContact O-C 3.53Å; E40-L50 WeakPolarHBondContact O-CA 3.41Å; E40-R51 HydrophobicContact CB-CB 4.38Å; E40-R51 PolarHBondContact N-O 3.14Å; E40-R51 PolarHBondContact O-N 2.7Å
41	P	90.1	Very high	86	Confident	56 Å²	56	72.5 Å²	72.5	36%	0.364	39%	0.393	S	S	.	.	S	Bend	cis	-77.4	170.4	-0.4	32.9	-35.5	0	0	0	113.1	P43 I49	P41-P43 CarbonylContact C-O 3.54Å; P41-P43 CarbonylContact O-C 3.57Å; P41-I49 WeakPolarHBondContact CD-O 3.37Å
42	S	76.2	Confident	86.5	Confident	89 Å²	89	70.6 Å²	70.6	62%	0.622	38%	0.38	S	S	*	.	S	Bend	trans	-128.6	120.4	171.9	-166.3	0	0	0	0	109.7
43	P	81.2	Confident	86.8	Confident	80 Å²	80	68.3 Å²	68.3	52%	0.519	37%	0.366	S	S	.	.	S	Bend	cis	-62.5	156.6	-2.6	28	-34	0	0	0	112.7	T17 P41	T17-P43 HydrophobicContact CG2-CB 3.76Å; T17-P43 HydrophobicContact CG2-CG 4.19Å; P41-P43 CarbonylContact C-O 3.54Å; P41-P43 CarbonylContact O-C 3.57Å
44	L	80.5	Confident	87.1	Confident	81 Å²	81	63.2 Å²	63.2	42%	0.424	35%	0.348	S	S	.	.	P	Polyproline II helix	trans	-75.1	127.2	178.4	-170.4	62.6	0	0	0	110.3	V46 L50 L125	L44-V46 HydrophobicContact CG-CG2 4.38Å; L44-L50 HydrophobicContact CD1-CB 4.15Å; L44-L50 HydrophobicContact CD1-CD1 3.64Å; L44-L50 HydrophobicContact CD1-CG 4.4Å; L44-L125 HydrophobicContact CD1-CD1 3.57Å; L44-L125 HydrophobicContact CD2-CD1 3.49Å; L44-L125 VanDerWaalsContact CD2-CD1 3.49Å; L44-L125 HydrophobicContact CG-CD1 3.53Å
45	E	79.3	Confident	87.2	Confident	131 Å²	131	67.4 Å²	67.4	61%	0.612	36%	0.361	S	S	*	.	P	Polyproline II helix	trans	-89.5	130	176.1	-63.1	-178	-178.3	0	0	110.3
46	V	81.1	Confident	87.3	Confident	72 Å²	72	64.4 Å²	64.4	44%	0.436	35%	0.345	S	S	.	.	S	Bend	trans	-133.1	123.7	177.9	-175	0	0	0	0	109.5	L44 L125 P128	L44-V46 HydrophobicContact CG-CG2 4.38Å; V46-L125 HydrophobicContact CG2-CD1 4.04Å; V46-P128 HydrophobicContact CG1-CG 4.3Å
47	P	85.8	Confident	87.4	Confident	91 Å²	91	64.1 Å²	64.1	59%	0.591	35%	0.346	S	S	*	.	S	Bend	cis	-66.6	152.9	-7.9	31.7	-35.6	0	0	0	111.5	L125	P47-L125 CarbonylContact C-O 3.55Å; P47-L125 WeakPolarHBondContact CA-O 3.32Å; P47-L125 VanDerWaalsContact CB-O 3.28Å; P47-L125 WeakPolarHBondContact CB-O 3.04Å
48	G	88.4	Confident	87.5	Confident	18 Å²	18	61.1 Å²	61.1	19%	0.186	33%	0.33	C	S	.	.	E	Extended strand (participates in β ladder)	trans	179.1	-172.8	-174.4	0	0	0	0	0	113.3	L125	G48-L125 PolarHBondContact N-O 3.44Å; G48-L125 PolarHBondContact O-N 3.18Å
49	I	88.8	Confident	87.4	Confident	103 Å²	103	60.5 Å²	60.5	53%	0.528	34%	0.335	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.5	126.9	177	-62.8	176.5	0	0	0	108.6	P41 T122 L124	P41-I49 WeakPolarHBondContact CD-O 3.37Å; I49-T122 HydrophobicContact CG2-CG2 3.16Å; I49-L124 HydrophobicContact CG1-CD2 3.93Å
50	L	89.9	Confident	87.5	Confident	26 Å²	26	63 Å²	63	14%	0.136	35%	0.346	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.5	119.7	172.6	169.9	66.2	0	0	0	109.5	A39 E40 L44 T122 F123 L125	A39-L50 HydrophobicContact CB-CD1 3.82Å; E40-L50 CarbonylContact O-C 3.53Å; E40-L50 WeakPolarHBondContact O-CA 3.41Å; L44-L50 HydrophobicContact CD1-CB 4.15Å; L44-L50 HydrophobicContact CD1-CD1 3.64Å; L44-L50 HydrophobicContact CD1-CG 4.4Å; L50-T122 CarbonylContact O-C 3.53Å; L50-T122 WeakPolarHBondContact O-CA 3.47Å; L50-F123 HydrophobicContact CB-CB 4.44Å; L50-F123 PolarHBondContact N-O 2.79Å; L50-F123 PolarHBondContact O-N 3.36Å; L50-L125 HydrophobicContact CB-CD1 3.78Å; L50-L125 HydrophobicContact CB-CD2 4.18Å; L50-L125 HydrophobicContact CB-CG 3.79Å; L50-L125 HydrophobicContact CD2-CD1 4.42Å; L50-L125 HydrophobicContact CD2-CD2 4.08Å
51	R	92.2	Very high	87.5	Confident	108 Å²	108	62.7 Å²	62.7	41%	0.408	35%	0.352	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.9	123.8	162.9	-173.9	-179.2	178.5	-174.6	2	109.4	A39 E40 D120 E121	A39-R51 CarbonylContact C-O 3.56Å; A39-R51 WeakPolarHBondContact CA-O 3.42Å; E40-R51 HydrophobicContact CB-CB 4.38Å; E40-R51 PolarHBondContact N-O 3.14Å; E40-R51 PolarHBondContact O-N 2.7Å; R51-D120 IonicContact CZ-OD1 2.72Å; R51-D120 IonicContact CZ-OD2 3.73Å; R51-D120 IonicContact NE-OD1 3.49Å; R51-D120 PolarHBondContact NE-OD1 3.49Å; R51-D120 IonicContact NE-OD2 3.15Å; R51-D120 IonicContact NH2-OD1 2.94Å; R51-D120 PolarHBondContact NH2-OD1 2.93Å; R51-D120 IonicContact NH2-OD2 3.14Å; R51-D120 PolarHBondContact NH2-OD2 3.14Å; R51-E121 WeakPolarHBondContact CA-O 3.12Å
52	L	90.7	Very high	87.3	Confident	26 Å²	26	61.8 Å²	61.8	14%	0.136	35%	0.345	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.7	116.4	179.4	-177.8	72.3	0	0	0	109.8	L37 Q38 L54 L107 D120 E121 F123	L37-L52 HydrophobicContact CD1-CD1 3.67Å; Q38-L52 WeakPolarHBondContact O-CA 3.48Å; L52-L54 HydrophobicContact CG-CB 4.47Å; L52-L107 HydrophobicContact CD2-CD2 4.04Å; L52-D120 WeakPolarHBondContact O-CA 3.49Å; L52-E121 PolarHBondContact N-O 3Å; L52-E121 PolarHBondContact O-N 3.22Å; L52-F123 HydrophobicContact CB-CD2 4.14Å; L52-F123 HydrophobicContact CB-CE2 3.88Å; L52-F123 HydrophobicContact CD2-CE2 4.1Å
53	T	91.7	Very high	87.9	Confident	20 Å²	20	61.5 Å²	61.5	12%	0.123	34%	0.342	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.8	113.9	170.1	-46.9	0	0	0	0	109.1	L37 Q38 I119 D120	L37-T53 CarbonylContact C-O 3.53Å; L37-T53 WeakPolarHBondContact CA-O 3.34Å; Q38-T53 PolarHBondContact N-O 2.81Å; Q38-T53 PolarHBondContact O-N 2.72Å; T53-I119 CarbonylContact C-O 3.52Å; T53-I119 VanDerWaalsContact CA-O 3.31Å; T53-I119 WeakPolarHBondContact CA-O 3.4Å; T53-D120 PolarHBondContact OG1-OD1 2.7Å
54	L	91.3	Very high	88.3	Confident	16 Å²	16	66.2 Å²	66.2	8%	0.084	36%	0.357	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.8	124.3	-174.3	170.3	61.8	0	0	0	110.2	V34 H36 L37 L52 V56 F108 I119	V34-L54 HydrophobicContact CG1-CD1 3.61Å; H36-L54 WeakPolarHBondContact O-CA 2.87Å; H36-L54 WeakPolarHBondContact O-CD1 3.45Å; L37-L54 HydrophobicContact CD1-CB 4.33Å; L37-L54 HydrophobicContact CD1-CD1 3.95Å; L52-L54 HydrophobicContact CG-CB 4.47Å; L54-V56 HydrophobicContact CD1-CB 4.3Å; L54-V56 HydrophobicContact CG-CG1 4.33Å; L54-F108 HydrophobicContact CD2-CZ 4.09Å; L54-I119 HydrophobicContact CB-CB 4.23Å; L54-I119 HydrophobicContact CD2-CD1 4Å; L54-I119 HydrophobicContact CG-CD1 4.37Å; L54-I119 PolarHBondContact N-O 3Å; L54-I119 PolarHBondContact O-N 2.75Å
