A0A077Z4A7_TRITR Loading...

Sm protein F

Plays a role in pre-mRNA splicing as a core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome.

AlphaFold DB , UniProt , Accession A0A077Z4A7, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 86 aa.

						>A0A077Z4A7_TRITR|A0A077Z4A7
MSSPVNPKPFINSLIGKPIIVKLKWGMEYKGYLLSTDNYMNLQLAHTEEYINGQLAGNLGETLIRCNNVLYIRGLEEAEEGEMHEY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48.7	Very low	88.7	Confident	241 Å²	241	104.7 Å²	104.7	100%	1.187	60%	0.601	S	S	*	*				0	124.7	0	-67.6	-176.9	-167.1	0	0	107.3
2	S	81.9	Confident	89.3	Confident	122 Å²	122	103.8 Å²	103.8	85%	0.853	59%	0.593	S	S	*	*	P	Polyproline II helix	trans	-70.6	128.2	173.3	52.8	0	0	0	0	109.4
3	S	87.1	Confident	89.7	Confident	98 Å²	98	100.2 Å²	100.2	69%	0.685	58%	0.578	S	S	*	*	P	Polyproline II helix	trans	-59.7	146.1	172.7	-60.1	0	0	0	0	110.5	V5	S3-V5 PolarHBondContact O-N 2.96Å
4	P	91.8	Very high	90.3	Very high	122 Å²	122	93.8 Å²	93.8	79%	0.792	54%	0.54	S	S	*	.	P	Polyproline II helix	trans	-59.4	134.6	175.6	25.7	-33.9	0	0	0	110.2
5	V	93.4	Very high	90.7	Very high	101 Å²	101	92.5 Å²	92.5	61%	0.612	53%	0.53	S	S	*	.	P	Polyproline II helix	trans	-96.8	117.6	178	-173.6	0	0	0	0	108.9	S3 P9 F10	S3-V5 PolarHBondContact O-N 2.96Å; V5-P9 HydrophobicContact CG1-CB 4.2Å; V5-F10 HydrophobicContact CG1-CB 3.88Å
6	N	95.1	Very high	91.1	Very high	107 Å²	107	90.1 Å²	90.1	57%	0.572	53%	0.532	S	S	*	.	P	Polyproline II helix	trans	-72.7	158.1	175.8	-72.8	-38.6	0	0	0	111.4	K8 P9 F10	N6-K8 PolarHBondContact O-N 2.81Å; N6-P9 HydrophobicContact CB-CG 4.07Å; N6-P9 VanDerWaalsContact O-CD 3.25Å; N6-P9 WeakPolarHBondContact O-CD 3.37Å; N6-F10 WeakPolarHBondContact O-CB 3.49Å; N6-F10 PolarHBondContact O-N 3Å
7	P	95.9	Very high	91.5	Very high	81 Å²	81	90.9 Å²	90.9	53%	0.526	53%	0.527	S	S	.	.	H	α-helix	trans	-57.7	-41.1	-177	-28.5	36	0	0	0	114.8	F10 I11 M40	P7-F10 WeakPolarHBondContact O-CB 3.38Å; P7-F10 PolarHBondContact O-N 2.69Å; P7-I11 WeakPolarHBondContact O-CG1 3.42Å; P7-I11 PolarHBondContact O-N 3.06Å; P7-M40 HydrophobicContact CB-CE 4.16Å
8	K	94.3	Very high	91.8	Very high	113 Å²	113	86.6 Å²	86.6	49%	0.491	50%	0.503	S	S	.	.	H	α-helix	trans	-64	-53.1	178.7	-74.6	-173	178.7	-168.6	0	112.1	N6 F10 I11 N12	N6-K8 PolarHBondContact O-N 2.81Å; K8-F10 VanDerWaalsContact C-N 3.26Å; K8-F10 PolarHBondContact O-N 2.89Å; K8-I11 PolarHBondContact O-N 2.7Å; K8-N12 WeakPolarHBondContact O-CB 3.25Å; K8-N12 VanDerWaalsContact O-CG 3.24Å; K8-N12 PolarHBondContact O-N 3.23Å
9	P	95	Very high	92.2	Very high	72 Å²	72	82.1 Å²	82.1	47%	0.468	48%	0.476	S	S	.	.	H	α-helix	trans	-54.5	-39.9	170.7	-29.1	33.8	0	0	0	114	V5 N6 S13	V5-P9 HydrophobicContact CG1-CB 4.2Å; N6-P9 HydrophobicContact CB-CG 4.07Å; N6-P9 VanDerWaalsContact O-CD 3.25Å; N6-P9 WeakPolarHBondContact O-CD 3.37Å; P9-S13 WeakPolarHBondContact O-CB 3.38Å; P9-S13 PolarHBondContact O-N 3.02Å
10	F	96	Very high	92.4	Very high	83 Å²	83	78.7 Å²	78.7	36%	0.364	46%	0.456	S	S	.	.	H	α-helix	trans	-61.5	-54.3	178.7	176.3	-106.5	0	0	0	111.9	V5 N6 P7 K8 N12 S13 L14 I72	V5-F10 HydrophobicContact CG1-CB 3.88Å; N6-F10 WeakPolarHBondContact O-CB 3.49Å; N6-F10 PolarHBondContact O-N 3Å; P7-F10 WeakPolarHBondContact O-CB 3.38Å; P7-F10 PolarHBondContact O-N 2.69Å; K8-F10 VanDerWaalsContact C-N 3.26Å; K8-F10 PolarHBondContact O-N 2.89Å; F10-N12 VanDerWaalsContact C-N 3.31Å; F10-N12 PolarHBondContact O-N 3.03Å; F10-S13 WeakPolarHBondContact O-CB 3.38Å; F10-S13 PolarHBondContact O-N 3.47Å; F10-S13 PolarHBondContact O-OG 3.28Å; F10-L14 HydrophobicContact CD1-CD1 4.42Å; F10-L14 HydrophobicContact CE1-CD1 3.85Å; F10-L14 HydrophobicContact CZ-CD1 3.98Å; F10-L14 PolarHBondContact O-N 3.18Å; F10-I72 HydrophobicContact CE1-CG2 4.26Å
11	I	96.1	Very high	92.7	Very high	12 Å²	12	74.9 Å²	74.9	6%	0.062	43%	0.434	C	S	.	.	H	α-helix	trans	-63.8	-39.6	-179.2	-62.4	170.9	0	0	0	110.7	P7 K8 S13 L14 L33 T36 M40 L42 I72	P7-I11 WeakPolarHBondContact O-CG1 3.42Å; P7-I11 PolarHBondContact O-N 3.06Å; K8-I11 PolarHBondContact O-N 2.7Å; I11-S13 PolarHBondContact O-N 2.79Å; I11-L14 WeakPolarHBondContact O-CB 3.27Å; I11-L14 PolarHBondContact O-N 3.34Å; I11-L33 HydrophobicContact CG2-CD2 4.2Å; I11-T36 HydrophobicContact CG2-CG2 3.82Å; I11-M40 HydrophobicContact CD1-CB 4.39Å; I11-M40 HydrophobicContact CD1-CE 4.27Å; I11-M40 HydrophobicContact CD1-CG 3.93Å; I11-M40 HydrophobicContact CD1-SD 3.7Å; I11-L42 HydrophobicContact CG2-CD2 4.38Å; I11-I72 HydrophobicContact CG1-CG2 4.22Å
12	N	95.9	Very high	95.1	Very high	94 Å²	94	65.9 Å²	65.9	50%	0.503	39%	0.388	S	S	.	.	H	α-helix	trans	-60.4	-33.1	175.7	-72.2	-8.4	0	0	0	112.3	K8 F10 L14 I15	K8-N12 WeakPolarHBondContact O-CB 3.25Å; K8-N12 VanDerWaalsContact O-CG 3.24Å; K8-N12 PolarHBondContact O-N 3.23Å; F10-N12 VanDerWaalsContact C-N 3.31Å; F10-N12 PolarHBondContact O-N 3.03Å; N12-L14 PolarHBondContact O-N 3.13Å; N12-I15 HydrophobicContact CB-CD1 4.49Å; N12-I15 PolarHBondContact O-N 2.65Å
13	S	95.5	Very high	95.9	Very high	57 Å²	57	60.8 Å²	60.8	40%	0.399	35%	0.352	S	S	.	.	T	Hydrogen-bonded Turn	trans	-71.2	-12.2	176.7	80.9	0	0	0	0	114.3	P9 F10 I11 K17	P9-S13 WeakPolarHBondContact O-CB 3.38Å; P9-S13 PolarHBondContact O-N 3.02Å; F10-S13 WeakPolarHBondContact O-CB 3.38Å; F10-S13 PolarHBondContact O-N 3.47Å; F10-S13 PolarHBondContact O-OG 3.28Å; I11-S13 PolarHBondContact O-N 2.79Å; S13-K17 WeakPolarHBondContact O-CD 3.42Å; S13-K17 VanDerWaalsContact O-CE 3.3Å; S13-K17 WeakPolarHBondContact O-CE 3.41Å; S13-K17 PolarHBondContact O-NZ 2.93Å
