A0A077Z4E0_TRITR Loading...

Nucleolar protein 10

AlphaFold DB , UniProt , Accession A0A077Z4E0, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 65 aa.

						>A0A077Z4E0_TRITR|A0A077Z4E0
MYLYYYVDEEGKRVYTLKKYDPSGKLTLSAHPARFTPENQYSSERMTIKRRFGLLPTQKAATSTR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	84.3	Confident	94	Very high	165 Å²	165	100.8 Å²	100.8	81%	0.813	50%	0.497	S	S	*	.				0	132	0	-66.8	-63.4	180	0	0	108.3	H31	M1-H31 HydrophobicContact CB-CB 4.39Å; M1-H31 WeakPolarHBondContact CB-CD2 3.32Å; M1-H31 WeakPolarHBondContact CB-NE2 3.38Å; M1-H31 HydrophobicContact CG-CB 4.13Å
2	Y	91.7	Very high	94.2	Very high	193 Å²	193	102.7 Å²	102.7	76%	0.757	50%	0.5	S	S	*	.			trans	-92.1	-9.9	-171.6	-63.6	-70.2	0	0	0	114.3	Y4 L17	Y2-Y4 WeakPolarHBondContact O-CD2 3.49Å; Y2-Y4 VanDerWaalsContact O-CE2 3.23Å; Y2-Y4 WeakPolarHBondContact O-CE2 3.46Å; Y2-Y4 PolarHBondContact O-N 3.26Å; Y2-L17 WeakPolarHBondContact O-CD2 3.25Å
3	L	96.2	Very high	94.3	Very high	67 Å²	67	105.5 Å²	105.5	35%	0.351	50%	0.502	S	S	.	.			trans	-80.2	118.9	179.7	-168.4	65.7	0	0	0	109.7	Y15 A30	L3-Y15 HydrophobicContact CD1-CD1 4.21Å; L3-Y15 HydrophobicContact CD1-CG 4.47Å; L3-Y15 HydrophobicContact CD2-CD1 4Å; L3-Y15 HydrophobicContact CD2-CE1 4.32Å; L3-Y15 HydrophobicContact CG-CD1 3.96Å; L3-A30 HydrophobicContact CB-CB 4.02Å; L3-A30 HydrophobicContact CD2-CB 3.85Å; L3-A30 HydrophobicContact CG-CB 3.71Å; L3-A30 VanDerWaalsContact O-CB 3.23Å; L3-A30 WeakPolarHBondContact O-CB 3.38Å; L3-A30 PolarHBondContact O-N 3.02Å
4	Y	97.1	Very high	94.4	Very high	55 Å²	55	101.4 Å²	101.4	22%	0.216	49%	0.487	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.2	168.1	173.7	-57	-83.5	0	0	0	110.3	Y2 Y15 T16 T27 L28	Y2-Y4 WeakPolarHBondContact O-CD2 3.49Å; Y2-Y4 VanDerWaalsContact O-CE2 3.23Å; Y2-Y4 WeakPolarHBondContact O-CE2 3.46Å; Y2-Y4 PolarHBondContact O-N 3.26Å; Y4-Y15 WeakPolarHBondContact O-CA 3.36Å; Y4-T16 CarbonylContact C-O 3.58Å; Y4-T16 WeakPolarHBondContact CA-O 3.39Å; Y4-T16 WeakPolarHBondContact CB-O 3.14Å; Y4-T16 PolarHBondContact N-O 3.16Å; Y4-T16 PolarHBondContact O-N 2.98Å; Y4-T27 WeakPolarHBondContact CB-OG1 3.43Å; Y4-L28 CarbonylContact C-O 3.44Å; Y4-L28 WeakPolarHBondContact CA-O 3.07Å; Y4-L28 WeakPolarHBondContact CB-O 3.39Å
5	Y	97.3	Very high	94.6	Very high	34 Å²	34	103.3 Å²	103.3	13%	0.133	49%	0.488	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.9	158.7	169.7	76.8	-77.7	0	0	0	111.3	V7 R13 V14 L28 S29 A30	Y5-V7 HydrophobicContact CD2-CG2 4.42Å; Y5-V7 HydrophobicContact CE2-CG2 4.04Å; Y5-R13 HydrophobicContact CD2-CB 3.83Å; Y5-R13 HydrophobicContact CD2-CG 3.55Å; Y5-R13 HydrophobicContact CE2-CG 3.79Å; Y5-R13 HydrophobicContact CG-CB 4.37Å; Y5-R13 HydrophobicContact CG-CG 4.39Å; Y5-V14 WeakPolarHBondContact CA-O 3.41Å; Y5-V14 WeakPolarHBondContact CB-O 3.45Å; Y5-L28 HydrophobicContact CD1-CB 4.1Å; Y5-L28 WeakPolarHBondContact CD1-O 3.35Å; Y5-L28 HydrophobicContact CE1-CB 3.63Å; Y5-L28 HydrophobicContact CE2-CD1 4.38Å; Y5-L28 PolarHBondContact N-O 2.83Å; Y5-L28 PolarHBondContact O-N 3.4Å; Y5-S29 WeakPolarHBondContact CE1-O 3.49Å; Y5-A30 HydrophobicContact CD1-CB 4.27Å