55	R	91.8	Very high	88.7	Confident	114 Å²	114	66.6 Å²	66.6	43%	0.43	36%	0.356	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.1	119.7	169.6	-58.5	178.4	-176.1	157.7	2.7	109.4	D35 H36 Y117	D35-R55 HydrophobicContact CB-CB 4.39Å; D35-R55 PolarHBondContact N-O 2.91Å; H36-R55 HydrophobicContact CB-CB 3.82Å; H36-R55 HydrophobicContact CB-CG 3.95Å; H36-R55 PolarHBondContact N-O 2.02Å; H36-R55 PolarHBondContact O-N 2.82Å; R55-Y117 WeakPolarHBondContact CA-O 3.19Å
56	V	90.8	Very high	89.1	Confident	2 Å²	2	62.5 Å²	62.5	1%	0.012	34%	0.34	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.6	135.2	-174.1	61.9	0	0	0	0	110.8	V32 R33 V34 L54 I58 F108 Y117	V32-V56 HydrophobicContact CG1-CG2 3.47Å; V32-V56 VanDerWaalsContact CG1-CG2 3.47Å; R33-V56 CarbonylContact O-C 3.22Å; R33-V56 WeakPolarHBondContact O-CA 2.97Å; R33-V56 WeakPolarHBondContact O-CG2 3.31Å; V34-V56 HydrophobicContact CG2-CB 4.39Å; V34-V56 HydrophobicContact CG2-CG2 3.91Å; L54-V56 HydrophobicContact CD1-CB 4.3Å; L54-V56 HydrophobicContact CG-CG1 4.33Å; V56-I58 HydrophobicContact CG2-CG1 4.29Å; V56-F108 HydrophobicContact CG1-CE1 3.49Å; V56-F108 VanDerWaalsContact CG1-CE1 3.49Å; V56-F108 HydrophobicContact CG1-CZ 3.73Å; V56-Y117 HydrophobicContact CG1-CD2 4.47Å; V56-Y117 PolarHBondContact N-O 3.46Å; V56-Y117 PolarHBondContact O-N 3.45Å
57	N	90.3	Very high	89.4	Confident	55 Å²	55	65.6 Å²	65.6	29%	0.294	35%	0.345	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.5	123.5	171.3	-173.3	11.2	0	0	0	109.3	V32 R33 Y116	V32-N57 WeakPolarHBondContact CA-O 3.35Å; R33-N57 HydrophobicContact CB-CB 4.37Å; R33-N57 PolarHBondContact N-O 2.89Å; R33-N57 PolarHBondContact O-N 2.86Å; N57-Y116 HydrophobicContact CB-CD2 3.92Å; N57-Y116 HydrophobicContact CB-CE2 4.37Å
58	I	90.3	Very high	89.5	Confident	6 Å²	6	63.8 Å²	63.8	3%	0.031	33%	0.332	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.2	110.2	173.7	-58.4	-176.1	0	0	0	107.1	T31 V32 V56 V60 I112 A114 S115 Y117	T31-I58 WeakPolarHBondContact O-CA 3.5Å; V32-I58 HydrophobicContact CG1-CG1 4.48Å; V32-I58 HydrophobicContact CG2-CG1 4.37Å; V56-I58 HydrophobicContact CG2-CG1 4.29Å; I58-V60 WeakPolarHBondContact CG2-O 3.45Å; I58-I112 HydrophobicContact CD1-CG2 3.55Å; I58-A114 CarbonylContact O-C 3.45Å; I58-A114 WeakPolarHBondContact O-CA 3.41Å; I58-A114 WeakPolarHBondContact O-CB 3.45Å; I58-S115 PolarHBondContact N-O 3.24Å; I58-S115 PolarHBondContact O-N 3.49Å; I58-Y117 HydrophobicContact CB-CE2 4.43Å; I58-Y117 HydrophobicContact CD1-CD2 4.06Å; I58-Y117 HydrophobicContact CD1-CE2 3.82Å; I58-Y117 HydrophobicContact CG1-CD2 4.25Å; I58-Y117 HydrophobicContact CG1-CE2 4.24Å
59	S	89.1	Confident	89.5	Confident	69 Å²	69	67.7 Å²	67.7	48%	0.483	34%	0.344	S	S	.	.	S	Bend	trans	-82	-30.1	-175.3	58.4	0	0	0	0	113.3	T31 A114	T31-S59 WeakPolarHBondContact CA-OG 3.37Å; T31-S59 PolarHBondContact O-N 2.78Å; T31-S59 PolarHBondContact O-OG 2.94Å; S59-A114 WeakPolarHBondContact O-CB 3.46Å
60	V	88.5	Confident	89.5	Confident	82 Å²	82	66.3 Å²	66.3	50%	0.497	34%	0.337	S	S	.	.	S	Bend	trans	-135	137.6	177.7	-177.2	0	0	0	0	108.4	T31 I58	T31-V60 HydrophobicContact CG2-CB 3.9Å; T31-V60 WeakPolarHBondContact CG2-O 3.4Å; I58-V60 WeakPolarHBondContact CG2-O 3.45Å
61	P	89	Confident	89.5	Confident	72 Å²	72	70.8 Å²	70.8	47%	0.468	36%	0.356	S	S	.	.	P	Polyproline II helix	trans	-55	131	174.1	-24.3	35.8	0	0	0	110.7	A114	P61-A114 HydrophobicContact CG-CB 4.32Å
62	P	86.6	Confident	89.3	Confident	36 Å²	36	68.8 Å²	68.8	23%	0.234	35%	0.353	C	S	.	.	P	Polyproline II helix	trans	-67.8	155.6	176.3	29	-33.7	0	0	0	110.9	V100 I112	P62-V100 HydrophobicContact CB-CG1 4.37Å; P62-V100 HydrophobicContact CB-CG2 4.33Å; P62-V100 HydrophobicContact CG-CG1 3.92Å; P62-I112 HydrophobicContact CG-CB 3.92Å; P62-I112 HydrophobicContact CG-CD1 3.96Å; P62-I112 HydrophobicContact CG-CG1 4.43Å; P62-I112 HydrophobicContact CG-CG2 4.13Å
63	P	89.1	Confident	89.1	Confident	84 Å²	84	75 Å²	75	55%	0.545	37%	0.374	S	S	.	.	P	Polyproline II helix	trans	-62.8	166.7	171.5	28.9	-35.6	0	0	0	111.4	E65 V66 V100	P63-E65 VanDerWaalsContact C-N 3.25Å; P63-E65 WeakPolarHBondContact CG-O 3.44Å; P63-E65 PolarHBondContact O-N 2.92Å; P63-V66 HydrophobicContact CG-CG1 3.88Å; P63-V100 WeakPolarHBondContact O-CG2 3.49Å
64	E	88.8	Confident	88.8	Confident	179 Å²	179	80.4 Å²	80.4	84%	0.836	40%	0.396	S	S	*	.	S	Bend	trans	-61.2	-34.9	-180	-64.4	-173.6	168	0	0	112.9	P99 V100	E64-P99 WeakPolarHBondContact O-CA 3.15Å; E64-V100 PolarHBondContact O-N 2.83Å
65	E	90.2	Very high	88.5	Confident	89 Å²	89	83.8 Å²	83.8	42%	0.416	41%	0.408	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.6	146.2	177.6	-61.7	-174.8	159.4	0	0	111.4	P63 H97 L98	P63-E65 VanDerWaalsContact C-N 3.25Å; P63-E65 WeakPolarHBondContact CG-O 3.44Å; P63-E65 PolarHBondContact O-N 2.92Å; E65-H97 VanDerWaalsContact OE2-CB 3.29Å; E65-H97 WeakPolarHBondContact OE2-CB 3.39Å; E65-H97 IonicContact OE2-CG 2.9Å; E65-H97 IonicContact OE2-ND1 2.76Å; E65-H97 PolarHBondContact OE2-ND1 3.26Å; E65-L98 WeakPolarHBondContact CA-O 3.22Å
66	V	86.9	Confident	88.1	Confident	44 Å²	44	83.8 Å²	83.8	27%	0.267	42%	0.415	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.2	153.5	178.9	-70.6	0	0	0	0	111.5	P63 V68 L98 V100	P63-V66 HydrophobicContact CG-CG1 3.88Å; V66-V68 HydrophobicContact CG2-CG2 3.83Å; V66-L98 PolarHBondContact N-O 2.75Å; V66-L98 PolarHBondContact O-N 2.94Å; V66-V100 HydrophobicContact CB-CG2 4.12Å; V66-V100 HydrophobicContact CG1-CG2 3.45Å; V66-V100 VanDerWaalsContact CG1-CG2 3.45Å; V66-V100 HydrophobicContact CG2-CG2 3.67Å
67	Y	86.9	Confident	87.5	Confident	138 Å²	138	86.4 Å²	86.4	54%	0.541	44%	0.437	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.2	122.8	166.5	176.6	-94.9	0	0	0	109.7	K69 D94 Y95 A96	Y67-K69 HydrophobicContact CE1-CB 3.94Å; Y67-D94 HydrophobicContact CE2-CB 4.19Å; Y67-D94 PolarHBondContact OH-OD2 2.79Å; Y67-Y95 WeakPolarHBondContact CA-O 3.45Å; Y67-A96 HydrophobicContact CD2-CB 4.29Å
68	V	87.7	Confident	86.7	Confident	53 Å²	53	89.4 Å²	89.4	32%	0.321	45%	0.453	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119	119.9	179.7	-179.1	0	0	0	0	110.4	V66 Y95 L98	V66-V68 HydrophobicContact CG2-CG2 3.83Å; V68-Y95 HydrophobicContact CB-CD2 4.37Å; V68-Y95 HydrophobicContact CG1-CD2 4.46Å; V68-Y95 PolarHBondContact N-O 2.85Å; V68-Y95 PolarHBondContact O-N 3.28Å; V68-L98 HydrophobicContact CB-CD2 4.29Å; V68-L98 HydrophobicContact CG2-CD2 3.78Å