14	L	97.1	Very high	96.4	Very high	10 Å²	10	61.6 Å²	61.6	5%	0.052	34%	0.343	C	S	.	.	T	Hydrogen-bonded Turn	trans	-94.7	-8.9	177	-61.2	179	0	0	0	112.9	F10 I11 N12 G16 K17 I19 L33 I72	F10-L14 HydrophobicContact CD1-CD1 4.42Å; F10-L14 HydrophobicContact CE1-CD1 3.85Å; F10-L14 HydrophobicContact CZ-CD1 3.98Å; F10-L14 PolarHBondContact O-N 3.18Å; I11-L14 WeakPolarHBondContact O-CB 3.27Å; I11-L14 PolarHBondContact O-N 3.34Å; N12-L14 PolarHBondContact O-N 3.13Å; L14-G16 PolarHBondContact O-N 2.92Å; L14-K17 WeakPolarHBondContact O-CB 3.24Å; L14-K17 PolarHBondContact O-N 2.91Å; L14-I19 HydrophobicContact CB-CG2 3.92Å; L14-I19 HydrophobicContact CD1-CG2 4.23Å; L14-I19 HydrophobicContact CG-CG2 4.46Å; L14-L33 HydrophobicContact CB-CD2 3.88Å; L14-I72 HydrophobicContact CD1-CD1 3.77Å; L14-I72 HydrophobicContact CD1-CG1 3.8Å
15	I	97.3	Very high	96.5	Very high	75 Å²	75	64.5 Å²	64.5	39%	0.385	34%	0.338	S	S	.	.	T	Hydrogen-bonded Turn	trans	-61	131.6	177.1	-63.1	172.8	0	0	0	109	N12 K17 L33 T36	N12-I15 HydrophobicContact CB-CD1 4.49Å; N12-I15 PolarHBondContact O-N 2.65Å; I15-K17 VanDerWaalsContact C-N 3.29Å; I15-K17 PolarHBondContact O-N 2.91Å; I15-L33 HydrophobicContact CG1-CD2 4.14Å; I15-L33 HydrophobicContact CG1-CG 4.42Å; I15-T36 HydrophobicContact CD1-CG2 4.45Å
16	G	96.7	Very high	96.6	Very high	54 Å²	54	61.4 Å²	61.4	56%	0.557	33%	0.327	S	S	*	.	T	Hydrogen-bonded Turn	trans	82.4	-4.9	-175.6	0	0	0	0	0	114.9	L14 L33	L14-G16 PolarHBondContact O-N 2.92Å; G16-L33 PolarHBondContact N-O 3.42Å
17	K	97.5	Very high	96.7	Very high	103 Å²	103	58.6 Å²	58.6	45%	0.448	31%	0.311	S	S	.	.	S	Bend	trans	-102.6	155.5	-176.7	-61.6	-177.3	-177.7	163.6	0	111.9	S13 L14 I15 I19 L33	S13-K17 WeakPolarHBondContact O-CD 3.42Å; S13-K17 VanDerWaalsContact O-CE 3.3Å; S13-K17 WeakPolarHBondContact O-CE 3.41Å; S13-K17 PolarHBondContact O-NZ 2.93Å; L14-K17 WeakPolarHBondContact O-CB 3.24Å; L14-K17 PolarHBondContact O-N 2.91Å; I15-K17 VanDerWaalsContact C-N 3.29Å; I15-K17 PolarHBondContact O-N 2.91Å; K17-I19 PolarHBondContact O-N 2.78Å; K17-L33 PolarHBondContact O-N 3.45Å; K17-L33 VanDerWaalsContact O-N 3.12Å
18	P	97.6	Very high	96.8	Very high	14 Å²	14	56.9 Å²	56.9	9%	0.091	30%	0.296	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-65.9	131.9	168	28.9	-34.1	0	0	0	109.7	G31 Y32 L75 E77	P18-G31 WeakPolarHBondContact CA-O 3.28Å; P18-Y32 HydrophobicContact CB-CD1 4.48Å; P18-Y32 HydrophobicContact CB-CE1 4.22Å; P18-Y32 HydrophobicContact CG-CE1 4.44Å; P18-L75 HydrophobicContact CB-CB 4.02Å; P18-L75 HydrophobicContact CB-CD1 4.16Å; P18-L75 HydrophobicContact CG-CB 4.09Å; P18-L75 PolarHBondContact O-N 2.97Å; P18-E77 WeakPolarHBondContact CD-OE1 3.13Å; P18-E77 HydrophobicContact CG-CG 3.71Å
19	I	98.1	Very high	97	Very high	0 Å²	0	52.6 Å²	52.6	0%	0	28%	0.277	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131	162.3	-180	66.1	155.6	0	0	0	111.2	L14 K17 V21 K30 G31 L33 L44 I72 R73	L14-I19 HydrophobicContact CB-CG2 3.92Å; L14-I19 HydrophobicContact CD1-CG2 4.23Å; L14-I19 HydrophobicContact CG-CG2 4.46Å; K17-I19 PolarHBondContact O-N 2.78Å; I19-V21 HydrophobicContact CD1-CG2 3.4Å; I19-V21 HydrophobicContact CG1-CG2 4.32Å; I19-K30 WeakPolarHBondContact O-CA 3.41Å; I19-G31 WeakPolarHBondContact CG1-O 3.46Å; I19-G31 PolarHBondContact N-O 2.86Å; I19-G31 PolarHBondContact O-N 2.83Å; I19-G31 VanDerWaalsContact O-N 3.13Å; I19-L33 HydrophobicContact CD1-CB 3.98Å; I19-L33 HydrophobicContact CD1-CD1 4.24Å; I19-L33 HydrophobicContact CD1-CG 4.48Å; I19-L33 HydrophobicContact CG1-CB 4.17Å; I19-L33 HydrophobicContact CG2-CB 4.15Å; I19-L44 HydrophobicContact CD1-CD2 3.55Å; I19-L44 HydrophobicContact CG1-CD2 4.02Å; I19-I72 HydrophobicContact CB-CG1 4.43Å; I19-I72 HydrophobicContact CD1-CD1 3.45Å; I19-I72 VanDerWaalsContact CD1-CD1 3.45Å; I19-I72 HydrophobicContact CD1-CG1 3.89Å; I19-I72 HydrophobicContact CG2-CD1 4.48Å; I19-R73 CarbonylContact C-O 3.57Å; I19-R73 VanDerWaalsContact CA-O 3.28Å; I19-R73 WeakPolarHBondContact CA-O 3.34Å; I19-R73 WeakPolarHBondContact CB-O 3.44Å
20	I	98	Very high	97.1	Very high	14 Å²	14	52.5 Å²	52.5	7%	0.072	27%	0.269	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.6	129.7	162.7	-72.5	166.9	0	0	0	109.2	E28 Y29 K30 I72 R73 L75	I20-E28 HydrophobicContact CG2-CB 4.37Å; I20-Y29 CarbonylContact C-O 3.58Å; I20-Y29 WeakPolarHBondContact CA-O 3.44Å; I20-K30 HydrophobicContact CD1-CD 4.47Å; I20-K30 HydrophobicContact CG1-CB 3.96Å; I20-K30 HydrophobicContact CG1-CD 4.5Å; I20-K30 HydrophobicContact CG1-CG 4.05Å; I20-I72 WeakPolarHBondContact O-CA 3.3Å; I20-R73 HydrophobicContact CB-CG 4.02Å; I20-R73 VanDerWaalsContact CD1-CZ 3.47Å; I20-R73 PolarHBondContact N-O 3.45Å; I20-R73 PolarHBondContact O-N 3.42Å; I20-L75 HydrophobicContact CD1-CD1 3.78Å; I20-L75 HydrophobicContact CD1-CD2 3.69Å; I20-L75 HydrophobicContact CD1-CG 3.82Å; I20-L75 HydrophobicContact CG1-CD1 3.7Å; I20-L75 HydrophobicContact CG1-CD2 4.44Å; I20-L75 HydrophobicContact CG1-CG 4.02Å