6	Y	97	Very high	94.6	Very high	57 Å²	57	98.6 Å²	98.6	22%	0.224	47%	0.469	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.8	168	161.4	62	-85	0	0	0	108.9	R13 V14 T16 D21 T27	Y6-R13 WeakPolarHBondContact O-CA 3.32Å; Y6-V14 HydrophobicContact CD1-CB 4.27Å; Y6-V14 HydrophobicContact CD2-CB 4.32Å; Y6-V14 HydrophobicContact CE1-CB 3.76Å; Y6-V14 HydrophobicContact CE1-CG1 3.72Å; Y6-V14 HydrophobicContact CE2-CB 3.83Å; Y6-V14 HydrophobicContact CE2-CG1 4.32Å; Y6-V14 HydrophobicContact CE2-CG2 4.09Å; Y6-V14 PolarHBondContact N-O 2.67Å; Y6-V14 PolarHBondContact O-N 2.8Å; Y6-V14 WeakPolarHBondContact OH-CG1 3.32Å; Y6-T16 HydrophobicContact CD1-CG2 4.14Å; Y6-T16 HydrophobicContact CE1-CG2 4.38Å; Y6-D21 HydrophobicContact CD1-CB 4.01Å; Y6-D21 HydrophobicContact CD2-CB 4.22Å; Y6-D21 HydrophobicContact CG-CB 3.8Å; Y6-T27 HydrophobicContact CD1-CG2 4.49Å
7	V	95.7	Very high	94.7	Very high	84 Å²	84	100.4 Å²	100.4	51%	0.509	48%	0.481	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.7	124.7	178.4	-177.2	0	0	0	0	107.5	Y5 K12	Y5-V7 HydrophobicContact CD2-CG2 4.42Å; Y5-V7 HydrophobicContact CE2-CG2 4.04Å; V7-K12 WeakPolarHBondContact CA-O 3.49Å
8	D	93	Very high	94.8	Very high	49 Å²	49	103.2 Å²	103.2	26%	0.262	49%	0.491	S	S	.	.			trans	-76.6	179.9	174.9	65.9	15.1	0	0	0	111.7	E10 G11 K12 V14	D8-E10 PolarHBondContact O-N 2.75Å; D8-E10 WeakPolarHBondContact OD1-CA 3.42Å; D8-E10 WeakPolarHBondContact OD1-CB 3.36Å; D8-E10 PolarHBondContact OD1-N 3Å; D8-G11 PolarHBondContact O-N 2.74Å; D8-G11 VanDerWaalsContact O-N 3.08Å; D8-G11 PolarHBondContact OD1-N 2.85Å; D8-K12 PolarHBondContact N-O 3.1Å; D8-K12 WeakPolarHBondContact OD1-CA 3.49Å; D8-K12 PolarHBondContact OD1-N 3.15Å; D8-K12 WeakPolarHBondContact OD2-CB 3.48Å; D8-V14 HydrophobicContact CB-CG2 4.07Å
9	E	93.6	Very high	94.8	Very high	208 Å²	208	105.3 Å²	105.3	97%	0.972	50%	0.497	S	S	*	.	T	Hydrogen-bonded Turn	trans	-64.6	-22.2	179.5	-60.2	-177.9	169.5	0	0	112.8	G11	E9-G11 VanDerWaalsContact C-N 3.31Å
10	E	94.5	Very high	94.8	Very high	142 Å²	142	107 Å²	107	66%	0.664	50%	0.5	S	S	*	.	T	Hydrogen-bonded Turn	trans	-85.8	-2.7	176.6	-58.9	-176.9	-179	0	0	112.9	D8 K12	D8-E10 PolarHBondContact O-N 2.75Å; D8-E10 WeakPolarHBondContact OD1-CA 3.42Å; D8-E10 WeakPolarHBondContact OD1-CB 3.36Å; D8-E10 PolarHBondContact OD1-N 3Å; E10-K12 VanDerWaalsContact C-N 3.3Å; E10-K12 HydrophobicContact CB-CD 4.43Å; E10-K12 HydrophobicContact CB-CG 4.41Å; E10-K12 VanDerWaalsContact OE2-CE 3.32Å; E10-K12 WeakPolarHBondContact OE2-CE 3.42Å; E10-K12 IonicContact OE2-NZ 2.67Å; E10-K12 PolarHBondContact OE2-NZ 3.08Å