69	K	89.4	Confident	86.1	Confident	99 Å²	99	95.4 Å²	95.4	43%	0.43	49%	0.49	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.5	109.2	173.7	179.7	164.8	-157.1	86.7	0	110.1	Y67 F71 D94	Y67-K69 HydrophobicContact CE1-CB 3.94Å; K69-F71 HydrophobicContact CD-CE2 3.71Å; K69-F71 HydrophobicContact CD-CZ 3.76Å; K69-F71 HydrophobicContact CG-CD2 4.19Å; K69-F71 HydrophobicContact CG-CE2 3.51Å; K69-F71 HydrophobicContact CG-CZ 3.87Å; K69-D94 VanDerWaalsContact CG-OD1 3.32Å; K69-D94 WeakPolarHBondContact CG-OD1 3.22Å; K69-D94 IonicContact NZ-OD1 3.62Å; K69-D94 PolarHBondContact NZ-OD1 2.89Å; K69-D94 IonicContact NZ-OD2 2.79Å; K69-D94 PolarHBondContact NZ-OD2 2.84Å
70	L	89.1	Confident	85.9	Confident	75 Å²	75	100.6 Å²	100.6	39%	0.393	50%	0.499	S	S	.	.			trans	-99.6	132.9	-178.3	-176	62.4	0	0	0	110.9	G91 S92 C93 Y95	L70-G91 WeakPolarHBondContact CD2-O 3.14Å; L70-S92 CarbonylContact O-C 3.6Å; L70-S92 VanDerWaalsContact O-C 3.22Å; L70-S92 WeakPolarHBondContact O-CA 3.49Å; L70-S92 WeakPolarHBondContact O-CB 3.28Å; L70-C93 WeakPolarHBondContact CB-O 3.2Å; L70-C93 PolarHBondContact N-O 2.79Å; L70-C93 PolarHBondContact O-N 3.47Å; L70-Y95 HydrophobicContact CB-CE2 4.13Å; L70-Y95 HydrophobicContact CD2-CE2 4.25Å
71	F	89.3	Confident	85.8	Confident	120 Å²	120	102.2 Å²	102.2	53%	0.526	50%	0.496	S	S	.	.			trans	-120.8	106.9	172.8	-67.5	-80	0	0	0	109.9	K69	K69-F71 HydrophobicContact CD-CE2 3.71Å; K69-F71 HydrophobicContact CD-CZ 3.76Å; K69-F71 HydrophobicContact CG-CD2 4.19Å; K69-F71 HydrophobicContact CG-CE2 3.51Å; K69-F71 HydrophobicContact CG-CZ 3.87Å
72	L	86.9	Confident	85.8	Confident	65 Å²	65	101.5 Å²	101.5	34%	0.34	49%	0.49	S	S	.	.			trans	-102.8	131.5	177.1	-173.1	63.1	0	0	0	110.4	I84 F90 S92	L72-I84 HydrophobicContact CB-CB 4.32Å; L72-I84 HydrophobicContact CD2-CB 4.15Å; L72-I84 HydrophobicContact CD2-CG1 4.22Å; L72-I84 HydrophobicContact CD2-CG2 4.34Å; L72-I84 HydrophobicContact CG-CB 4.23Å; L72-I84 HydrophobicContact CG-CG1 4.15Å; L72-I84 PolarHBondContact O-N 3.18Å; L72-F90 HydrophobicContact CD2-CE1 4.25Å; L72-F90 HydrophobicContact CD2-CZ 4.15Å; L72-S92 PolarHBondContact N-OG 2.74Å; L72-S92 PolarHBondContact O-OG 2.63Å; L72-S92 VanDerWaalsContact O-OG 3.1Å
73	R	87.7	Confident	85.9	Confident	157 Å²	157	105.6 Å²	105.6	59%	0.592	50%	0.501	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-128.5	142	174.2	-67.8	-179.2	162.7	-171.3	-4.7	109.9	W81 V82 R83	R73-W81 HydrophobicContact CB-CE3 3.69Å; R73-W81 HydrophobicContact CB-CZ3 4.23Å; R73-V82 CarbonylContact C-O 3.53Å; R73-V82 VanDerWaalsContact CA-O 3.27Å; R73-V82 WeakPolarHBondContact CA-O 3.4Å; R73-R83 HydrophobicContact CG-CB 4.49Å
74	K	84.3	Confident	85.9	Confident	134 Å²	134	103.6 Å²	103.6	58%	0.583	49%	0.485	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-114.6	132.5	172.4	-177.3	175.9	-179.8	177.9	0	109.1	I76 V82 I84	K74-I76 HydrophobicContact CG-CG1 4.43Å; K74-V82 PolarHBondContact N-O 3.05Å; K74-V82 PolarHBondContact O-N 2.96Å; K74-I84 HydrophobicContact CB-CD1 3.72Å; K74-I84 HydrophobicContact CB-CG1 4.1Å
75	R	86.1	Confident	86.1	Confident	87 Å²	87	98.5 Å²	98.5	33%	0.328	47%	0.468	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.1	124.1	167.4	-171.7	174.7	72.4	-174.4	12.8	108.9	T16 E18 A77 W81	T16-R75 PolarHBondContact O-NH2 2.87Å; T16-R75 VanDerWaalsContact O-NH2 3.11Å; E18-R75 VanDerWaalsContact OE1-CD 3.3Å; E18-R75 WeakPolarHBondContact OE1-CD 3.4Å; E18-R75 IonicContact OE1-CZ 2.77Å; E18-R75 IonicContact OE1-NE 2.87Å; E18-R75 IonicContact OE1-NH1 3.55Å; E18-R75 PolarHBondContact OE1-NH1 3.33Å; E18-R75 VanDerWaalsContact OE2-CB 3.28Å; E18-R75 WeakPolarHBondContact OE2-CB 3.31Å; E18-R75 IonicContact OE2-CZ 3.7Å; E18-R75 IonicContact OE2-NE 3.37Å; E18-R75 IonicContact OE2-NH1 3.79Å; R75-A77 WeakPolarHBondContact CG-O 3.12Å; R75-W81 HydrophobicContact CB-CD2 4.29Å; R75-W81 HydrophobicContact CB-CE3 4.17Å; R75-W81 HydrophobicContact CB-CZ3 4.35Å
76	I	82.8	Confident	86	Confident	114 Å²	114	97.5 Å²	97.5	59%	0.585	47%	0.47	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-108.5	-27.7	-179.4	-54.7	-172.8	0	0	0	111.3	K74 R80 V82	K74-I76 HydrophobicContact CG-CG1 4.43Å; I76-R80 PolarHBondContact N-O 3.44Å; I76-R80 VanDerWaalsContact N-O 3.1Å; I76-V82 HydrophobicContact CD1-CB 3.75Å; I76-V82 HydrophobicContact CD1-CG1 4.35Å; I76-V82 HydrophobicContact CD1-CG2 3.51Å; I76-V82 HydrophobicContact CG1-CB 4.3Å; I76-V82 HydrophobicContact CG1-CG2 4.06Å
77	A	77.4	Confident	86	Confident	56 Å²	56	100 Å²	100	46%	0.463	48%	0.481	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.8	171.4	174.8	0	0	0	0	0	109	R75 T79 R80	R75-A77 WeakPolarHBondContact CG-O 3.12Å; A77-T79 PolarHBondContact O-N 3.24Å; A77-R80 PolarHBondContact O-N 3.21Å; A77-R80 VanDerWaalsContact O-N 3.17Å
78	D	74.6	Confident	86	Confident	119 Å²	119	102.3 Å²	102.3	64%	0.636	49%	0.494	S	S	*	.	T	Hydrogen-bonded Turn	trans	-49.8	-29.3	-168.6	-66.3	-31.5	0	0	0	115.4
79	T	77	Confident	85.7	Confident	132 Å²	132	101.6 Å²	101.6	81%	0.81	50%	0.498	S	S	*	.	T	Hydrogen-bonded Turn	trans	-126.4	-7.8	179.3	59.1	0	0	0	0	114.8	A77	A77-T79 PolarHBondContact O-N 3.24Å
80	R	85.1	Confident	85.3	Confident	177 Å²	177	102.1 Å²	102.1	67%	0.668	50%	0.5	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-97.5	112.3	-172.9	-169.3	177.8	-74.1	-166.9	-0.9	111.5	I76 A77 V82	I76-R80 PolarHBondContact N-O 3.44Å; I76-R80 VanDerWaalsContact N-O 3.1Å; A77-R80 PolarHBondContact O-N 3.21Å; A77-R80 VanDerWaalsContact O-N 3.17Å; R80-V82 HydrophobicContact CG-CG2 4.2Å
81	W	87.6	Confident	85.1	Confident	117 Å²	117	98.6 Å²	98.6	44%	0.443	48%	0.482	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.9	119.3	169.1	-71.1	88.9	0	0	0	110.7	E18 R73 R75	E18-W81 HydrophobicContact CG-CH2 3.76Å; E18-W81 HydrophobicContact CG-CZ2 3.87Å; E18-W81 WeakPolarHBondContact OE1-CH2 3.35Å; E18-W81 WeakPolarHBondContact OE1-CZ2 3.07Å; E18-W81 WeakPolarHBondContact OE2-CH2 3.37Å; E18-W81 VanDerWaalsContact OE2-CZ2 3.24Å; E18-W81 WeakPolarHBondContact OE2-CZ2 3.35Å; E18-W81 WeakPolarHBondContact OE2-CZ3 3.47Å; R73-W81 HydrophobicContact CB-CE3 3.69Å; R73-W81 HydrophobicContact CB-CZ3 4.23Å; R75-W81 HydrophobicContact CB-CD2 4.29Å; R75-W81 HydrophobicContact CB-CE3 4.17Å; R75-W81 HydrophobicContact CB-CZ3 4.35Å