21	V	98.2	Very high	97.2	Very high	0 Å²	0	48.9 Å²	48.9	0%	0	25%	0.254	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.2	119.5	174.7	-174.4	0	0	0	0	108.2	I19 L23 E28 Y29 L42 L44 I64 V69 Y71 I72	I19-V21 HydrophobicContact CD1-CG2 3.4Å; I19-V21 HydrophobicContact CG1-CG2 4.32Å; V21-L23 HydrophobicContact CG1-CD2 4.25Å; V21-E28 CarbonylContact O-C 3.56Å; V21-E28 WeakPolarHBondContact O-CA 3.47Å; V21-Y29 PolarHBondContact N-O 2.88Å; V21-Y29 PolarHBondContact O-N 2.72Å; V21-L42 HydrophobicContact CB-CD1 4.46Å; V21-L42 HydrophobicContact CG1-CD1 3.93Å; V21-L42 HydrophobicContact CG2-CD1 3.63Å; V21-L44 HydrophobicContact CG2-CD1 4.22Å; V21-I64 HydrophobicContact CB-CD1 4.05Å; V21-I64 HydrophobicContact CG1-CD1 4.02Å; V21-I64 HydrophobicContact CG2-CD1 4.25Å; V21-V69 HydrophobicContact CG1-CG1 4Å; V21-V69 HydrophobicContact CG1-CG2 3.97Å; V21-Y71 WeakPolarHBondContact CA-O 3.21Å; V21-I72 HydrophobicContact CG2-CG1 4.34Å
22	K	98.1	Very high	97.3	Very high	52 Å²	52	53.2 Å²	53.2	23%	0.226	27%	0.271	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.3	130.9	170.7	-172	159.8	-163	140.6	0	109.9	E28 L70 Y71	K22-E28 HydrophobicContact CB-CG 4.03Å; K22-E28 HydrophobicContact CD-CG 4.04Å; K22-E28 WeakPolarHBondContact CD-OE1 3.44Å; K22-E28 WeakPolarHBondContact CE-OE1 3.38Å; K22-E28 HydrophobicContact CG-CG 3.87Å; K22-E28 IonicContact NZ-OE1 2.72Å; K22-E28 PolarHBondContact NZ-OE1 2.88Å; K22-L70 HydrophobicContact CD-CD2 4.33Å; K22-L70 HydrophobicContact CG-CD2 4.31Å; K22-L70 WeakPolarHBondContact O-CB 3.36Å; K22-L70 PolarHBondContact O-N 3.3Å; K22-Y71 HydrophobicContact CB-CD1 3.98Å; K22-Y71 HydrophobicContact CB-CD2 4.18Å; K22-Y71 HydrophobicContact CB-CE1 3.59Å; K22-Y71 HydrophobicContact CB-CE2 3.76Å; K22-Y71 HydrophobicContact CB-CG 4.25Å; K22-Y71 VanDerWaalsContact CB-CZ 3.45Å; K22-Y71 HydrophobicContact CD-CD1 4.46Å; K22-Y71 HydrophobicContact CD-CE1 3.52Å; K22-Y71 WeakPolarHBondContact CD-OH 2.87Å; K22-Y71 HydrophobicContact CG-CE1 4.07Å; K22-Y71 PolarHBondContact N-O 3.08Å; K22-Y71 PolarHBondContact O-N 3.09Å
23	L	98.2	Very high	97.4	Very high	15 Å²	15	48.8 Å²	48.8	8%	0.079	25%	0.247	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-85.7	156.2	171.9	-56.8	-165	0	0	0	111.2	V21 W25 G26 M27 Y29 I64 N68	V21-L23 HydrophobicContact CG1-CD2 4.25Å; L23-W25 PolarHBondContact O-N 2.84Å; L23-G26 PolarHBondContact O-N 3.26Å; L23-M27 PolarHBondContact N-O 3.45Å; L23-Y29 HydrophobicContact CD1-CD2 4.09Å; L23-Y29 HydrophobicContact CD1-CE2 3.31Å; L23-Y29 HydrophobicContact CD2-CD2 4.23Å; L23-Y29 HydrophobicContact CD2-CE2 4.27Å; L23-Y29 HydrophobicContact CG-CD2 3.85Å; L23-Y29 HydrophobicContact CG-CE2 3.52Å; L23-I64 HydrophobicContact CD2-CG2 3.81Å; L23-N68 CarbonylContact C-O 3.59Å; L23-N68 VanDerWaalsContact CA-O 3.25Å; L23-N68 WeakPolarHBondContact CA-O 3.4Å; L23-N68 HydrophobicContact CD1-CB 4.42Å; L23-N68 HydrophobicContact CD2-CB 4.13Å
24	K	97.6	Very high	97.5	Very high	114 Å²	114	49.8 Å²	49.8	50%	0.496	25%	0.248	S	C	.	.	T	Hydrogen-bonded Turn	trans	-53.9	-24.3	175.7	-71.1	173.8	-180	177.8	0	113.8	N67 N68 V69 L70	K24-N67 WeakPolarHBondContact CD-O 3.44Å; K24-N67 WeakPolarHBondContact CE-O 3.36Å; K24-N67 PolarHBondContact NZ-O 2.75Å; K24-N68 WeakPolarHBondContact CG-O 3.43Å; K24-N68 PolarHBondContact N-O 3.39Å; K24-V69 WeakPolarHBondContact CE-O 3.21Å; K24-L70 HydrophobicContact CG-CB 4.38Å
25	W	94.8	Very high	97.6	Very high	183 Å²	183	51.6 Å²	51.6	69%	0.693	26%	0.261	S	S	*	.	T	Hydrogen-bonded Turn	trans	-97	6.6	-175.4	-42	120.1	0	0	0	113.3	L23 M27 N68	L23-W25 PolarHBondContact O-N 2.84Å; W25-M27 HydrophobicContact CB-CE 3.36Å; W25-M27 HydrophobicContact CG-CE 4.18Å; W25-N68 PolarHBondContact NE1-OD1 3.09Å
26	G	95.1	Very high	97.6	Very high	37 Å²	37	49.6 Å²	49.6	38%	0.381	25%	0.253	S	S	.	.	S	Bend	trans	100.1	-23.1	171.5	0	0	0	0	0	115.8	L23	L23-G26 PolarHBondContact O-N 3.26Å
27	M	97.4	Very high	97.6	Very high	48 Å²	48	50.3 Å²	50.3	24%	0.236	24%	0.243	C	C	.	.			trans	-61.4	143.5	173.6	-69.1	145.9	-71.4	0	0	111.3	L23 W25 Y29 I51	L23-M27 PolarHBondContact N-O 3.45Å; W25-M27 HydrophobicContact CB-CE 3.36Å; W25-M27 HydrophobicContact CG-CE 4.18Å; M27-Y29 HydrophobicContact CB-CE2 3.84Å; M27-I51 HydrophobicContact CG-CG1 4.05Å
28	E	98	Very high	97.5	Very high	44 Å²	44	51.6 Å²	51.6	21%	0.206	26%	0.255	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119	138.4	174.6	-69.8	179.9	-166.5	0	0	109.9	I20 V21 K22 Y50	I20-E28 HydrophobicContact CG2-CB 4.37Å; V21-E28 CarbonylContact O-C 3.56Å; V21-E28 WeakPolarHBondContact O-CA 3.47Å; K22-E28 HydrophobicContact CB-CG 4.03Å; K22-E28 HydrophobicContact CD-CG 4.04Å; K22-E28 WeakPolarHBondContact CD-OE1 3.44Å; K22-E28 WeakPolarHBondContact CE-OE1 3.38Å; K22-E28 HydrophobicContact CG-CG 3.87Å; K22-E28 IonicContact NZ-OE1 2.72Å; K22-E28 PolarHBondContact NZ-OE1 2.88Å; E28-Y50 PolarHBondContact N-O 3.03Å; E28-Y50 PolarHBondContact O-N 2.88Å
29	Y	98.2	Very high	97.5	Very high	24 Å²	24	59.3 Å²	59.3	9%	0.094	28%	0.284	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.2	122.6	177.7	-64.7	-93.2	0	0	0	108.3	I20 V21 L23 M27 T47 E48 E49 L59 I64	I20-Y29 CarbonylContact C-O 3.58Å; I20-Y29 WeakPolarHBondContact CA-O 3.44Å; V21-Y29 PolarHBondContact N-O 2.88Å; V21-Y29 PolarHBondContact O-N 2.72Å; L23-Y29 HydrophobicContact CD1-CD2 4.09Å; L23-Y29 HydrophobicContact CD1-CE2 3.31Å; L23-Y29 HydrophobicContact CD2-CD2 4.23Å; L23-Y29 HydrophobicContact CD2-CE2 4.27Å; L23-Y29 HydrophobicContact CG-CD2 3.85Å; L23-Y29 HydrophobicContact CG-CE2 3.52Å; M27-Y29 HydrophobicContact CB-CE2 3.84Å; Y29-T47 HydrophobicContact CD1-CG2 3.78Å; Y29-T47 HydrophobicContact CG-CG2 4.38Å; Y29-E48 WeakPolarHBondContact CA-O 3.37Å; Y29-E49 HydrophobicContact CD1-CB 4.38Å; Y29-E49 HydrophobicContact CE1-CB 4.09Å; Y29-E49 HydrophobicContact CE1-CG 3.9Å; Y29-E49 WeakPolarHBondContact CE1-OE1 3.41Å; Y29-E49 PolarHBondContact OH-OE1 3.49Å; Y29-L59 HydrophobicContact CD1-CD1 3.93Å; Y29-L59 HydrophobicContact CE1-CD1 3.48Å; Y29-L59 VanDerWaalsContact CE1-CD1 3.48Å; Y29-I64 HydrophobicContact CD2-CD1 4.16Å; Y29-I64 HydrophobicContact CG-CD1 3.96Å