11	G	93.9	Very high	94.8	Very high	55 Å²	55	103 Å²	103	57%	0.567	48%	0.482	S	S	*	.	S	Bend	trans	79.7	8.9	-176.5	0	0	0	0	0	114.2	D8 E9	D8-G11 PolarHBondContact O-N 2.74Å; D8-G11 VanDerWaalsContact O-N 3.08Å; D8-G11 PolarHBondContact OD1-N 2.85Å; E9-G11 VanDerWaalsContact C-N 3.31Å
12	K	95.7	Very high	95.2	Very high	123 Å²	123	100.4 Å²	100.4	54%	0.535	48%	0.477	S	S	.	.	P	Polyproline II helix	trans	-86.8	151.4	177.2	-64.2	172	-177.9	159.8	0	110.6	V7 D8 E10	V7-K12 WeakPolarHBondContact CA-O 3.49Å; D8-K12 PolarHBondContact N-O 3.1Å; D8-K12 WeakPolarHBondContact OD1-CA 3.49Å; D8-K12 PolarHBondContact OD1-N 3.15Å; D8-K12 WeakPolarHBondContact OD2-CB 3.48Å; E10-K12 VanDerWaalsContact C-N 3.3Å; E10-K12 HydrophobicContact CB-CD 4.43Å; E10-K12 HydrophobicContact CB-CG 4.41Å; E10-K12 VanDerWaalsContact OE2-CE 3.32Å; E10-K12 WeakPolarHBondContact OE2-CE 3.42Å; E10-K12 IonicContact OE2-NZ 2.67Å; E10-K12 PolarHBondContact OE2-NZ 3.08Å
13	R	95.6	Very high	95.3	Very high	139 Å²	139	95.9 Å²	95.9	53%	0.525	47%	0.474	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.2	119.7	177.4	-62.7	-174	179.5	174.9	-0.5	109.7	Y5 Y6 Y15	Y5-R13 HydrophobicContact CD2-CB 3.83Å; Y5-R13 HydrophobicContact CD2-CG 3.55Å; Y5-R13 HydrophobicContact CE2-CG 3.79Å; Y5-R13 HydrophobicContact CG-CB 4.37Å; Y5-R13 HydrophobicContact CG-CG 4.39Å; Y6-R13 WeakPolarHBondContact O-CA 3.32Å; R13-Y15 HydrophobicContact CB-CE2 4.5Å
14	V	96.2	Very high	95.2	Very high	48 Å²	48	95.1 Å²	95.1	29%	0.291	48%	0.483	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100	117.6	169.9	-176.6	0	0	0	0	108.7	Y5 Y6 D8	Y5-V14 WeakPolarHBondContact CA-O 3.41Å; Y5-V14 WeakPolarHBondContact CB-O 3.45Å; Y6-V14 HydrophobicContact CD1-CB 4.27Å; Y6-V14 HydrophobicContact CD2-CB 4.32Å; Y6-V14 HydrophobicContact CE1-CB 3.76Å; Y6-V14 HydrophobicContact CE1-CG1 3.72Å; Y6-V14 HydrophobicContact CE2-CB 3.83Å; Y6-V14 HydrophobicContact CE2-CG1 4.32Å; Y6-V14 HydrophobicContact CE2-CG2 4.09Å; Y6-V14 PolarHBondContact N-O 2.67Å; Y6-V14 PolarHBondContact O-N 2.8Å; Y6-V14 WeakPolarHBondContact OH-CG1 3.32Å; D8-V14 HydrophobicContact CB-CG2 4.07Å
15	Y	96.6	Very high	95.1	Very high	130 Å²	130	99.5 Å²	99.5	51%	0.51	50%	0.503	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.6	144.3	-178.3	-66.8	-75.5	0	0	0	112	L3 Y4 R13 A30	L3-Y15 HydrophobicContact CD1-CD1 4.21Å; L3-Y15 HydrophobicContact CD1-CG 4.47Å; L3-Y15 HydrophobicContact CD2-CD1 4Å; L3-Y15 HydrophobicContact CD2-CE1 4.32Å; L3-Y15 HydrophobicContact CG-CD1 3.96Å; Y4-Y15 WeakPolarHBondContact O-CA 3.36Å; R13-Y15 HydrophobicContact CB-CE2 4.5Å; Y15-A30 HydrophobicContact CD1-CB 4.09Å; Y15-A30 HydrophobicContact CE1-CB 3.82Å