82	V	87.8	Confident	85.2	Confident	56 Å²	56	93.2 Å²	93.2	34%	0.339	46%	0.46	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102	128.7	175.9	179.6	0	0	0	0	108.9	R73 K74 I76 R80 I84	R73-V82 CarbonylContact C-O 3.53Å; R73-V82 VanDerWaalsContact CA-O 3.27Å; R73-V82 WeakPolarHBondContact CA-O 3.4Å; K74-V82 PolarHBondContact N-O 3.05Å; K74-V82 PolarHBondContact O-N 2.96Å; I76-V82 HydrophobicContact CD1-CB 3.75Å; I76-V82 HydrophobicContact CD1-CG1 4.35Å; I76-V82 HydrophobicContact CD1-CG2 3.51Å; I76-V82 HydrophobicContact CG1-CB 4.3Å; I76-V82 HydrophobicContact CG1-CG2 4.06Å; R80-V82 HydrophobicContact CG-CG2 4.2Å; V82-I84 PolarHBondContact O-N 2.91Å
83	R	89.6	Confident	85.3	Confident	123 Å²	123	90.3 Å²	90.3	46%	0.464	44%	0.444	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.9	125.4	172.2	-175.6	-179.7	-179.5	-171.7	-5.4	108.6	R73 P85 S92	R73-R83 HydrophobicContact CG-CB 4.49Å; R83-P85 WeakPolarHBondContact O-CD 3.36Å; R83-S92 VanDerWaalsContact CG-OG 3.25Å; R83-S92 WeakPolarHBondContact CG-OG 3.21Å; R83-S92 PolarHBondContact NE-OG 3.06Å
84	I	88.7	Confident	85.5	Confident	41 Å²	41	86.5 Å²	86.5	21%	0.21	44%	0.436	C	S	.	.	P	Polyproline II helix	trans	-78.4	118.1	173.6	-56	-54.7	0	0	0	107.5	L72 K74 V82 S92	L72-I84 HydrophobicContact CB-CB 4.32Å; L72-I84 HydrophobicContact CD2-CB 4.15Å; L72-I84 HydrophobicContact CD2-CG1 4.22Å; L72-I84 HydrophobicContact CD2-CG2 4.34Å; L72-I84 HydrophobicContact CG-CB 4.23Å; L72-I84 HydrophobicContact CG-CG1 4.15Å; L72-I84 PolarHBondContact O-N 3.18Å; K74-I84 HydrophobicContact CB-CD1 3.72Å; K74-I84 HydrophobicContact CB-CG1 4.1Å; V82-I84 PolarHBondContact O-N 2.91Å; I84-S92 WeakPolarHBondContact O-CB 3.3Å; I84-S92 PolarHBondContact O-N 3.31Å; I84-S92 PolarHBondContact O-OG 2.97Å
85	P	92.3	Very high	85.6	Confident	73 Å²	73	83.5 Å²	83.5	47%	0.474	42%	0.421	S	S	.	.	P	Polyproline II helix	trans	-63.8	160	179.1	28.4	-35.3	0	0	0	111	R83 I87 F90	R83-P85 WeakPolarHBondContact O-CD 3.36Å; P85-I87 HydrophobicContact CB-CG1 4.39Å; P85-I87 HydrophobicContact CG-CD1 3.78Å; P85-I87 HydrophobicContact CG-CG1 4.05Å; P85-I87 PolarHBondContact O-N 3.12Å; P85-F90 VanDerWaalsContact O-O 3.14Å
86	C	89.6	Confident	85.7	Confident	67 Å²	67	82.3 Å²	82.3	45%	0.453	43%	0.43	S	S	.	.			trans	-75.3	112.8	171.1	-172.5	0	0	0	0	109.4	F90 C93	C86-F90 CarbonylContact C-O 3.45Å; C86-F90 WeakPolarHBondContact CA-O 3.37Å; C86-C93 VanDerWaalsContact CA-SG 3.53Å; C86-C93 HydrophobicContact CB-CB 3.94Å; C86-C93 WeakPolarHBondContact CB-SG 3.49Å; C86-C93 VanDerWaalsContact SG-CA 3.58Å; C86-C93 WeakPolarHBondContact SG-CB 3.29Å; C86-C93 CovalentContact SG-SG 2.04Å; C86-C93 PolarHBondContact SG-SG 3.22Å
87	I	86.9	Confident	86	Confident	96 Å²	96	83.5 Å²	83.5	49%	0.492	43%	0.433	S	S	.	.	B	Isolated β-bridge	trans	-130.2	121	178.3	-60.3	176.3	0	0	0	107.4	P85 G89 F90	P85-I87 HydrophobicContact CB-CG1 4.39Å; P85-I87 HydrophobicContact CG-CD1 3.78Å; P85-I87 HydrophobicContact CG-CG1 4.05Å; P85-I87 PolarHBondContact O-N 3.12Å; I87-G89 PolarHBondContact O-N 3.41Å; I87-G89 VanDerWaalsContact O-N 3.13Å; I87-F90 PolarHBondContact N-O 3.2Å; I87-F90 WeakPolarHBondContact O-CB 3.25Å; I87-F90 PolarHBondContact O-N 3.18Å
88	F	86.1	Confident	86.4	Confident	187 Å²	187	82.1 Å²	82.1	82%	0.82	42%	0.418	S	S	*	.	T	Hydrogen-bonded Turn	trans	51	34.2	-177.5	-54.1	-60.1	0	0	0	114.5	F90	F88-F90 VanDerWaalsContact C-N 3.3Å; F88-F90 PolarHBondContact O-N 3.48Å
89	G	82.5	Confident	87.2	Confident	39 Å²	39	78.2 Å²	78.2	40%	0.402	40%	0.399	S	S	.	.	T	Hydrogen-bonded Turn	trans	78	10.9	-177.2	0	0	0	0	0	114.3	I87 Y95	I87-G89 PolarHBondContact O-N 3.41Å; I87-G89 VanDerWaalsContact O-N 3.13Å; G89-Y95 PolarHBondContact O-OH 3.38Å
90	F	80.9	Confident	87.6	Confident	109 Å²	109	72.8 Å²	72.8	48%	0.478	37%	0.366	S	S	.	.	B	Isolated β-bridge	trans	-111.9	141.3	172.6	-176.7	-96	0	0	0	111.1	L72 P85 C86 I87 F88 L132	L72-F90 HydrophobicContact CD2-CE1 4.25Å; L72-F90 HydrophobicContact CD2-CZ 4.15Å; P85-F90 VanDerWaalsContact O-O 3.14Å; C86-F90 CarbonylContact C-O 3.45Å; C86-F90 WeakPolarHBondContact CA-O 3.37Å; I87-F90 PolarHBondContact N-O 3.2Å; I87-F90 WeakPolarHBondContact O-CB 3.25Å; I87-F90 PolarHBondContact O-N 3.18Å; F88-F90 VanDerWaalsContact C-N 3.3Å; F88-F90 PolarHBondContact O-N 3.48Å; F90-L132 HydrophobicContact CD2-CD1 4.42Å; F90-L132 HydrophobicContact CD2-CD2 4.24Å
91	G	85	Confident	87.9	Confident	2 Å²	2	66.6 Å²	66.6	2%	0.021	35%	0.349	C	S	.	.	S	Bend	trans	106.1	-144	179.8	0	0	0	0	0	113.2	L70 C93	L70-G91 WeakPolarHBondContact CD2-O 3.14Å; G91-C93 VanDerWaalsContact C-N 3.35Å; G91-C93 PolarHBondContact O-N 2.92Å
92	S	89.6	Confident	87.8	Confident	7 Å²	7	63.9 Å²	63.9	5%	0.049	34%	0.343	C	S	.	.	S	Bend	trans	-83.4	74.5	-179.3	-56.4	0	0	0	0	112.3	L70 L72 R83 I84	L70-S92 CarbonylContact O-C 3.6Å; L70-S92 VanDerWaalsContact O-C 3.22Å; L70-S92 WeakPolarHBondContact O-CA 3.49Å; L70-S92 WeakPolarHBondContact O-CB 3.28Å; L72-S92 PolarHBondContact N-OG 2.74Å; L72-S92 PolarHBondContact O-OG 2.63Å; L72-S92 VanDerWaalsContact O-OG 3.1Å; R83-S92 VanDerWaalsContact CG-OG 3.25Å; R83-S92 WeakPolarHBondContact CG-OG 3.21Å; R83-S92 PolarHBondContact NE-OG 3.06Å; I84-S92 WeakPolarHBondContact O-CB 3.3Å; I84-S92 PolarHBondContact O-N 3.31Å; I84-S92 PolarHBondContact O-OG 2.97Å
93	C	90	Very high	87.2	Confident	3 Å²	3	66.5 Å²	66.5	2%	0.02	35%	0.354	C	S	.	.			trans	-100.7	154.2	-175.3	-59	0	0	0	0	113.3	L70 C86 G91 Y95	L70-C93 WeakPolarHBondContact CB-O 3.2Å; L70-C93 PolarHBondContact N-O 2.79Å; L70-C93 PolarHBondContact O-N 3.47Å; C86-C93 VanDerWaalsContact CA-SG 3.53Å; C86-C93 HydrophobicContact CB-CB 3.94Å; C86-C93 WeakPolarHBondContact CB-SG 3.49Å; C86-C93 VanDerWaalsContact SG-CA 3.58Å; C86-C93 WeakPolarHBondContact SG-CB 3.29Å; C86-C93 CovalentContact SG-SG 2.04Å; C86-C93 PolarHBondContact SG-SG 3.22Å; G91-C93 VanDerWaalsContact C-N 3.35Å; G91-C93 PolarHBondContact O-N 2.92Å; C93-Y95 HydrophobicContact CB-CD2 4.42Å; C93-Y95 HydrophobicContact CB-CE1 4.05Å; C93-Y95 HydrophobicContact CB-CE2 3.75Å
94	D	91.2	Very high	86.9	Confident	78 Å²	78	61.9 Å²	61.9	42%	0.417	34%	0.34	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.5	119	167.5	-67.1	-3.3	0	0	0	107.9	Y67 K69	Y67-D94 HydrophobicContact CE2-CB 4.19Å; Y67-D94 PolarHBondContact OH-OD2 2.79Å; K69-D94 VanDerWaalsContact CG-OD1 3.32Å; K69-D94 WeakPolarHBondContact CG-OD1 3.22Å; K69-D94 IonicContact NZ-OD1 3.62Å; K69-D94 PolarHBondContact NZ-OD1 2.89Å; K69-D94 IonicContact NZ-OD2 2.79Å; K69-D94 PolarHBondContact NZ-OD2 2.84Å