30	K	98	Very high	97.4	Very high	70 Å²	70	62.8 Å²	62.8	30%	0.304	30%	0.301	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.9	132.8	176.4	176.8	176.9	162.4	-143.6	0	108.7	I19 I20 T47 E48 Y50 L75	I19-K30 WeakPolarHBondContact O-CA 3.41Å; I20-K30 HydrophobicContact CD1-CD 4.47Å; I20-K30 HydrophobicContact CG1-CB 3.96Å; I20-K30 HydrophobicContact CG1-CD 4.5Å; I20-K30 HydrophobicContact CG1-CG 4.05Å; K30-T47 CarbonylContact O-C 3.49Å; K30-T47 VanDerWaalsContact O-CA 3.27Å; K30-T47 WeakPolarHBondContact O-CA 3.37Å; K30-E48 HydrophobicContact CB-CB 4.34Å; K30-E48 WeakPolarHBondContact CD-OE2 3.26Å; K30-E48 PolarHBondContact N-O 3.3Å; K30-E48 IonicContact NZ-OE2 3.23Å; K30-E48 PolarHBondContact NZ-OE2 3.03Å; K30-E48 PolarHBondContact O-N 3.41Å; K30-Y50 HydrophobicContact CB-CD2 4.28Å; K30-Y50 HydrophobicContact CB-CE2 3.82Å; K30-Y50 HydrophobicContact CD-CE2 4.16Å; K30-L75 HydrophobicContact CD-CD1 3.92Å; K30-L75 HydrophobicContact CG-CD1 3.74Å
31	G	97.8	Very high	97.5	Very high	6 Å²	6	63.8 Å²	63.8	6%	0.062	31%	0.306	C	S	.	.	E	Extended strand (participates in β ladder)	trans	177.9	-177.7	179.4	0	0	0	0	0	111.8	P18 I19 A45	P18-G31 WeakPolarHBondContact CA-O 3.28Å; I19-G31 WeakPolarHBondContact CG1-O 3.46Å; I19-G31 PolarHBondContact N-O 2.86Å; I19-G31 PolarHBondContact O-N 2.83Å; I19-G31 VanDerWaalsContact O-N 3.13Å; G31-A45 WeakPolarHBondContact CA-O 3.47Å
32	Y	98	Very high	97.5	Very high	104 Å²	104	63.9 Å²	63.9	41%	0.408	31%	0.307	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89	127.7	175.6	-70.2	-91.5	0	0	0	110.5	P18 L34 L44 A45 H46	P18-Y32 HydrophobicContact CB-CD1 4.48Å; P18-Y32 HydrophobicContact CB-CE1 4.22Å; P18-Y32 HydrophobicContact CG-CE1 4.44Å; Y32-L34 PolarHBondContact O-N 3.13Å; Y32-L44 CarbonylContact O-C 3.54Å; Y32-L44 VanDerWaalsContact O-CA 3.26Å; Y32-L44 WeakPolarHBondContact O-CA 3.35Å; Y32-A45 PolarHBondContact N-O 3.36Å; Y32-A45 PolarHBondContact O-N 2.82Å; Y32-H46 HydrophobicContact CD2-CB 4.44Å
33	L	98.3	Very high	97.5	Very high	0 Å²	0	64.3 Å²	64.3	0%	0	31%	0.31	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.3	106.9	176.5	-177.8	61	0	0	0	110.5	I11 L14 I15 G16 K17 I19 S35 L42 L44 I72	I11-L33 HydrophobicContact CG2-CD2 4.2Å; L14-L33 HydrophobicContact CB-CD2 3.88Å; I15-L33 HydrophobicContact CG1-CD2 4.14Å; I15-L33 HydrophobicContact CG1-CG 4.42Å; G16-L33 PolarHBondContact N-O 3.42Å; K17-L33 PolarHBondContact O-N 3.45Å; K17-L33 VanDerWaalsContact O-N 3.12Å; I19-L33 HydrophobicContact CD1-CB 3.98Å; I19-L33 HydrophobicContact CD1-CD1 4.24Å; I19-L33 HydrophobicContact CD1-CG 4.48Å; I19-L33 HydrophobicContact CG1-CB 4.17Å; I19-L33 HydrophobicContact CG2-CB 4.15Å; L33-S35 WeakPolarHBondContact CD1-O 3.21Å; L33-L42 HydrophobicContact CD1-CB 4.12Å; L33-L42 HydrophobicContact CD1-CD2 4.01Å; L33-L44 HydrophobicContact CB-CD2 4.33Å; L33-L44 HydrophobicContact CD1-CD2 3.8Å; L33-I72 HydrophobicContact CD2-CD1 4.27Å
34	L	98.1	Very high	97.5	Very high	79 Å²	79	63.6 Å²	63.6	41%	0.414	31%	0.306	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.2	-46.9	178.3	-65.6	-173	0	0	0	112.2	Y32 Q43 A45	Y32-L34 PolarHBondContact O-N 3.13Å; L34-Q43 HydrophobicContact CB-CB 4.34Å; L34-Q43 HydrophobicContact CB-CG 4.13Å; L34-Q43 HydrophobicContact CD1-CG 4.16Å; L34-Q43 PolarHBondContact N-O 2.83Å; L34-A45 HydrophobicContact CD1-CB 3.85Å; L34-A45 HydrophobicContact CD2-CB 3.76Å; L34-A45 HydrophobicContact CG-CB 3.76Å
35	S	97.9	Very high	97.5	Very high	47 Å²	47	58.9 Å²	58.9	33%	0.329	29%	0.289	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-157.7	162.6	-176.5	76.5	0	0	0	0	112.1	L33 Q43	L33-S35 WeakPolarHBondContact CD1-O 3.21Å; S35-Q43 PolarHBondContact O-N 2.82Å; S35-Q43 WeakPolarHBondContact OG-CB 3.49Å; S35-Q43 PolarHBondContact OG-OE1 2.76Å
36	T	97.9	Very high	97.6	Very high	34 Å²	34	57 Å²	57	21%	0.209	29%	0.287	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.6	156.5	170.1	-167.9	0	0	0	0	110.4	I11 I15 N41	I11-T36 HydrophobicContact CG2-CG2 3.82Å; I15-T36 HydrophobicContact CD1-CG2 4.45Å; T36-N41 VanDerWaalsContact CA-O 3.22Å; T36-N41 WeakPolarHBondContact CA-O 3.41Å; T36-N41 WeakPolarHBondContact CB-O 3.4Å; T36-N41 PolarHBondContact OG1-O 2.84Å
37	D	96.7	Very high	97.8	Very high	68 Å²	68	55.3 Å²	55.3	36%	0.364	27%	0.269	S	S	.	.			trans	-109.1	-177.5	175.6	73.1	6.3	0	0	0	112.5	Y39 M40 N41	D37-Y39 PolarHBondContact O-N 2.77Å; D37-Y39 WeakPolarHBondContact OD1-CA 3.5Å; D37-Y39 WeakPolarHBondContact OD1-CB 3.25Å; D37-Y39 PolarHBondContact OD1-N 3.19Å; D37-M40 PolarHBondContact O-N 3.12Å; D37-M40 VanDerWaalsContact O-N 3.07Å; D37-M40 PolarHBondContact OD1-N 2.65Å; D37-N41 PolarHBondContact N-O 3.5Å; D37-N41 PolarHBondContact OD1-N 2.82Å; D37-N41 PolarHBondContact OD1-ND2 2.83Å; D37-N41 PolarHBondContact OD2-ND2 2.92Å
38	N	96	Very high	97.8	Very high	131 Å²	131	55.2 Å²	55.2	70%	0.701	27%	0.268	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.5	-17.3	178.8	-79.1	-48.6	0	0	0	114.4