16	T	95.9	Very high	95	Very high	28 Å²	28	104.2 Å²	104.2	17%	0.172	53%	0.53	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-154.6	158.7	-178	-177.2	0	0	0	0	111.1	Y4 Y6 K18 T27	Y4-T16 CarbonylContact C-O 3.58Å; Y4-T16 WeakPolarHBondContact CA-O 3.39Å; Y4-T16 WeakPolarHBondContact CB-O 3.14Å; Y4-T16 PolarHBondContact N-O 3.16Å; Y4-T16 PolarHBondContact O-N 2.98Å; Y6-T16 HydrophobicContact CD1-CG2 4.14Å; Y6-T16 HydrophobicContact CE1-CG2 4.38Å; T16-K18 WeakPolarHBondContact OG1-CB 3.49Å; T16-K18 PolarHBondContact OG1-N 2.87Å; T16-K18 VanDerWaalsContact OG1-N 3.07Å; T16-T27 HydrophobicContact CG2-CG2 3.78Å
17	L	96	Very high	95	Very high	129 Å²	129	102.2 Å²	102.2	68%	0.675	52%	0.523	S	S	*	.	S	Bend	trans	-98.2	-8.2	169.5	-60.3	178.7	0	0	0	112.1	Y2	Y2-L17 WeakPolarHBondContact O-CD2 3.25Å
18	K	95.8	Very high	94.9	Very high	152 Å²	152	102.9 Å²	102.9	66%	0.661	52%	0.524	S	S	*	.	S	Bend	trans	-77.4	148.3	178.3	-61.2	179.6	179.3	178.7	0	109.9	T16 Y20 T27	T16-K18 WeakPolarHBondContact OG1-CB 3.49Å; T16-K18 PolarHBondContact OG1-N 2.87Å; T16-K18 VanDerWaalsContact OG1-N 3.07Å; K18-Y20 VanDerWaalsContact C-N 3.31Å; K18-T27 PolarHBondContact O-OG1 3.12Å; K18-T27 VanDerWaalsContact O-OG1 3.12Å
19	K	94.8	Very high	95.1	Very high	142 Å²	142	103.5 Å²	103.5	62%	0.617	53%	0.532	S	S	*	.	S	Bend	trans	-77.3	-16	176	-63.1	-172.4	178.4	-178.8	0	113.9	T27	K19-T27 VanDerWaalsContact C-OG1 3.29Å; K19-T27 WeakPolarHBondContact CA-OG1 3.23Å; K19-T27 PolarHBondContact O-N 3.09Å; K19-T27 PolarHBondContact O-OG1 3.07Å; K19-T27 VanDerWaalsContact O-OG1 3.09Å
20	Y	96	Very high	95.2	Very high	140 Å²	140	94.7 Å²	94.7	55%	0.549	49%	0.494	S	S	.	.	B	Isolated β-bridge	trans	-124.1	142.3	-176.9	-61.7	-81.5	0	0	0	110.1	K18 K25 L26	K18-Y20 VanDerWaalsContact C-N 3.31Å; Y20-K25 CarbonylContact C-O 3.57Å; Y20-K25 VanDerWaalsContact CA-O 3.32Å; Y20-K25 WeakPolarHBondContact CA-O 3.34Å; Y20-L26 HydrophobicContact CD1-CG 4.46Å; Y20-L26 HydrophobicContact CE1-CG 4.12Å
21	D	93.4	Very high	95.3	Very high	24 Å²	24	91.2 Å²	91.2	13%	0.128	48%	0.478	C	S	.	.			trans	-75.7	172.2	170.6	79	1	0	0	0	110.8	Y6 S23 G24 K25 T27	Y6-D21 HydrophobicContact CD1-CB 4.01Å; Y6-D21 HydrophobicContact CD2-CB 4.22Å; Y6-D21 HydrophobicContact CG-CB 3.8Å; D21-S23 PolarHBondContact O-N 2.89Å; D21-S23 VanDerWaalsContact O-N 3.15Å; D21-S23 VanDerWaalsContact OD1-CA 3.25Å; D21-S23 WeakPolarHBondContact OD1-CA 3.2Å; D21-S23 WeakPolarHBondContact OD1-CB 3.35Å; D21-S23 PolarHBondContact OD1-N 3.05Å; D21-G24 PolarHBondContact O-N 2.91Å; D21-G24 VanDerWaalsContact O-N 3.1Å; D21-G24 PolarHBondContact OD1-N 2.82Å; D21-K25 PolarHBondContact N-O 2.99Å; D21-K25 PolarHBondContact OD1-N 2.9Å; D21-K25 WeakPolarHBondContact OD2-CB 3.45Å; D21-T27 HydrophobicContact CB-CG2 4.43Å