95	Y	87.4	Confident	86.8	Confident	70 Å²	70	64.8 Å²	64.8	28%	0.275	35%	0.352	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.2	103.3	178.9	-54	-84.6	0	0	0	108.9	Y67 V68 L70 G89 C93	Y67-Y95 WeakPolarHBondContact CA-O 3.45Å; V68-Y95 HydrophobicContact CB-CD2 4.37Å; V68-Y95 HydrophobicContact CG1-CD2 4.46Å; V68-Y95 PolarHBondContact N-O 2.85Å; V68-Y95 PolarHBondContact O-N 3.28Å; L70-Y95 HydrophobicContact CB-CE2 4.13Å; L70-Y95 HydrophobicContact CD2-CE2 4.25Å; G89-Y95 PolarHBondContact O-OH 3.38Å; C93-Y95 HydrophobicContact CB-CD2 4.42Å; C93-Y95 HydrophobicContact CB-CE1 4.05Å; C93-Y95 HydrophobicContact CB-CE2 3.75Å
96	A	87.4	Confident	86.4	Confident	63 Å²	63	67.5 Å²	67.5	52%	0.521	36%	0.359	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80	144.3	167.5	0	0	0	0	0	109.4	Y67 L98	Y67-A96 HydrophobicContact CD2-CB 4.29Å; A96-L98 VanDerWaalsContact C-N 3.32Å; A96-L98 PolarHBondContact O-N 3.05Å
97	H	88.4	Confident	86.2	Confident	138 Å²	138	66.4 Å²	66.4	64%	0.639	35%	0.348	S	S	*	.	E	Extended strand (participates in β ladder)	trans	59.5	37.6	175.7	-56.1	-75.2	0	0	0	114	E65 P99	E65-H97 VanDerWaalsContact OE2-CB 3.29Å; E65-H97 WeakPolarHBondContact OE2-CB 3.39Å; E65-H97 IonicContact OE2-CG 2.9Å; E65-H97 IonicContact OE2-ND1 2.76Å; E65-H97 PolarHBondContact OE2-ND1 3.26Å; H97-P99 WeakPolarHBondContact O-CD 3.33Å
98	L	86.4	Confident	86.3	Confident	27 Å²	27	63.5 Å²	63.5	14%	0.141	33%	0.332	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.8	116.6	176.8	-172.6	69.7	0	0	0	108.7	E65 V66 V68 A96 V100 L102 L103	E65-L98 WeakPolarHBondContact CA-O 3.22Å; V66-L98 PolarHBondContact N-O 2.75Å; V66-L98 PolarHBondContact O-N 2.94Å; V68-L98 HydrophobicContact CB-CD2 4.29Å; V68-L98 HydrophobicContact CG2-CD2 3.78Å; A96-L98 VanDerWaalsContact C-N 3.32Å; A96-L98 PolarHBondContact O-N 3.05Å; L98-V100 PolarHBondContact O-N 3.46Å; L98-L102 HydrophobicContact CD1-CD2 3.97Å; L98-L103 HydrophobicContact CD2-CD1 3.78Å; L98-L103 HydrophobicContact CD2-CG 4.49Å
99	P	91	Very high	86.4	Confident	38 Å²	38	56.1 Å²	56.1	25%	0.247	31%	0.309	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-63.4	124.5	177.5	-19.8	33.5	0	0	0	108.8	E64 H97 C101 L102	E64-P99 WeakPolarHBondContact O-CA 3.15Å; H97-P99 WeakPolarHBondContact O-CD 3.33Å; P99-C101 PolarHBondContact O-N 3.31Å; P99-L102 HydrophobicContact CB-CB 4.43Å; P99-L102 VanDerWaalsContact O-CB 3.25Å; P99-L102 WeakPolarHBondContact O-CB 3.39Å; P99-L102 PolarHBondContact O-N 2.89Å
100	V	87.1	Confident	86.7	Confident	18 Å²	18	57.5 Å²	57.5	11%	0.109	31%	0.311	C	S	.	.	H	α-helix	trans	-56.2	-41.7	-173.8	170.3	0	0	0	0	110.9	P62 P63 E64 V66 L98 L102 T104 I112	P62-V100 HydrophobicContact CB-CG1 4.37Å; P62-V100 HydrophobicContact CB-CG2 4.33Å; P62-V100 HydrophobicContact CG-CG1 3.92Å; P63-V100 WeakPolarHBondContact O-CG2 3.49Å; E64-V100 PolarHBondContact O-N 2.83Å; V66-V100 HydrophobicContact CB-CG2 4.12Å; V66-V100 HydrophobicContact CG1-CG2 3.45Å; V66-V100 VanDerWaalsContact CG1-CG2 3.45Å; V66-V100 HydrophobicContact CG2-CG2 3.67Å; L98-V100 PolarHBondContact O-N 3.46Å; V100-L102 PolarHBondContact O-N 3.32Å; V100-T104 PolarHBondContact O-OG1 2.95Å; V100-I112 HydrophobicContact CG1-CD1 3.39Å; V100-I112 HydrophobicContact CG1-CG1 4.35Å
101	C	89.8	Confident	87.1	Confident	47 Å²	47	57.3 Å²	57.3	32%	0.318	32%	0.321	S	S	.	.	H	α-helix	trans	-61.4	-23.5	178.8	-81	0	0	0	0	115.1	P99 L103 T104 H105 C110	P99-C101 PolarHBondContact O-N 3.31Å; C101-L103 VanDerWaalsContact C-N 3.26Å; C101-L103 PolarHBondContact O-N 2.91Å; C101-T104 PolarHBondContact O-N 3.44Å; C101-H105 VanDerWaalsContact O-CB 3.31Å; C101-H105 WeakPolarHBondContact O-CB 3.18Å; C101-H105 PolarHBondContact O-N 3.47Å; C101-H105 VanDerWaalsContact O-N 3.16Å; C101-H105 PolarHBondContact O-ND1 2.96Å; C101-C110 WeakPolarHBondContact CA-SG 3.44Å; C101-C110 HydrophobicContact CB-CB 4.16Å; C101-C110 WeakPolarHBondContact CB-SG 3.24Å; C101-C110 WeakPolarHBondContact SG-CB 3.34Å; C101-C110 CovalentContact SG-SG 2.02Å; C101-C110 PolarHBondContact SG-SG 3.39Å
102	L	85.3	Confident	87.4	Confident	59 Å²	59	58 Å²	58	31%	0.309	32%	0.324	S	S	.	.	H	α-helix	trans	-59.3	-39.6	-175.7	-173.3	67.5	0	0	0	112	L98 P99 V100	L98-L102 HydrophobicContact CD1-CD2 3.97Å; P99-L102 HydrophobicContact CB-CB 4.43Å; P99-L102 VanDerWaalsContact O-CB 3.25Å; P99-L102 WeakPolarHBondContact O-CB 3.39Å; P99-L102 PolarHBondContact O-N 2.89Å; V100-L102 PolarHBondContact O-N 3.32Å
103	L	75.3	Confident	87.5	Confident	111 Å²	111	64.4 Å²	64.4	58%	0.581	35%	0.351	S	S	*	.	H	α-helix	trans	-101.4	-16.4	-176.5	-62.5	-178.6	0	0	0	114	L98 C101	L98-L103 HydrophobicContact CD2-CD1 3.78Å; L98-L103 HydrophobicContact CD2-CG 4.49Å; C101-L103 VanDerWaalsContact C-N 3.26Å; C101-L103 PolarHBondContact O-N 2.91Å
104	T	84.4	Confident	87.6	Confident	27 Å²	27	66.7 Å²	66.7	17%	0.166	37%	0.37	C	S	.	.	H	α-helix	trans	-116.6	-8.9	-164.5	58.2	0	0	0	0	114	V100 C101 E106 L107 F108 I112	V100-T104 PolarHBondContact O-OG1 2.95Å; C101-T104 PolarHBondContact O-N 3.44Å; T104-E106 VanDerWaalsContact C-N 3.26Å; T104-E106 PolarHBondContact O-N 3.03Å; T104-L107 PolarHBondContact O-N 3.2Å; T104-F108 HydrophobicContact CG2-CD2 4.09Å; T104-F108 HydrophobicContact CG2-CE2 4.11Å; T104-F108 PolarHBondContact O-N 2.79Å; T104-I112 HydrophobicContact CG2-CD1 4.4Å; T104-I112 WeakPolarHBondContact OG1-CD1 3.47Å
105	H	86.8	Confident	87.8	Confident	101 Å²	101	65.8 Å²	65.8	47%	0.468	37%	0.37	S	S	.	.	H	α-helix	trans	-57.4	-38.6	-176.4	74.5	-78.3	0	0	0	112.8	C101 L107 G109	C101-H105 VanDerWaalsContact O-CB 3.31Å; C101-H105 WeakPolarHBondContact O-CB 3.18Å; C101-H105 PolarHBondContact O-N 3.47Å; C101-H105 VanDerWaalsContact O-N 3.16Å; C101-H105 PolarHBondContact O-ND1 2.96Å; H105-L107 PolarHBondContact O-N 3.32Å; H105-G109 WeakPolarHBondContact O-CA 3.41Å; H105-G109 PolarHBondContact O-N 2.96Å; H105-G109 VanDerWaalsContact O-N 3.07Å
106	E	83.7	Confident	88.1	Confident	131 Å²	131	68 Å²	68	61%	0.612	38%	0.378	S	S	*	.	H	α-helix	trans	-67.7	-23.5	177.8	-60.5	-171.3	168.4	0	0	112.8	T104 F123	T104-E106 VanDerWaalsContact C-N 3.26Å; T104-E106 PolarHBondContact O-N 3.03Å; E106-F123 HydrophobicContact CB-CE1 4.49Å
107	L	85.1	Confident	88.4	Confident	43 Å²	43	66.9 Å²	66.9	23%	0.225	36%	0.361	C	S	.	.	H	α-helix	trans	-99	-41.3	-174.5	-67.2	174	0	0	0	113.2	L52 T104 H105 I119 F123	L52-L107 HydrophobicContact CD2-CD2 4.04Å; T104-L107 PolarHBondContact O-N 3.2Å; H105-L107 PolarHBondContact O-N 3.32Å; L107-I119 HydrophobicContact CB-CD1 3.85Å; L107-I119 HydrophobicContact CD2-CD1 4.09Å; L107-I119 HydrophobicContact CD2-CG2 3.89Å; L107-I119 HydrophobicContact CG-CD1 4.48Å; L107-F123 HydrophobicContact CD2-CE1 4.5Å; L107-F123 HydrophobicContact CD2-CE2 4.25Å; L107-F123 HydrophobicContact CD2-CZ 3.6Å