39	Y	97.2	Very high	97.8	Very high	176 Å²	176	54.9 Å²	54.9	69%	0.69	27%	0.267	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.5	-2	176.6	-62.9	-73.2	0	0	0	112.4	D37 N41 C66	D37-Y39 PolarHBondContact O-N 2.77Å; D37-Y39 WeakPolarHBondContact OD1-CA 3.5Å; D37-Y39 WeakPolarHBondContact OD1-CB 3.25Å; D37-Y39 PolarHBondContact OD1-N 3.19Å; Y39-N41 VanDerWaalsContact C-N 3.32Å; Y39-C66 WeakPolarHBondContact O-CB 3.45Å; Y39-C66 PolarHBondContact O-SG 2.87Å; Y39-C66 VanDerWaalsContact O-SG 3.38Å
40	M	97	Very high	97.8	Very high	73 Å²	73	56.3 Å²	56.3	36%	0.36	27%	0.272	S	S	.	.			trans	64.4	33.8	-173	-50.1	176.1	-176.4	0	0	112.8	P7 I11 D37 C66	P7-M40 HydrophobicContact CB-CE 4.16Å; I11-M40 HydrophobicContact CD1-CB 4.39Å; I11-M40 HydrophobicContact CD1-CE 4.27Å; I11-M40 HydrophobicContact CD1-CG 3.93Å; I11-M40 HydrophobicContact CD1-SD 3.7Å; D37-M40 PolarHBondContact O-N 3.12Å; D37-M40 VanDerWaalsContact O-N 3.07Å; D37-M40 PolarHBondContact OD1-N 2.65Å; M40-C66 HydrophobicContact CB-CB 4.41Å; M40-C66 WeakPolarHBondContact O-CB 3.41Å
41	N	98.2	Very high	97.8	Very high	34 Å²	34	56.3 Å²	56.3	18%	0.182	28%	0.275	C	S	.	.			trans	-67.5	143.8	159.1	-62	-52.9	0	0	0	108.2	T36 D37 Y39 L63 I64 R65 C66	T36-N41 VanDerWaalsContact CA-O 3.22Å; T36-N41 WeakPolarHBondContact CA-O 3.41Å; T36-N41 WeakPolarHBondContact CB-O 3.4Å; T36-N41 PolarHBondContact OG1-O 2.84Å; D37-N41 PolarHBondContact N-O 3.5Å; D37-N41 PolarHBondContact OD1-N 2.82Å; D37-N41 PolarHBondContact OD1-ND2 2.83Å; D37-N41 PolarHBondContact OD2-ND2 2.92Å; Y39-N41 VanDerWaalsContact C-N 3.32Å; N41-L63 HydrophobicContact CB-CD1 4.42Å; N41-I64 WeakPolarHBondContact CA-O 3.45Å; N41-R65 WeakPolarHBondContact OD1-CA 3.41Å; N41-C66 PolarHBondContact OD1-N 2.9Å
42	L	98.4	Very high	97.6	Very high	3 Å²	3	63.4 Å²	63.4	2%	0.016	31%	0.312	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.5	127.2	-173.2	-51.8	173.4	0	0	0	109.8	I11 V21 L33 L44 L63 I64 V69 I72	I11-L42 HydrophobicContact CG2-CD2 4.38Å; V21-L42 HydrophobicContact CB-CD1 4.46Å; V21-L42 HydrophobicContact CG1-CD1 3.93Å; V21-L42 HydrophobicContact CG2-CD1 3.63Å; L33-L42 HydrophobicContact CD1-CB 4.12Å; L33-L42 HydrophobicContact CD1-CD2 4.01Å; L42-L44 HydrophobicContact CB-CD2 4.4Å; L42-L63 CarbonylContact O-C 3.52Å; L42-L63 WeakPolarHBondContact O-CA 3.44Å; L42-I64 HydrophobicContact CB-CB 4.29Å; L42-I64 PolarHBondContact N-O 3.48Å; L42-I64 PolarHBondContact O-N 2.72Å; L42-V69 HydrophobicContact CD1-CG2 4.15Å; L42-I72 HydrophobicContact CD1-CD1 4.28Å; L42-I72 HydrophobicContact CD2-CD1 4.43Å
43	Q	98.5	Very high	97.4	Very high	60 Å²	60	61.5 Å²	61.5	28%	0.28	32%	0.324	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.6	120.5	169.5	-173.8	-174.3	13	0	0	108.7	L34 S35 E61	L34-Q43 HydrophobicContact CB-CB 4.34Å; L34-Q43 HydrophobicContact CB-CG 4.13Å; L34-Q43 HydrophobicContact CD1-CG 4.16Å; L34-Q43 PolarHBondContact N-O 2.83Å; S35-Q43 PolarHBondContact O-N 2.82Å; S35-Q43 WeakPolarHBondContact OG-CB 3.49Å; S35-Q43 PolarHBondContact OG-OE1 2.76Å; Q43-E61 PolarHBondContact NE2-OE1 3.32Å
44	L	98.4	Very high	97.3	Very high	0 Å²	0	68.5 Å²	68.5	0%	0	36%	0.356	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113	142.1	-179.7	-54.7	-171.7	0	0	0	111.5	I19 V21 Y32 L33 L42 T47 E61 T62 I64	I19-L44 HydrophobicContact CD1-CD2 3.55Å; I19-L44 HydrophobicContact CG1-CD2 4.02Å; V21-L44 HydrophobicContact CG2-CD1 4.22Å; Y32-L44 CarbonylContact O-C 3.54Å; Y32-L44 VanDerWaalsContact O-CA 3.26Å; Y32-L44 WeakPolarHBondContact O-CA 3.35Å; L33-L44 HydrophobicContact CB-CD2 4.33Å; L33-L44 HydrophobicContact CD1-CD2 3.8Å; L42-L44 HydrophobicContact CB-CD2 4.4Å; L44-T47 HydrophobicContact CB-CG2 4.45Å; L44-T47 WeakPolarHBondContact CB-OG1 3.5Å; L44-T47 HydrophobicContact CD1-CG2 4.15Å; L44-E61 WeakPolarHBondContact O-CA 3.25Å; L44-T62 PolarHBondContact N-O 3.29Å; L44-T62 PolarHBondContact O-N 2.96Å; L44-I64 HydrophobicContact CD1-CD1 3.65Å; L44-I64 HydrophobicContact CG-CD1 4.36Å
45	A	98.1	Very high	97.3	Very high	16 Å²	16	69.2 Å²	69.2	13%	0.132	36%	0.36	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.4	153.8	166.7	0	0	0	0	0	111.3	G31 Y32 L34 T47	G31-A45 WeakPolarHBondContact CA-O 3.47Å; Y32-A45 PolarHBondContact N-O 3.36Å; Y32-A45 PolarHBondContact O-N 2.82Å; L34-A45 HydrophobicContact CD1-CB 3.85Å; L34-A45 HydrophobicContact CD2-CB 3.76Å; L34-A45 HydrophobicContact CG-CB 3.76Å; A45-T47 PolarHBondContact O-N 2.93Å
46	H	97.1	Very high	97.3	Very high	144 Å²	144	69.6 Å²	69.6	67%	0.667	37%	0.366	S	S	*	.	E	Extended strand (participates in β ladder)	trans	49.9	44.3	179.5	-54.8	-67.4	0	0	0	112.6	Y32 E48 G60	Y32-H46 HydrophobicContact CD2-CB 4.44Å; H46-E48 PolarHBondContact O-N 2.62Å; H46-G60 PolarHBondContact N-O 3.01Å
47	T	98.2	Very high	97.2	Very high	0 Å²	0	69.1 Å²	69.1	0%	0	37%	0.368	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.2	124.1	-171.8	-47.6	0	0	0	0	110.9	Y29 K30 L44 A45 L59 G60 T62	Y29-T47 HydrophobicContact CD1-CG2 3.78Å; Y29-T47 HydrophobicContact CG-CG2 4.38Å; K30-T47 CarbonylContact O-C 3.49Å; K30-T47 VanDerWaalsContact O-CA 3.27Å; K30-T47 WeakPolarHBondContact O-CA 3.37Å; L44-T47 HydrophobicContact CB-CG2 4.45Å; L44-T47 WeakPolarHBondContact CB-OG1 3.5Å; L44-T47 HydrophobicContact CD1-CG2 4.15Å; A45-T47 PolarHBondContact O-N 2.93Å; T47-L59 PolarHBondContact O-N 3.01Å; T47-G60 VanDerWaalsContact CB-O 3.24Å; T47-G60 WeakPolarHBondContact CB-O 3.45Å; T47-G60 PolarHBondContact N-O 2.82Å; T47-G60 PolarHBondContact O-N 2.69Å; T47-G60 PolarHBondContact OG1-O 3.39Å; T47-T62 HydrophobicContact CG2-CG2 4.48Å; T47-T62 PolarHBondContact OG1-OG1 3.02Å