22	P	93.7	Very high	95.4	Very high	109 Å²	109	94.3 Å²	94.3	71%	0.708	49%	0.488	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.8	-18.9	176.4	-24.7	35.6	0	0	0	114.8
23	S	93.7	Very high	95.3	Very high	99 Å²	99	93 Å²	93	69%	0.692	50%	0.501	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.9	0.3	177.9	-60.9	0	0	0	0	113.4	D21	D21-S23 PolarHBondContact O-N 2.89Å; D21-S23 VanDerWaalsContact O-N 3.15Å; D21-S23 VanDerWaalsContact OD1-CA 3.25Å; D21-S23 WeakPolarHBondContact OD1-CA 3.2Å; D21-S23 WeakPolarHBondContact OD1-CB 3.35Å; D21-S23 PolarHBondContact OD1-N 3.05Å
24	G	94.2	Very high	95.2	Very high	51 Å²	51	96.6 Å²	96.6	53%	0.526	51%	0.514	S	S	.	.	S	Bend	trans	81.9	5.8	-176.8	0	0	0	0	0	115.9	D21	D21-G24 PolarHBondContact O-N 2.91Å; D21-G24 VanDerWaalsContact O-N 3.1Å; D21-G24 PolarHBondContact OD1-N 2.82Å
25	K	94	Very high	95.1	Very high	146 Å²	146	102.1 Å²	102.1	64%	0.635	53%	0.534	S	S	*	.	P	Polyproline II helix	trans	-78.7	151.6	173.3	-55.3	173.4	179.9	168.1	0	110.5	Y20 D21	Y20-K25 CarbonylContact C-O 3.57Å; Y20-K25 VanDerWaalsContact CA-O 3.32Å; Y20-K25 WeakPolarHBondContact CA-O 3.34Å; D21-K25 PolarHBondContact N-O 2.99Å; D21-K25 PolarHBondContact OD1-N 2.9Å; D21-K25 WeakPolarHBondContact OD2-CB 3.45Å
26	L	95.4	Very high	95	Very high	134 Å²	134	97.4 Å²	97.4	70%	0.702	52%	0.519	S	S	*	.	B	Isolated β-bridge	trans	-68.9	134	176.4	-74.9	112	0	0	0	111.5	Y20	Y20-L26 HydrophobicContact CD1-CG 4.46Å; Y20-L26 HydrophobicContact CE1-CG 4.12Å
27	T	96.4	Very high	94.9	Very high	14 Å²	14	101 Å²	101	9%	0.086	54%	0.543	C	S	.	.	P	Polyproline II helix	trans	-77.5	152.1	175.2	58	0	0	0	0	111.8	Y4 Y6 T16 K18 K19 D21	Y4-T27 WeakPolarHBondContact CB-OG1 3.43Å; Y6-T27 HydrophobicContact CD1-CG2 4.49Å; T16-T27 HydrophobicContact CG2-CG2 3.78Å; K18-T27 PolarHBondContact O-OG1 3.12Å; K18-T27 VanDerWaalsContact O-OG1 3.12Å; K19-T27 VanDerWaalsContact C-OG1 3.29Å; K19-T27 WeakPolarHBondContact CA-OG1 3.23Å; K19-T27 PolarHBondContact O-N 3.09Å; K19-T27 PolarHBondContact O-OG1 3.07Å; K19-T27 VanDerWaalsContact O-OG1 3.09Å; D21-T27 HydrophobicContact CB-CG2 4.43Å
28	L	95.5	Very high	94.8	Very high	99 Å²	99	101.7 Å²	101.7	52%	0.518	54%	0.543	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.2	150	179.2	-59.8	176.8	0	0	0	111.4	Y4 Y5 A30	Y4-L28 CarbonylContact C-O 3.44Å; Y4-L28 WeakPolarHBondContact CA-O 3.07Å; Y4-L28 WeakPolarHBondContact CB-O 3.39Å; Y5-L28 HydrophobicContact CD1-CB 4.1Å; Y5-L28 WeakPolarHBondContact CD1-O 3.35Å; Y5-L28 HydrophobicContact CE1-CB 3.63Å; Y5-L28 HydrophobicContact CE2-CD1 4.38Å; Y5-L28 PolarHBondContact N-O 2.83Å; Y5-L28 PolarHBondContact O-N 3.4Å; L28-A30 PolarHBondContact O-N 2.88Å