108	F	88.6	Confident	88.7	Confident	36 Å²	36	64.3 Å²	64.3	16%	0.158	36%	0.359	C	S	.	.	H	α-helix	trans	-120.8	-8.8	-171.1	-52.9	-52.2	0	0	0	113.8	L54 V56 T104 I112 Y117 I119	L54-F108 HydrophobicContact CD2-CZ 4.09Å; V56-F108 HydrophobicContact CG1-CE1 3.49Å; V56-F108 VanDerWaalsContact CG1-CE1 3.49Å; V56-F108 HydrophobicContact CG1-CZ 3.73Å; T104-F108 HydrophobicContact CG2-CD2 4.09Å; T104-F108 HydrophobicContact CG2-CE2 4.11Å; T104-F108 PolarHBondContact O-N 2.79Å; F108-I112 HydrophobicContact CB-CD1 4.32Å; F108-I112 HydrophobicContact CB-CG1 4.05Å; F108-I112 HydrophobicContact CB-CG2 4.38Å; F108-I112 HydrophobicContact CD2-CD1 3.89Å; F108-Y117 HydrophobicContact CB-CD1 4.5Å; F108-Y117 HydrophobicContact CB-CE1 4.04Å; F108-Y117 AromaticContact CD1-CD1 3.61Å; F108-Y117 HydrophobicContact CD1-CD1 3.61Å; F108-Y117 HydrophobicContact CD1-CD2 4.03Å; F108-Y117 AromaticContact CD1-CE1 3.98Å; F108-Y117 HydrophobicContact CD1-CE1 3.98Å; F108-Y117 HydrophobicContact CD1-CE2 4.38Å; F108-Y117 AromaticContact CD1-CG 3.62Å; F108-Y117 HydrophobicContact CD1-CG 3.62Å; F108-Y117 HydrophobicContact CE1-CD1 4.39Å; F108-Y117 HydrophobicContact CE1-CD2 4.35Å; F108-Y117 AromaticContact CE1-CG 3.99Å; F108-Y117 HydrophobicContact CE1-CG 3.99Å; F108-Y117 HydrophobicContact CG-CD1 4.48Å; F108-Y117 HydrophobicContact CG-CE1 4.43Å; F108-I119 HydrophobicContact CD1-CD1 3.82Å; F108-I119 HydrophobicContact CE1-CD1 3.34Å; F108-I119 HydrophobicContact CZ-CD1 4.14Å
109	G	88.1	Confident	88.9	Confident	32 Å²	32	63.6 Å²	63.6	33%	0.33	36%	0.355	S	S	.	.			trans	68.3	-179.7	-165.5	0	0	0	0	0	112.9	H105	H105-G109 WeakPolarHBondContact O-CA 3.41Å; H105-G109 PolarHBondContact O-N 2.96Å; H105-G109 VanDerWaalsContact O-N 3.07Å
110	C	89	Confident	89.1	Confident	67 Å²	67	65.4 Å²	65.4	45%	0.453	36%	0.363	S	S	.	.	S	Bend	trans	-138.4	130.7	-179.6	-76.6	0	0	0	0	111.4	C101	C101-C110 WeakPolarHBondContact CA-SG 3.44Å; C101-C110 HydrophobicContact CB-CB 4.16Å; C101-C110 WeakPolarHBondContact CB-SG 3.24Å; C101-C110 WeakPolarHBondContact SG-CB 3.34Å; C101-C110 CovalentContact SG-SG 2.02Å; C101-C110 PolarHBondContact SG-SG 3.39Å
111	P	90	Very high	89.3	Confident	106 Å²	106	69.6 Å²	69.6	69%	0.688	38%	0.381	S	S	*	.	S	Bend	cis	-72.2	150	-1.6	31.2	-35.6	0	0	0	112.7	K113	P111-K113 PolarHBondContact O-N 2.83Å
112	I	90	Very high	89.4	Confident	15 Å²	15	71.5 Å²	71.5	8%	0.077	39%	0.391	C	S	.	.	P	Polyproline II helix	trans	-68.4	131.4	174.5	-58.1	-177.3	0	0	0	109	I58 P62 V100 T104 F108	I58-I112 HydrophobicContact CD1-CG2 3.55Å; P62-I112 HydrophobicContact CG-CB 3.92Å; P62-I112 HydrophobicContact CG-CD1 3.96Å; P62-I112 HydrophobicContact CG-CG1 4.43Å; P62-I112 HydrophobicContact CG-CG2 4.13Å; V100-I112 HydrophobicContact CG1-CD1 3.39Å; V100-I112 HydrophobicContact CG1-CG1 4.35Å; T104-I112 HydrophobicContact CG2-CD1 4.4Å; T104-I112 WeakPolarHBondContact OG1-CD1 3.47Å; F108-I112 HydrophobicContact CB-CD1 4.32Å; F108-I112 HydrophobicContact CB-CG1 4.05Å; F108-I112 HydrophobicContact CB-CG2 4.38Å; F108-I112 HydrophobicContact CD2-CD1 3.89Å
113	K	92.8	Very high	89.4	Confident	143 Å²	143	70.7 Å²	70.7	62%	0.622	39%	0.385	S	S	*	.	P	Polyproline II helix	trans	-103.8	156.3	178.9	-62.6	-178.3	-177.8	177.6	0	110.3	P111 S115 Y117	P111-K113 PolarHBondContact O-N 2.83Å; K113-S115 PolarHBondContact O-N 2.9Å; K113-Y117 PolarHBondContact N-OH 3.47Å; K113-Y117 WeakPolarHBondContact O-CE2 3.22Å; K113-Y117 PolarHBondContact O-OH 3.02Å; K113-Y117 VanDerWaalsContact O-OH 3.07Å
114	A	92.6	Very high	90	Very high	51 Å²	51	72 Å²	72	42%	0.421	39%	0.392	S	S	.	.	S	Bend	trans	-66.6	116.7	167.2	0	0	0	0	0	108.7	I58 S59 P61	I58-A114 CarbonylContact O-C 3.45Å; I58-A114 WeakPolarHBondContact O-CA 3.41Å; I58-A114 WeakPolarHBondContact O-CB 3.45Å; S59-A114 WeakPolarHBondContact O-CB 3.46Å; P61-A114 HydrophobicContact CG-CB 4.32Å
115	S	93.9	Very high	89.9	Confident	58 Å²	58	72.7 Å²	72.7	41%	0.406	40%	0.395	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-168.3	165.8	-178.2	-166.3	0	0	0	0	110.9	I58 K113 Y117	I58-S115 PolarHBondContact N-O 3.24Å; I58-S115 PolarHBondContact O-N 3.49Å; K113-S115 PolarHBondContact O-N 2.9Å; S115-Y117 WeakPolarHBondContact O-CD2 3.22Å
116	Y	94.2	Very high	89.5	Confident	117 Å²	117	73.7 Å²	73.7	46%	0.459	40%	0.397	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.2	118.6	162.6	-167.5	-96.5	0	0	0	109.7	D35 N57	D35-Y116 WeakPolarHBondContact OD2-CE2 3.4Å; N57-Y116 HydrophobicContact CB-CD2 3.92Å; N57-Y116 HydrophobicContact CB-CE2 4.37Å
117	Y	93.4	Very high	88.9	Confident	39 Å²	39	70.7 Å²	70.7	15%	0.153	39%	0.386	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.3	130.7	177.9	-65	-92.2	0	0	0	110	R55 V56 I58 F108 K113 S115	R55-Y117 WeakPolarHBondContact CA-O 3.19Å; V56-Y117 HydrophobicContact CG1-CD2 4.47Å; V56-Y117 PolarHBondContact N-O 3.46Å; V56-Y117 PolarHBondContact O-N 3.45Å; I58-Y117 HydrophobicContact CB-CE2 4.43Å; I58-Y117 HydrophobicContact CD1-CD2 4.06Å; I58-Y117 HydrophobicContact CD1-CE2 3.82Å; I58-Y117 HydrophobicContact CG1-CD2 4.25Å; I58-Y117 HydrophobicContact CG1-CE2 4.24Å; F108-Y117 HydrophobicContact CB-CD1 4.5Å; F108-Y117 HydrophobicContact CB-CE1 4.04Å; F108-Y117 AromaticContact CD1-CD1 3.61Å; F108-Y117 HydrophobicContact CD1-CD1 3.61Å; F108-Y117 HydrophobicContact CD1-CD2 4.03Å; F108-Y117 AromaticContact CD1-CE1 3.98Å; F108-Y117 HydrophobicContact CD1-CE1 3.98Å; F108-Y117 HydrophobicContact CD1-CE2 4.38Å; F108-Y117 AromaticContact CD1-CG 3.62Å; F108-Y117 HydrophobicContact CD1-CG 3.62Å; F108-Y117 HydrophobicContact CE1-CD1 4.39Å; F108-Y117 HydrophobicContact CE1-CD2 4.35Å; F108-Y117 AromaticContact CE1-CG 3.99Å; F108-Y117 HydrophobicContact CE1-CG 3.99Å; F108-Y117 HydrophobicContact CG-CD1 4.48Å; F108-Y117 HydrophobicContact CG-CE1 4.43Å; K113-Y117 PolarHBondContact N-OH 3.47Å; K113-Y117 WeakPolarHBondContact O-CE2 3.22Å; K113-Y117 PolarHBondContact O-OH 3.02Å; K113-Y117 VanDerWaalsContact O-OH 3.07Å; S115-Y117 WeakPolarHBondContact O-CD2 3.22Å
118	S	95	Very high	87.8	Confident	84 Å²	84	71.7 Å²	71.7	59%	0.587	40%	0.395	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-122.4	107	171.6	-178.6	0	0	0	0	108.3