48	E	98.2	Very high	97.2	Very high	47 Å²	47	71.7 Å²	71.7	22%	0.22	38%	0.381	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.7	130.1	169.8	-65.9	173.1	167.9	0	0	108.7	Y29 K30 H46 Y50 L55	Y29-E48 WeakPolarHBondContact CA-O 3.37Å; K30-E48 HydrophobicContact CB-CB 4.34Å; K30-E48 WeakPolarHBondContact CD-OE2 3.26Å; K30-E48 PolarHBondContact N-O 3.3Å; K30-E48 IonicContact NZ-OE2 3.23Å; K30-E48 PolarHBondContact NZ-OE2 3.03Å; K30-E48 PolarHBondContact O-N 3.41Å; H46-E48 PolarHBondContact O-N 2.62Å; E48-Y50 HydrophobicContact CB-CD2 4.21Å; E48-Y50 HydrophobicContact CB-CE2 3.52Å; E48-Y50 HydrophobicContact CG-CE2 4.49Å; E48-Y50 WeakPolarHBondContact OE2-CE2 3.4Å; E48-Y50 PolarHBondContact OE2-OH 3.26Å; E48-L55 HydrophobicContact CB-CD1 3.85Å; E48-L55 HydrophobicContact CG-CD1 4.18Å
49	E	98.3	Very high	97.3	Very high	37 Å²	37	69.2 Å²	69.2	17%	0.173	37%	0.368	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.5	131.6	172.8	-176.2	176.8	-108.2	0	0	110.3	Y29 I51 A56 G57 L59	Y29-E49 HydrophobicContact CD1-CB 4.38Å; Y29-E49 HydrophobicContact CE1-CB 4.09Å; Y29-E49 HydrophobicContact CE1-CG 3.9Å; Y29-E49 WeakPolarHBondContact CE1-OE1 3.41Å; Y29-E49 PolarHBondContact OH-OE1 3.49Å; E49-I51 HydrophobicContact CG-CG1 4.29Å; E49-A56 HydrophobicContact CB-CB 4.47Å; E49-A56 HydrophobicContact CG-CB 4.27Å; E49-A56 PolarHBondContact O-N 2.85Å; E49-G57 PolarHBondContact N-O 3Å; E49-G57 PolarHBondContact O-N 3.03Å; E49-L59 HydrophobicContact CB-CD1 3.98Å; E49-L59 HydrophobicContact CB-CG 4.27Å
50	Y	98.3	Very high	97.3	Very high	53 Å²	53	62.3 Å²	62.3	21%	0.208	35%	0.35	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.5	125.3	176	-69.8	-102.5	0	0	0	110.2	E28 K30 E48 Q54 L55	E28-Y50 PolarHBondContact N-O 3.03Å; E28-Y50 PolarHBondContact O-N 2.88Å; K30-Y50 HydrophobicContact CB-CD2 4.28Å; K30-Y50 HydrophobicContact CB-CE2 3.82Å; K30-Y50 HydrophobicContact CD-CE2 4.16Å; E48-Y50 HydrophobicContact CB-CD2 4.21Å; E48-Y50 HydrophobicContact CB-CE2 3.52Å; E48-Y50 HydrophobicContact CG-CE2 4.49Å; E48-Y50 WeakPolarHBondContact OE2-CE2 3.4Å; E48-Y50 PolarHBondContact OE2-OH 3.26Å; Y50-Q54 CarbonylContact C-O 3.56Å; Y50-Q54 VanDerWaalsContact CA-O 3.25Å; Y50-Q54 WeakPolarHBondContact CA-O 3.44Å; Y50-L55 HydrophobicContact CE1-CB 4.26Å; Y50-L55 HydrophobicContact CE2-CD1 4.22Å
51	I	97.1	Very high	97.3	Very high	70 Å²	70	65.3 Å²	65.3	36%	0.359	36%	0.363	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119	123.6	175.6	-58.7	177.6	0	0	0	107.3	M27 E49 G53 Q54 A56	M27-I51 HydrophobicContact CG-CG1 4.05Å; E49-I51 HydrophobicContact CG-CG1 4.29Å; I51-G53 PolarHBondContact O-N 3.31Å; I51-Q54 PolarHBondContact N-O 2.97Å; I51-Q54 PolarHBondContact O-N 3.39Å; I51-A56 HydrophobicContact CB-CB 4.25Å; I51-A56 HydrophobicContact CD1-CB 3.71Å; I51-A56 HydrophobicContact CG1-CB 3.75Å
52	N	94.6	Very high	97.3	Very high	156 Å²	156	65 Å²	65	83%	0.834	36%	0.363	S	S	*	.	T	Hydrogen-bonded Turn	trans	53.3	35.1	-175.8	-57.2	-37.9	0	0	0	113.5	Q54	N52-Q54 PolarHBondContact O-N 3.07Å
53	G	93.1	Very high	97.3	Very high	64 Å²	64	71 Å²	71	66%	0.66	39%	0.394	S	S	*	.	T	Hydrogen-bonded Turn	trans	76.6	2.2	-179.4	0	0	0	0	0	115	I51	I51-G53 PolarHBondContact O-N 3.31Å
54	Q	97	Very high	97.2	Very high	146 Å²	146	68.7 Å²	68.7	68%	0.682	38%	0.383	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-104.5	141	176.6	-63.9	-176.3	-21.4	0	0	110.5	Y50 I51 N52 A56	Y50-Q54 CarbonylContact C-O 3.56Å; Y50-Q54 VanDerWaalsContact CA-O 3.25Å; Y50-Q54 WeakPolarHBondContact CA-O 3.44Å; I51-Q54 PolarHBondContact N-O 2.97Å; I51-Q54 PolarHBondContact O-N 3.39Å; N52-Q54 PolarHBondContact O-N 3.07Å; Q54-A56 PolarHBondContact O-N 2.8Å; Q54-A56 VanDerWaalsContact O-N 3.13Å
55	L	97.3	Very high	97.2	Very high	95 Å²	95	76.8 Å²	76.8	50%	0.497	41%	0.414	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-61.9	114	173.6	-179.8	67.1	0	0	0	109.2	E48 Y50	E48-L55 HydrophobicContact CB-CD1 3.85Å; E48-L55 HydrophobicContact CG-CD1 4.18Å; Y50-L55 HydrophobicContact CE1-CB 4.26Å; Y50-L55 HydrophobicContact CE2-CD1 4.22Å
56	A	97.1	Very high	97.2	Very high	55 Å²	55	77.9 Å²	77.9	46%	0.455	42%	0.42	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.3	-31.6	177.3	0	0	0	0	0	111.7	E49 I51 Q54	E49-A56 HydrophobicContact CB-CB 4.47Å; E49-A56 HydrophobicContact CG-CB 4.27Å; E49-A56 PolarHBondContact O-N 2.85Å; I51-A56 HydrophobicContact CB-CB 4.25Å; I51-A56 HydrophobicContact CD1-CB 3.71Å; I51-A56 HydrophobicContact CG1-CB 3.75Å; Q54-A56 PolarHBondContact O-N 2.8Å; Q54-A56 VanDerWaalsContact O-N 3.13Å
57	G	96.9	Very high	97.3	Very high	24 Å²	24	74.6 Å²	74.6	25%	0.247	41%	0.408	C	S	.	.	E	Extended strand (participates in β ladder)	trans	172.2	173.1	176.5	0	0	0	0	0	114.7	E49	E49-G57 PolarHBondContact N-O 3Å; E49-G57 PolarHBondContact O-N 3.03Å
58	N	97.2	Very high	97.3	Very high	121 Å²	121	76.7 Å²	76.7	65%	0.647	42%	0.419	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-102.9	120.3	174.1	-65.2	-65.5	0	0	0	109.2
59	L	97.1	Very high	97.3	Very high	80 Å²	80	76 Å²	76	42%	0.419	42%	0.418	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.1	-15.8	-177.9	-57.8	-178.7	0	0	0	113.2	Y29 T47 E49 E61 T62	Y29-L59 HydrophobicContact CD1-CD1 3.93Å; Y29-L59 HydrophobicContact CE1-CD1 3.48Å; Y29-L59 VanDerWaalsContact CE1-CD1 3.48Å; T47-L59 PolarHBondContact O-N 3.01Å; E49-L59 HydrophobicContact CB-CD1 3.98Å; E49-L59 HydrophobicContact CB-CG 4.27Å; L59-E61 PolarHBondContact O-N 3.34Å; L59-T62 WeakPolarHBondContact CB-OG1 3.44Å