29	S	96.1	Very high	94.5	Very high	62 Å²	62	96.4 Å²	96.4	43%	0.434	52%	0.522	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-62.7	129.2	172.4	170	0	0	0	0	110.4	Y5 H31	Y5-S29 WeakPolarHBondContact CE1-O 3.49Å; S29-H31 PolarHBondContact O-N 3.29Å; S29-H31 PolarHBondContact OG-N 2.88Å; S29-H31 PolarHBondContact OG-O 2.9Å
30	A	96.4	Very high	94.4	Very high	23 Å²	23	97 Å²	97	19%	0.19	53%	0.527	C	S	.	.	S	Bend	trans	-70.2	-14.6	175.2	0	0	0	0	0	113.4	L3 Y5 Y15 L28	L3-A30 HydrophobicContact CB-CB 4.02Å; L3-A30 HydrophobicContact CD2-CB 3.85Å; L3-A30 HydrophobicContact CG-CB 3.71Å; L3-A30 VanDerWaalsContact O-CB 3.23Å; L3-A30 WeakPolarHBondContact O-CB 3.38Å; L3-A30 PolarHBondContact O-N 3.02Å; Y5-A30 HydrophobicContact CD1-CB 4.27Å; Y15-A30 HydrophobicContact CD1-CB 4.09Å; Y15-A30 HydrophobicContact CE1-CB 3.82Å; L28-A30 PolarHBondContact O-N 2.88Å
31	H	95.7	Very high	94.4	Very high	68 Å²	68	98 Å²	98	32%	0.315	53%	0.531	S	S	.	.	S	Bend	trans	-96.9	140.5	-174.8	-57.5	-90	0	0	0	111.1	M1 S29	M1-H31 HydrophobicContact CB-CB 4.39Å; M1-H31 WeakPolarHBondContact CB-CD2 3.32Å; M1-H31 WeakPolarHBondContact CB-NE2 3.38Å; M1-H31 HydrophobicContact CG-CB 4.13Å; S29-H31 PolarHBondContact O-N 3.29Å; S29-H31 PolarHBondContact OG-N 2.88Å; S29-H31 PolarHBondContact OG-O 2.9Å
32	P	95.9	Very high	94.4	Very high	120 Å²	120	99.3 Å²	99.3	78%	0.779	54%	0.542	S	S	*	.	P	Polyproline II helix	trans	-64.7	157.5	178.4	29.2	-35.5	0	0	0	111.4
33	A	93.9	Very high	94.5	Very high	97 Å²	97	97.4 Å²	97.4	80%	0.802	53%	0.531	S	S	*	.	P	Polyproline II helix	trans	-60.2	144.3	169.3	0	0	0	0	0	110.4	F35	A33-F35 PolarHBondContact O-N 3.24Å
34	R	94	Very high	94.6	Very high	213 Å²	213	96.8 Å²	96.8	80%	0.804	52%	0.517	S	S	*	.	P	Polyproline II helix	trans	-62.4	130.8	-179.6	-171.5	-178.3	69.8	97.3	1.1	110.6	T36	R34-T36 VanDerWaalsContact NH2-CG2 3.29Å
35	F	94.1	Very high	94.7	Very high	164 Å²	164	99.3 Å²	99.3	72%	0.719	51%	0.511	S	S	*	.	P	Polyproline II helix	trans	-86.9	138.5	172.4	178.8	-99.3	0	0	0	110.7	A33 P37	A33-F35 PolarHBondContact O-N 3.24Å; F35-P37 HydrophobicContact CE1-CG 4.43Å
36	T	93.9	Very high	94.7	Very high	31 Å²	31	95.5 Å²	95.5	19%	0.19	50%	0.496	C	S	.	.			trans	-130.9	141.6	165.3	51.1	0	0	0	0	109.9	R34 E38 N39	R34-T36 VanDerWaalsContact NH2-CG2 3.29Å; T36-E38 VanDerWaalsContact C-N 3.29Å; T36-E38 PolarHBondContact O-N 3.4Å; T36-N39 PolarHBondContact O-N 3.13Å; T36-N39 PolarHBondContact OG1-N 3.44Å
37	P	94.4	Very high	94.8	Very high	105 Å²	105	91.5 Å²	91.5	68%	0.682	48%	0.478	S	S	*	.	S	Bend	trans	-58.9	-39.7	173	-23.7	34.3	0	0	0	112.8	F35 N39	F35-P37 HydrophobicContact CE1-CG 4.43Å; P37-N39 VanDerWaalsContact C-N 3.28Å; P37-N39 PolarHBondContact O-N 3.04Å