119	I	91.8	Very high	86.4	Confident	12 Å²	12	77.1 Å²	77.1	6%	0.062	42%	0.421	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.2	133.2	-175.5	-62.4	158.1	0	0	0	108.2	T53 L54 L107 F108 E121	T53-I119 CarbonylContact C-O 3.52Å; T53-I119 VanDerWaalsContact CA-O 3.31Å; T53-I119 WeakPolarHBondContact CA-O 3.4Å; L54-I119 HydrophobicContact CB-CB 4.23Å; L54-I119 HydrophobicContact CD2-CD1 4Å; L54-I119 HydrophobicContact CG-CD1 4.37Å; L54-I119 PolarHBondContact N-O 3Å; L54-I119 PolarHBondContact O-N 2.75Å; L107-I119 HydrophobicContact CB-CD1 3.85Å; L107-I119 HydrophobicContact CD2-CD1 4.09Å; L107-I119 HydrophobicContact CD2-CG2 3.89Å; L107-I119 HydrophobicContact CG-CD1 4.48Å; F108-I119 HydrophobicContact CD1-CD1 3.82Å; F108-I119 HydrophobicContact CE1-CD1 3.34Å; F108-I119 HydrophobicContact CZ-CD1 4.14Å; I119-E121 HydrophobicContact CG2-CB 3.99Å; I119-E121 HydrophobicContact CG2-CG 3.66Å
120	D	93.9	Very high	85	Confident	77 Å²	77	79.2 Å²	79.2	41%	0.412	43%	0.427	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.3	88.9	169.2	-172.6	8	0	0	0	107.1	R51 L52 T53	R51-D120 IonicContact CZ-OD1 2.72Å; R51-D120 IonicContact CZ-OD2 3.73Å; R51-D120 IonicContact NE-OD1 3.49Å; R51-D120 PolarHBondContact NE-OD1 3.49Å; R51-D120 IonicContact NE-OD2 3.15Å; R51-D120 IonicContact NH2-OD1 2.94Å; R51-D120 PolarHBondContact NH2-OD1 2.93Å; R51-D120 IonicContact NH2-OD2 3.14Å; R51-D120 PolarHBondContact NH2-OD2 3.14Å; L52-D120 WeakPolarHBondContact O-CA 3.49Å; T53-D120 PolarHBondContact OG1-OD1 2.7Å
121	E	91.3	Very high	83.5	Confident	106 Å²	106	78.4 Å²	78.4	50%	0.495	42%	0.422	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129	153.7	-168	-72.1	-66.6	173.7	0	0	111.2	R51 L52 I119 F123	R51-E121 WeakPolarHBondContact CA-O 3.12Å; L52-E121 PolarHBondContact N-O 3Å; L52-E121 PolarHBondContact O-N 3.22Å; I119-E121 HydrophobicContact CG2-CB 3.99Å; I119-E121 HydrophobicContact CG2-CG 3.66Å; E121-F123 HydrophobicContact CB-CD2 4.49Å; E121-F123 HydrophobicContact CB-CE2 3.58Å; E121-F123 HydrophobicContact CB-CZ 3.73Å
122	T	91.8	Very high	81.9	Confident	87 Å²	87	76.7 Å²	76.7	53%	0.534	41%	0.407	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.5	125.2	-179	-58.2	0	0	0	0	110.6	I49 L50	I49-T122 HydrophobicContact CG2-CG2 3.16Å; L50-T122 CarbonylContact O-C 3.53Å; L50-T122 WeakPolarHBondContact O-CA 3.47Å
123	F	86.5	Confident	80.2	Confident	42 Å²	42	78.7 Å²	78.7	18%	0.184	42%	0.422	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116	139.5	-176.2	-59.7	-88.7	0	0	0	111	L50 L52 E106 L107 E121 L125	L50-F123 HydrophobicContact CB-CB 4.44Å; L50-F123 PolarHBondContact N-O 2.79Å; L50-F123 PolarHBondContact O-N 3.36Å; L52-F123 HydrophobicContact CB-CD2 4.14Å; L52-F123 HydrophobicContact CB-CE2 3.88Å; L52-F123 HydrophobicContact CD2-CE2 4.1Å; E106-F123 HydrophobicContact CB-CE1 4.49Å; L107-F123 HydrophobicContact CD2-CE1 4.5Å; L107-F123 HydrophobicContact CD2-CE2 4.25Å; L107-F123 HydrophobicContact CD2-CZ 3.6Å; E121-F123 HydrophobicContact CB-CD2 4.49Å; E121-F123 HydrophobicContact CB-CE2 3.58Å; E121-F123 HydrophobicContact CB-CZ 3.73Å; F123-L125 PolarHBondContact O-N 2.93Å
124	L	87.1	Confident	78.8	Confident	138 Å²	138	78.8 Å²	78.8	72%	0.723	42%	0.418	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-85.9	108.3	170	-73	167.6	0	0	0	109.8	I49 K126	I49-L124 HydrophobicContact CG1-CD2 3.93Å; L124-K126 PolarHBondContact O-N 2.78Å
125	L	81.5	Confident	77.3	Confident	42 Å²	42	80.3 Å²	80.3	22%	0.22	42%	0.419	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.1	113.6	173.8	-62.3	-176.7	0	0	0	109.8	L44 V46 P47 G48 L50 F123	L44-L125 HydrophobicContact CD1-CD1 3.57Å; L44-L125 HydrophobicContact CD2-CD1 3.49Å; L44-L125 VanDerWaalsContact CD2-CD1 3.49Å; L44-L125 HydrophobicContact CG-CD1 3.53Å; V46-L125 HydrophobicContact CG2-CD1 4.04Å; P47-L125 CarbonylContact C-O 3.55Å; P47-L125 WeakPolarHBondContact CA-O 3.32Å; P47-L125 VanDerWaalsContact CB-O 3.28Å; P47-L125 WeakPolarHBondContact CB-O 3.04Å; G48-L125 PolarHBondContact N-O 3.44Å; G48-L125 PolarHBondContact O-N 3.18Å; L50-L125 HydrophobicContact CB-CD1 3.78Å; L50-L125 HydrophobicContact CB-CD2 4.18Å; L50-L125 HydrophobicContact CB-CG 3.79Å; L50-L125 HydrophobicContact CD2-CD1 4.42Å; L50-L125 HydrophobicContact CD2-CD2 4.08Å; F123-L125 PolarHBondContact O-N 2.93Å
126	K	79.9	Confident	75.8	Confident	121 Å²	121	80.9 Å²	80.9	53%	0.526	42%	0.417	S	S	.	.			trans	-87.5	154.4	173.3	-61.9	-179.9	-177.7	-179.8	0	110.3	L124	L124-K126 PolarHBondContact O-N 2.78Å
127	N	69.6	Low	74.4	Confident	69 Å²	69	81.7 Å²	81.7	37%	0.369	43%	0.425	S	S	.	.			trans	-52.6	133	176.8	-165.6	18.6	0	0	0	110	E129 T130 S131	N127-E129 PolarHBondContact O-N 3.27Å; N127-T130 PolarHBondContact O-N 2.81Å; N127-T130 PolarHBondContact O-OG1 2.85Å; N127-S131 PolarHBondContact O-N 3.2Å
128	P	63.1	Low	73	Confident	63 Å²	63	84.4 Å²	84.4	41%	0.409	44%	0.439	S	S	.	.	H	α-helix	trans	-57.1	-30.8	-171.4	-25	34.9	0	0	0	113.2	V46 T130 S131 L132	V46-P128 HydrophobicContact CG1-CG 4.3Å; P128-T130 VanDerWaalsContact C-N 3.33Å; P128-T130 PolarHBondContact O-N 3.11Å; P128-S131 PolarHBondContact O-N 2.77Å; P128-L132 HydrophobicContact CB-CD1 4.37Å; P128-L132 WeakPolarHBondContact O-CB 3.04Å; P128-L132 VanDerWaalsContact O-CG 3.24Å; P128-L132 WeakPolarHBondContact O-CG 3.48Å; P128-L132 PolarHBondContact O-N 2.8Å
129	E	59.6	Low	71.5	Confident	151 Å²	151	82.7 Å²	82.7	71%	0.706	43%	0.425	S	S	*	.	H	α-helix	trans	-62	-40.3	177.8	-60.2	-177.3	159.1	0	0	112.3	N127 S133	N127-E129 PolarHBondContact O-N 3.27Å; E129-S133 WeakPolarHBondContact O-CB 3.24Å; E129-S133 PolarHBondContact O-N 2.96Å; E129-S133 PolarHBondContact O-OG 2.86Å
130	T	57.3	Low	70.1	Confident	76 Å²	76	90.3 Å²	90.3	47%	0.466	45%	0.453	S	S	.	.	H	α-helix	trans	-74.7	-33	177.1	63.1	0	0	0	0	112.4	N127 P128 S133 R134	N127-T130 PolarHBondContact O-N 2.81Å; N127-T130 PolarHBondContact O-OG1 2.85Å; P128-T130 VanDerWaalsContact C-N 3.33Å; P128-T130 PolarHBondContact O-N 3.11Å; T130-S133 PolarHBondContact O-OG 3.13Å; T130-S133 VanDerWaalsContact O-OG 3.05Å; T130-R134 WeakPolarHBondContact O-CB 3.3Å; T130-R134 PolarHBondContact O-N 3.37Å