60	G	96.7	Very high	97.3	Very high	31 Å²	31	79.2 Å²	79.2	32%	0.32	44%	0.436	S	S	.	.	E	Extended strand (participates in β ladder)	trans	72.1	-124	-179.5	0	0	0	0	0	111.8	H46 T47	H46-G60 PolarHBondContact N-O 3.01Å; T47-G60 VanDerWaalsContact CB-O 3.24Å; T47-G60 WeakPolarHBondContact CB-O 3.45Å; T47-G60 PolarHBondContact N-O 2.82Å; T47-G60 PolarHBondContact O-N 2.69Å; T47-G60 PolarHBondContact OG1-O 3.39Å
61	E	97.4	Very high	97.2	Very high	136 Å²	136	81 Å²	81	64%	0.636	44%	0.443	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-80.7	125.6	176.7	-169.2	173.6	174.8	0	0	110.4	Q43 L44 L59	Q43-E61 PolarHBondContact NE2-OE1 3.32Å; L44-E61 WeakPolarHBondContact O-CA 3.25Å; L59-E61 PolarHBondContact O-N 3.34Å
62	T	97.8	Very high	97.3	Very high	27 Å²	27	78.9 Å²	78.9	17%	0.166	43%	0.432	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.7	135.1	-172.1	-61.3	0	0	0	0	111.4	L44 T47 L59 I64	L44-T62 PolarHBondContact N-O 3.29Å; L44-T62 PolarHBondContact O-N 2.96Å; T47-T62 HydrophobicContact CG2-CG2 4.48Å; T47-T62 PolarHBondContact OG1-OG1 3.02Å; L59-T62 WeakPolarHBondContact CB-OG1 3.44Å; T62-I64 HydrophobicContact CG2-CG1 4.25Å
63	L	98.1	Very high	97.4	Very high	130 Å²	130	76.4 Å²	76.4	68%	0.681	41%	0.411	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-101.3	119.3	170.4	178	68.9	0	0	0	109.9	N41 L42	N41-L63 HydrophobicContact CB-CD1 4.42Å; L42-L63 CarbonylContact O-C 3.52Å; L42-L63 WeakPolarHBondContact O-CA 3.44Å
64	I	98.1	Very high	97.6	Very high	10 Å²	10	74.8 Å²	74.8	5%	0.051	39%	0.394	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.6	119.9	173.7	-57	178.3	0	0	0	109.3	V21 L23 Y29 N41 L42 L44 T62 V69	V21-I64 HydrophobicContact CB-CD1 4.05Å; V21-I64 HydrophobicContact CG1-CD1 4.02Å; V21-I64 HydrophobicContact CG2-CD1 4.25Å; L23-I64 HydrophobicContact CD2-CG2 3.81Å; Y29-I64 HydrophobicContact CD2-CD1 4.16Å; Y29-I64 HydrophobicContact CG-CD1 3.96Å; N41-I64 WeakPolarHBondContact CA-O 3.45Å; L42-I64 HydrophobicContact CB-CB 4.29Å; L42-I64 PolarHBondContact N-O 3.48Å; L42-I64 PolarHBondContact O-N 2.72Å; L44-I64 HydrophobicContact CD1-CD1 3.65Å; L44-I64 HydrophobicContact CG-CD1 4.36Å; T62-I64 HydrophobicContact CG2-CG1 4.25Å; I64-V69 HydrophobicContact CG2-CG2 3.84Å
65	R	98.3	Very high	97.4	Very high	170 Å²	170	70 Å²	70	64%	0.642	37%	0.373	S	S	*	.	P	Polyproline II helix	trans	-72.6	131.8	174.1	-166.8	-177.8	174.7	-178.2	0.6	110.9	N41 N67 N68	N41-R65 WeakPolarHBondContact OD1-CA 3.41Å; R65-N67 VanDerWaalsContact C-N 3.27Å; R65-N67 WeakPolarHBondContact CD-OD1 3.22Å; R65-N67 WeakPolarHBondContact CG-OD1 3.34Å; R65-N67 PolarHBondContact NE-OD1 2.76Å; R65-N67 PolarHBondContact O-N 3.42Å; R65-N67 VanDerWaalsContact O-N 3.09Å; R65-N68 PolarHBondContact O-N 2.95Å; R65-N68 VanDerWaalsContact O-N 3.08Å
66	C	97.5	Very high	96.6	Very high	39 Å²	39	74.5 Å²	74.5	26%	0.264	39%	0.392	S	S	.	.	G	3₁₀ helix	trans	-50.8	-39.8	-171.1	60.4	0	0	0	0	114.9	Y39 M40 N41 N68 V69	Y39-C66 WeakPolarHBondContact O-CB 3.45Å; Y39-C66 PolarHBondContact O-SG 2.87Å; Y39-C66 VanDerWaalsContact O-SG 3.38Å; M40-C66 HydrophobicContact CB-CB 4.41Å; M40-C66 WeakPolarHBondContact O-CB 3.41Å; N41-C66 PolarHBondContact OD1-N 2.9Å; C66-N68 PolarHBondContact O-N 3.08Å; C66-N68 VanDerWaalsContact O-N 3.09Å; C66-V69 PolarHBondContact O-N 2.88Å; C66-V69 VanDerWaalsContact O-N 3.08Å
67	N	98.2	Very high	95	Very high	76 Å²	76	78.1 Å²	78.1	41%	0.406	40%	0.399	S	S	.	.	G	3₁₀ helix	trans	-68.8	-11.3	-174.3	73.1	-65.1	0	0	0	113.7	K24 R65	K24-N67 WeakPolarHBondContact CD-O 3.44Å; K24-N67 WeakPolarHBondContact CE-O 3.36Å; K24-N67 PolarHBondContact NZ-O 2.75Å; R65-N67 VanDerWaalsContact C-N 3.27Å; R65-N67 WeakPolarHBondContact CD-OD1 3.22Å; R65-N67 WeakPolarHBondContact CG-OD1 3.34Å; R65-N67 PolarHBondContact NE-OD1 2.76Å; R65-N67 PolarHBondContact O-N 3.42Å; R65-N67 VanDerWaalsContact O-N 3.09Å
68	N	98.2	Very high	92.8	Very high	44 Å²	44	81.1 Å²	81.1	24%	0.235	42%	0.422	C	S	.	.	G	3₁₀ helix	trans	-91	-16.3	175.4	-64.8	-63.8	0	0	0	113.2	L23 K24 W25 R65 C66	L23-N68 CarbonylContact C-O 3.59Å; L23-N68 VanDerWaalsContact CA-O 3.25Å; L23-N68 WeakPolarHBondContact CA-O 3.4Å; L23-N68 HydrophobicContact CD1-CB 4.42Å; L23-N68 HydrophobicContact CD2-CB 4.13Å; K24-N68 WeakPolarHBondContact CG-O 3.43Å; K24-N68 PolarHBondContact N-O 3.39Å; W25-N68 PolarHBondContact NE1-OD1 3.09Å; R65-N68 PolarHBondContact O-N 2.95Å; R65-N68 VanDerWaalsContact O-N 3.08Å; C66-N68 PolarHBondContact O-N 3.08Å; C66-N68 VanDerWaalsContact O-N 3.09Å
69	V	98.2	Very high	90.2	Very high	32 Å²	32	84.2 Å²	84.2	19%	0.194	43%	0.432	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.1	132	-175.1	-179.7	0	0	0	0	110.2	V21 K24 L42 I64 C66	V21-V69 HydrophobicContact CG1-CG1 4Å; V21-V69 HydrophobicContact CG1-CG2 3.97Å; K24-V69 WeakPolarHBondContact CE-O 3.21Å; L42-V69 HydrophobicContact CD1-CG2 4.15Å; I64-V69 HydrophobicContact CG2-CG2 3.84Å; C66-V69 PolarHBondContact O-N 2.88Å; C66-V69 VanDerWaalsContact O-N 3.08Å
70	L	98.3	Very high	87.8	Confident	105 Å²	105	89.6 Å²	89.6	55%	0.55	46%	0.455	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94	-52.1	168	-179.7	64.4	0	0	0	110.2	K22 K24	K22-L70 HydrophobicContact CD-CD2 4.33Å; K22-L70 HydrophobicContact CG-CD2 4.31Å; K22-L70 WeakPolarHBondContact O-CB 3.36Å; K22-L70 PolarHBondContact O-N 3.3Å; K24-L70 HydrophobicContact CG-CB 4.38Å