38	E	93.7	Very high	94.8	Very high	143 Å²	143	95.3 Å²	95.3	67%	0.668	50%	0.496	S	S	*	.	S	Bend	trans	-69.4	-26.6	-173.7	-59.7	71.8	-153	0	0	112.8	T36 Q40	T36-E38 VanDerWaalsContact C-N 3.29Å; T36-E38 PolarHBondContact O-N 3.4Å; E38-Q40 PolarHBondContact O-N 2.89Å
39	N	89.5	Confident	94.9	Very high	40 Å²	40	94.6 Å²	94.6	21%	0.214	49%	0.489	C	S	.	.			trans	19.1	68.2	177.1	-160.1	-18.2	0	0	0	115.4	T36 P37 Y41 S42 R45	T36-N39 PolarHBondContact O-N 3.13Å; T36-N39 PolarHBondContact OG1-N 3.44Å; P37-N39 VanDerWaalsContact C-N 3.28Å; P37-N39 PolarHBondContact O-N 3.04Å; N39-Y41 PolarHBondContact O-N 3.25Å; N39-Y41 VanDerWaalsContact O-N 3.1Å; N39-S42 WeakPolarHBondContact O-CB 3.23Å; N39-S42 PolarHBondContact O-N 3.32Å; N39-S42 PolarHBondContact O-OG 2.95Å; N39-R45 PolarHBondContact ND2-NH1 3.03Å; N39-R45 PolarHBondContact ND2-NH2 3.28Å; N39-R45 PolarHBondContact OD1-NH1 3.14Å
40	Q	93.7	Very high	94.8	Very high	154 Å²	154	98.4 Å²	98.4	72%	0.72	49%	0.494	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54.9	-34.1	-174.2	-67.5	177.2	-40.4	0	0	112.6	E38 S42	E38-Q40 PolarHBondContact O-N 2.89Å; Q40-S42 VanDerWaalsContact C-N 3.3Å; Q40-S42 PolarHBondContact O-N 3.44Å
41	Y	94.9	Very high	94.8	Very high	162 Å²	162	107.1 Å²	107.1	64%	0.635	52%	0.522	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.4	22	-177.3	-53.2	-70.3	0	0	0	114.1	N39 E44 R45	N39-Y41 PolarHBondContact O-N 3.25Å; N39-Y41 VanDerWaalsContact O-N 3.1Å; Y41-E44 WeakPolarHBondContact CA-OE2 3.42Å; Y41-R45 PolarHBondContact O-N 3.42Å
42	S	93.8	Very high	94.8	Very high	51 Å²	51	111.1 Å²	111.1	36%	0.357	54%	0.539	S	S	.	.	H	α-helix	trans	-66.3	-37.7	-179	56.8	0	0	0	0	112.2	N39 Q40 R45 M46	N39-S42 WeakPolarHBondContact O-CB 3.23Å; N39-S42 PolarHBondContact O-N 3.32Å; N39-S42 PolarHBondContact O-OG 2.95Å; Q40-S42 VanDerWaalsContact C-N 3.3Å; Q40-S42 PolarHBondContact O-N 3.44Å; S42-R45 PolarHBondContact O-N 2.95Å; S42-M46 WeakPolarHBondContact O-CG 3.36Å; S42-M46 PolarHBondContact O-N 3.33Å
43	S	94.8	Very high	94.7	Very high	70 Å²	70	107.2 Å²	107.2	49%	0.49	52%	0.52	S	S	.	.	H	α-helix	trans	-66.1	-39.5	-178.4	81.5	0	0	0	0	112.4	M46 T47	S43-M46 PolarHBondContact O-N 2.91Å; S43-T47 WeakPolarHBondContact O-CB 3.34Å; S43-T47 PolarHBondContact O-N 3.35Å; S43-T47 PolarHBondContact O-OG1 3.06Å
44	E	97.1	Very high	94.7	Very high	86 Å²	86	107.6 Å²	107.6	40%	0.402	51%	0.508	S	S	.	.	H	α-helix	trans	-70	-45.2	180	-64.7	83.9	165.8	0	0	109.6	Y41 M46 T47 I48	Y41-E44 WeakPolarHBondContact CA-OE2 3.42Å; E44-M46 VanDerWaalsContact C-N 3.29Å; E44-M46 PolarHBondContact O-N 3.16Å; E44-T47 PolarHBondContact O-N 3.3Å; E44-I48 WeakPolarHBondContact O-CG1 3.5Å; E44-I48 PolarHBondContact O-N 3.2Å