131	S	59	Low	68.8	Low	49 Å²	49	89.3 Å²	89.3	34%	0.343	46%	0.456	S	S	.	.	H	α-helix	trans	-77.8	-43.1	179.3	-64.4	0	0	0	0	112.1	N127 P128 R134 L135	N127-S131 PolarHBondContact O-N 3.2Å; P128-S131 PolarHBondContact O-N 2.77Å; S131-R134 PolarHBondContact O-N 2.04Å; S131-L135 VanDerWaalsContact O-CB 3.3Å; S131-L135 WeakPolarHBondContact O-CB 3.28Å; S131-L135 PolarHBondContact O-N 3.07Å
132	L	56.3	Low	67.4	Low	71 Å²	71	90.7 Å²	90.7	37%	0.372	46%	0.46	S	S	.	.	H	α-helix	trans	-66.9	-42.4	179.9	-74.7	168.6	0	0	0	111.6	F90 P128 R134 L135 L136	F90-L132 HydrophobicContact CD2-CD1 4.42Å; F90-L132 HydrophobicContact CD2-CD2 4.24Å; P128-L132 HydrophobicContact CB-CD1 4.37Å; P128-L132 WeakPolarHBondContact O-CB 3.04Å; P128-L132 VanDerWaalsContact O-CG 3.24Å; P128-L132 WeakPolarHBondContact O-CG 3.48Å; P128-L132 PolarHBondContact O-N 2.8Å; L132-R134 VanDerWaalsContact C-N 3.32Å; L132-R134 PolarHBondContact O-N 3.5Å; L132-L135 PolarHBondContact O-N 3.44Å; L132-L136 WeakPolarHBondContact O-CB 3.45Å; L132-L136 WeakPolarHBondContact O-CG 3.27Å; L132-L136 PolarHBondContact O-N 2.98Å
133	S	54.8	Low	65.7	Low	57 Å²	57	94.9 Å²	94.9	40%	0.399	47%	0.466	S	S	.	.	H	α-helix	trans	-58.7	-45	174.9	49.3	0	0	0	0	111.5	E129 T130 Q137	E129-S133 WeakPolarHBondContact O-CB 3.24Å; E129-S133 PolarHBondContact O-N 2.96Å; E129-S133 PolarHBondContact O-OG 2.86Å; T130-S133 PolarHBondContact O-OG 3.13Å; T130-S133 VanDerWaalsContact O-OG 3.05Å; S133-Q137 WeakPolarHBondContact O-CB 2.84Å; S133-Q137 WeakPolarHBondContact O-CG 3.48Å; S133-Q137 PolarHBondContact O-N 2.88Å
134	R	62.1	Low	64.4	Low	144 Å²	144	96.6 Å²	96.6	54%	0.543	49%	0.488	S	S	.	.	H	α-helix	trans	-66.7	-41.6	176.5	-175.3	175.1	159.1	162.5	-6.2	112.9	T130 S131 L132 Q137 Q138	T130-R134 WeakPolarHBondContact O-CB 3.3Å; T130-R134 PolarHBondContact O-N 3.37Å; S131-R134 PolarHBondContact O-N 2.04Å; L132-R134 VanDerWaalsContact C-N 3.32Å; L132-R134 PolarHBondContact O-N 3.5Å; R134-Q137 WeakPolarHBondContact O-CB 2.91Å; R134-Q137 PolarHBondContact O-N 2.89Å; R134-Q138 WeakPolarHBondContact O-CG 3.25Å; R134-Q138 PolarHBondContact O-N 3.23Å
135	L	60.8	Low	62.7	Low	84 Å²	84	97.3 Å²	97.3	44%	0.44	49%	0.493	S	S	.	.	H	α-helix	trans	-70.1	-39.8	-179.4	-153.7	133.9	0	0	0	111	S131 L132 Q138 V139	S131-L135 VanDerWaalsContact O-CB 3.3Å; S131-L135 WeakPolarHBondContact O-CB 3.28Å; S131-L135 PolarHBondContact O-N 3.07Å; L132-L135 PolarHBondContact O-N 3.44Å; L135-Q138 PolarHBondContact O-N 3.42Å; L135-V139 HydrophobicContact CD2-CG2 4.47Å; L135-V139 WeakPolarHBondContact O-CG2 3.18Å; L135-V139 PolarHBondContact O-N 2.77Å
136	L	62.2	Low	60.9	Low	70 Å²	70	106 Å²	106	37%	0.366	53%	0.532	S	S	.	.	H	α-helix	trans	-58	-53.3	168.2	-73.5	169.8	0	0	0	109.6	L132 Q138 V139 W140	L132-L136 WeakPolarHBondContact O-CB 3.45Å; L132-L136 WeakPolarHBondContact O-CG 3.27Å; L132-L136 PolarHBondContact O-N 2.98Å; L136-Q138 PolarHBondContact O-N 3.1Å; L136-V139 PolarHBondContact O-N 2.76Å; L136-W140 VanDerWaalsContact C-CD1 3.46Å; L136-W140 WeakPolarHBondContact O-CB 3.16Å; L136-W140 PolarHBondContact O-N 2.92Å
137	Q	64.8	Low	60	Low	134 Å²	134	105.3 Å²	105.3	63%	0.626	53%	0.533	S	S	*	.	H	α-helix	trans	-52.9	-40.9	177.6	-78.6	171.9	-14.9	0	0	112.6	S133 R134 A141	S133-Q137 WeakPolarHBondContact O-CB 2.84Å; S133-Q137 WeakPolarHBondContact O-CG 3.48Å; S133-Q137 PolarHBondContact O-N 2.88Å; R134-Q137 WeakPolarHBondContact O-CB 2.91Å; R134-Q137 PolarHBondContact O-N 2.89Å; Q137-A141 WeakPolarHBondContact O-CB 3.46Å; Q137-A141 PolarHBondContact O-N 2.91Å
138	Q	65.3	Low	59.5	Low	95 Å²	95	107.2 Å²	107.2	44%	0.444	54%	0.541	S	S	.	.	H	α-helix	trans	-66.3	-42.8	175.7	-74.6	178.5	-32.4	0	0	112.8	R134 L135 L136 A141 K142	R134-Q138 WeakPolarHBondContact O-CG 3.25Å; R134-Q138 PolarHBondContact O-N 3.23Å; L135-Q138 PolarHBondContact O-N 3.42Å; L136-Q138 PolarHBondContact O-N 3.1Å; Q138-A141 PolarHBondContact O-N 2.98Å; Q138-K142 PolarHBondContact O-N 3.23Å
139	V	63.9	Low	59.3	Low	49 Å²	49	109.7 Å²	109.7	30%	0.297	55%	0.549	S	S	.	.	H	α-helix	trans	-64.8	-44	176.1	172.3	0	0	0	0	110.8	L135 L136 K142 R143	L135-V139 HydrophobicContact CD2-CG2 4.47Å; L135-V139 WeakPolarHBondContact O-CG2 3.18Å; L135-V139 PolarHBondContact O-N 2.77Å; L136-V139 PolarHBondContact O-N 2.76Å; V139-K142 PolarHBondContact O-N 2.9Å; V139-R143 PolarHBondContact O-N 3.34Å
140	W	61	Low	59.3	Low	171 Å²	171	107.2 Å²	107.2	65%	0.648	54%	0.54	S	S	*	.	H	α-helix	trans	-63.6	-44.1	176	-73.1	108	0	0	0	111.5	L136 K142 R143 A144	L136-W140 VanDerWaalsContact C-CD1 3.46Å; L136-W140 WeakPolarHBondContact O-CB 3.16Å; L136-W140 PolarHBondContact O-N 2.92Å; W140-K142 VanDerWaalsContact C-N 3.35Å; W140-K142 PolarHBondContact O-N 3.27Å; W140-R143 PolarHBondContact O-N 2.87Å; W140-A144 WeakPolarHBondContact O-CB 3.33Å; W140-A144 PolarHBondContact O-N 3.17Å
141	A	67.6	Low	59.4	Low	56 Å²	56	109.2 Å²	109.2	46%	0.463	54%	0.544	S	S	.	.	H	α-helix	trans	-63	-39	176.6	0	0	0	0	0	112.4	Q137 Q138 A144 N145	Q137-A141 WeakPolarHBondContact O-CB 3.46Å; Q137-A141 PolarHBondContact O-N 2.91Å; Q138-A141 PolarHBondContact O-N 2.98Å; A141-A144 PolarHBondContact O-N 3.1Å; A141-N145 PolarHBondContact O-N 2.82Å
142	K	61.5	Low	59.4	Low	136 Å²	136	113.2 Å²	113.2	59%	0.591	56%	0.558	S	S	*	*	H	α-helix	trans	-68.2	-38	174	-85.1	-156.6	174.1	-163.5	0	112.8	Q138 V139 W140 N145	Q138-K142 PolarHBondContact O-N 3.23Å; V139-K142 PolarHBondContact O-N 2.9Å; W140-K142 VanDerWaalsContact C-N 3.35Å; W140-K142 PolarHBondContact O-N 3.27Å; K142-N145 PolarHBondContact O-N 2.87Å
143	R	57	Low	59.7	Low	175 Å²	175	116.2 Å²	116.2	66%	0.66	57%	0.571	S	S	*	*	H	α-helix	trans	-71.5	-27.1	176	-78.6	-173.2	-175.5	176.7	1.4	113.7	V139 W140 N145	V139-R143 PolarHBondContact O-N 3.34Å; W140-R143 PolarHBondContact O-N 2.87Å; R143-N145 VanDerWaalsContact C-N 3.29Å
144	A	58	Low	60	Low	78 Å²	78	120.8 Å²	120.8	65%	0.645	58%	0.584	S	S	*	*	H	α-helix	trans	-77.4	-15.3	177.3	0	0	0	0	0	113.4	W140 A141	W140-A144 WeakPolarHBondContact O-CB 3.33Å; W140-A144 PolarHBondContact O-N 3.17Å; A141-A144 PolarHBondContact O-N 3.1Å
145	N	52.5	Low	59.9	Low	152 Å²	152	118.8 Å²	118.8	81%	0.813	59%	0.587	S	S	*	*	T	Hydrogen-bonded Turn	trans	-105.6	16.1	178.9	-82	-8.6	0	0	0	113.2	A141 K142 R143	A141-N145 PolarHBondContact O-N 2.82Å; K142-N145 PolarHBondContact O-N 2.87Å; R143-N145 VanDerWaalsContact C-N 3.29Å
146	Q	43.7	Very low	59.8	Low	226 Å²	226	122 Å²	122	100%	1.056	60%	0.601	S	S	*	*			trans	-119.7	0	167.3	-80.5	-178.7	-0.1	0	0	108.9

Retrieved 146 of 146 residues in 99.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).