71	Y	98	Very high	85.1	Confident	90 Å²	90	90.9 Å²	90.9	35%	0.353	47%	0.468	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-151.6	164.1	171.5	66.5	-107.3	0	0	0	111.6	V21 K22 R73	V21-Y71 WeakPolarHBondContact CA-O 3.21Å; K22-Y71 HydrophobicContact CB-CD1 3.98Å; K22-Y71 HydrophobicContact CB-CD2 4.18Å; K22-Y71 HydrophobicContact CB-CE1 3.59Å; K22-Y71 HydrophobicContact CB-CE2 3.76Å; K22-Y71 HydrophobicContact CB-CG 4.25Å; K22-Y71 VanDerWaalsContact CB-CZ 3.45Å; K22-Y71 HydrophobicContact CD-CD1 4.46Å; K22-Y71 HydrophobicContact CD-CE1 3.52Å; K22-Y71 WeakPolarHBondContact CD-OH 2.87Å; K22-Y71 HydrophobicContact CG-CE1 4.07Å; K22-Y71 PolarHBondContact N-O 3.08Å; K22-Y71 PolarHBondContact O-N 3.09Å; Y71-R73 HydrophobicContact CE2-CG 4.31Å
72	I	97.9	Very high	82.3	Confident	25 Å²	25	92.3 Å²	92.3	13%	0.128	48%	0.475	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.7	139.3	169.5	178.5	172	0	0	0	108.5	F10 I11 L14 I19 I20 V21 L33 L42	F10-I72 HydrophobicContact CE1-CG2 4.26Å; I11-I72 HydrophobicContact CG1-CG2 4.22Å; L14-I72 HydrophobicContact CD1-CD1 3.77Å; L14-I72 HydrophobicContact CD1-CG1 3.8Å; I19-I72 HydrophobicContact CB-CG1 4.43Å; I19-I72 HydrophobicContact CD1-CD1 3.45Å; I19-I72 VanDerWaalsContact CD1-CD1 3.45Å; I19-I72 HydrophobicContact CD1-CG1 3.89Å; I19-I72 HydrophobicContact CG2-CD1 4.48Å; I20-I72 WeakPolarHBondContact O-CA 3.3Å; V21-I72 HydrophobicContact CG2-CG1 4.34Å; L33-I72 HydrophobicContact CD2-CD1 4.27Å; L42-I72 HydrophobicContact CD1-CD1 4.28Å; L42-I72 HydrophobicContact CD2-CD1 4.43Å
73	R	97.1	Very high	79.6	Confident	104 Å²	104	99.7 Å²	99.7	39%	0.392	51%	0.51	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.7	147.3	172.1	65.6	178.7	-176.7	87.7	-11.1	110.9	I19 I20 Y71	I19-R73 CarbonylContact C-O 3.57Å; I19-R73 VanDerWaalsContact CA-O 3.28Å; I19-R73 WeakPolarHBondContact CA-O 3.34Å; I19-R73 WeakPolarHBondContact CB-O 3.44Å; I20-R73 HydrophobicContact CB-CG 4.02Å; I20-R73 VanDerWaalsContact CD1-CZ 3.47Å; I20-R73 PolarHBondContact N-O 3.45Å; I20-R73 PolarHBondContact O-N 3.42Å; Y71-R73 HydrophobicContact CE2-CG 4.31Å
74	G	96.5	Very high	77	Confident	31 Å²	31	101.1 Å²	101.1	32%	0.32	51%	0.513	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-66.7	145.1	164.6	0	0	0	0	0	110.4
75	L	93.5	Very high	75	Confident	45 Å²	45	109.2 Å²	109.2	24%	0.236	55%	0.55	C	S	.	*	P	Polyproline II helix	trans	-89	127.8	156.6	-81.3	156	0	0	0	106.5	P18 I20 K30 E77	P18-L75 HydrophobicContact CB-CB 4.02Å; P18-L75 HydrophobicContact CB-CD1 4.16Å; P18-L75 HydrophobicContact CG-CB 4.09Å; P18-L75 PolarHBondContact O-N 2.97Å; I20-L75 HydrophobicContact CD1-CD1 3.78Å; I20-L75 HydrophobicContact CD1-CD2 3.69Å; I20-L75 HydrophobicContact CD1-CG 3.82Å; I20-L75 HydrophobicContact CG1-CD1 3.7Å; I20-L75 HydrophobicContact CG1-CD2 4.44Å; I20-L75 HydrophobicContact CG1-CG 4.02Å; K30-L75 HydrophobicContact CD-CD1 3.92Å; K30-L75 HydrophobicContact CG-CD1 3.74Å; L75-E77 PolarHBondContact O-N 2.74Å
76	E	81.1	Confident	73.1	Confident	189 Å²	189	115.9 Å²	115.9	88%	0.883	58%	0.578	S	S	*	*	P	Polyproline II helix	trans	-64.6	121.9	161	-70.8	173.2	179.6	0	0	105.8	A78	E76-A78 PolarHBondContact O-N 3.07Å
77	E	62.5	Low	71.9	Confident	131 Å²	131	119.7 Å²	119.7	61%	0.612	59%	0.593	S	S	*	*			trans	-58	114.9	162.5	-72.6	172.5	-174.9	0	0	104.8	P18 L75 E79	P18-E77 WeakPolarHBondContact CD-OE1 3.13Å; P18-E77 HydrophobicContact CG-CG 3.71Å; L75-E77 PolarHBondContact O-N 2.74Å; E77-E79 PolarHBondContact O-N 3.19Å
78	A	50.6	Low	70.5	Confident	88 Å²	88	122 Å²	122	73%	0.727	60%	0.603	S	S	*	*			trans	-56.5	118.5	164	0	0	0	0	0	104.2	E76 E80	E76-A78 PolarHBondContact O-N 3.07Å; A78-E80 PolarHBondContact O-N 2.99Å
79	E	43.4	Very low	69	Low	186 Å²	186	126.3 Å²	126.3	87%	0.869	62%	0.624	S	S	*	*			trans	-42.6	115.2	170.5	-68.9	177.1	158.4	0	0	105.6	E77 G81	E77-E79 PolarHBondContact O-N 3.19Å; E79-G81 PolarHBondContact O-N 3.38Å
80	E	46	Very low	67.3	Low	193 Å²	193	131.9 Å²	131.9	90%	0.902	65%	0.649	S	S	*	*			trans	-56.9	97.1	170.2	-80.5	-176.4	160.5	0	0	104.2	A78 E82	A78-E80 PolarHBondContact O-N 2.99Å; E80-E82 PolarHBondContact O-N 2.87Å
81	G	40.5	Very low	65.3	Low	57 Å²	57	133.6 Å²	133.6	59%	0.588	66%	0.655	S	S	*	*			trans	-52.1	121	-177.5	0	0	0	0	0	105.8	E79 M83	E79-G81 PolarHBondContact O-N 3.38Å; G81-M83 VanDerWaalsContact C-N 3.26Å; G81-M83 PolarHBondContact O-N 2.73Å
82	E	38.9	Very low	63.2	Low	167 Å²	167	136.5 Å²	136.5	78%	0.78	68%	0.675	S	S	*	*			trans	-41.8	98.4	170.2	-67.7	177.9	153.7	0	0	107.2	E80 H84	E80-E82 PolarHBondContact O-N 2.87Å; E82-H84 PolarHBondContact O-N 3.44Å
83	M	41.5	Very low	60.7	Low	181 Å²	181	144.4 Å²	144.4	89%	0.892	71%	0.714	S	S	*	*			trans	-72.6	79.3	164.2	-72.1	-170.7	-174.4	0	0	104.3	G81 E85	G81-M83 VanDerWaalsContact C-N 3.26Å; G81-M83 PolarHBondContact O-N 2.73Å; M83-E85 VanDerWaalsContact C-N 3.25Å; M83-E85 PolarHBondContact O-N 3.35Å
84	H	43.5	Very low	57.9	Low	161 Å²	161	147.5 Å²	147.5	75%	0.745	74%	0.739	S	S	*	*			trans	-59.3	95.6	158.8	-107.6	-82.3	0	0	0	106.3	E82	E82-H84 PolarHBondContact O-N 3.44Å
85	E	56.1	Low	54.7	Low	179 Å²	179	157.3 Å²	157.3	84%	0.836	77%	0.774	S	S	*	*			trans	-63	139.1	160.4	-83.5	-175.2	148	0	0	108.8	M83	M83-E85 VanDerWaalsContact C-N 3.25Å; M83-E85 PolarHBondContact O-N 3.35Å
86	Y	58.4	Low	51.1	Low	310 Å²	310	167.5 Å²	167.5	100%	1.216	82%	0.823	S	S	*	*			trans	-53.8	0	-177.3	-71.3	-92.8	0	0	0	114.6

Retrieved 86 of 86 residues in 128.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).