45	R	95.8	Very high	94.6	Very high	103 Å²	103	98.7 Å²	98.7	39%	0.389	48%	0.476	S	S	.	.	H	α-helix	trans	-57.3	-42.9	173.6	-175.1	179.1	64	-108.9	3.5	111.4	N39 Y41 S42 K49	N39-R45 PolarHBondContact ND2-NH1 3.03Å; N39-R45 PolarHBondContact ND2-NH2 3.28Å; N39-R45 PolarHBondContact OD1-NH1 3.14Å; Y41-R45 PolarHBondContact O-N 3.42Å; S42-R45 PolarHBondContact O-N 2.95Å; R45-K49 WeakPolarHBondContact O-CB 3.37Å; R45-K49 WeakPolarHBondContact O-CG 3.1Å; R45-K49 PolarHBondContact O-N 3.29Å
46	M	94.7	Very high	94.3	Very high	66 Å²	66	96.1 Å²	96.1	33%	0.325	48%	0.476	S	S	.	.	H	α-helix	trans	-67.9	-40.7	177.4	-70	-54.2	102.9	0	0	112.2	S42 S43 E44 K49 R50 L55	S42-M46 WeakPolarHBondContact O-CG 3.36Å; S42-M46 PolarHBondContact O-N 3.33Å; S43-M46 PolarHBondContact O-N 2.91Å; E44-M46 VanDerWaalsContact C-N 3.29Å; E44-M46 PolarHBondContact O-N 3.16Å; M46-K49 HydrophobicContact CE-CD 3.95Å; M46-K49 PolarHBondContact O-N 3.27Å; M46-R50 WeakPolarHBondContact O-CB 3.48Å; M46-R50 PolarHBondContact O-N 2.9Å; M46-L55 HydrophobicContact SD-CD2 4.33Å
47	T	96.7	Very high	94.2	Very high	51 Å²	51	100.7 Å²	100.7	31%	0.313	50%	0.504	S	S	.	.	H	α-helix	trans	-62.6	-44.6	177.8	-60.9	0	0	0	0	111.6	S43 E44 R50 R51	S43-T47 WeakPolarHBondContact O-CB 3.34Å; S43-T47 PolarHBondContact O-N 3.35Å; S43-T47 PolarHBondContact O-OG1 3.06Å; E44-T47 PolarHBondContact O-N 3.3Å; T47-R50 PolarHBondContact O-N 3.19Å; T47-R51 WeakPolarHBondContact O-CG 3.39Å; T47-R51 PolarHBondContact O-N 3.35Å
48	I	97.1	Very high	93.9	Very high	93 Å²	93	100 Å²	100	48%	0.477	49%	0.491	S	S	.	.	H	α-helix	trans	-61.4	-50.1	175	-68.3	168.5	0	0	0	110.2	E44 R50 R51 F52	E44-I48 WeakPolarHBondContact O-CG1 3.5Å; E44-I48 PolarHBondContact O-N 3.2Å; I48-R50 VanDerWaalsContact C-N 3.26Å; I48-R50 PolarHBondContact O-N 2.9Å; I48-R51 PolarHBondContact O-N 3.07Å; I48-R51 VanDerWaalsContact O-N 3.14Å; I48-F52 HydrophobicContact CG2-CD2 3.84Å; I48-F52 HydrophobicContact CG2-CE2 4Å; I48-F52 VanDerWaalsContact O-CD2 3.32Å; I48-F52 WeakPolarHBondContact O-CD2 3.16Å; I48-F52 PolarHBondContact O-N 3.47Å; I48-F52 VanDerWaalsContact O-N 3.13Å
49	K	96.4	Very high	93.5	Very high	84 Å²	84	100 Å²	100	37%	0.365	49%	0.489	S	S	.	.	H	α-helix	trans	-56	-41.5	177.5	-76.7	-175.5	177.4	-166.8	0	112.4	R45 M46 F52 G53 L54 L55	R45-K49 WeakPolarHBondContact O-CB 3.37Å; R45-K49 WeakPolarHBondContact O-CG 3.1Å; R45-K49 PolarHBondContact O-N 3.29Å; M46-K49 HydrophobicContact CE-CD 3.95Å; M46-K49 PolarHBondContact O-N 3.27Å; K49-F52 PolarHBondContact O-N 3.21Å; K49-G53 PolarHBondContact O-N 3.39Å; K49-L54 HydrophobicContact CB-CB 4.25Å; K49-L54 HydrophobicContact CG-CB 4.33Å; K49-L54 PolarHBondContact O-N 3.36Å; K49-L55 HydrophobicContact CB-CD2 3.76Å; K49-L55 HydrophobicContact CB-CG 4.25Å; K49-L55 HydrophobicContact CD-CD2 4.42Å
50	R	95.2	Very high	93.1	Very high	142 Å²	142	102.3 Å²	102.3	54%	0.536	51%	0.514	S	S	.	.	H	α-helix	trans	-62.1	-45.8	177.1	-168.9	-176.5	-64	122.9	-1.5	112	M46 T47 I48 F52 G53 L55 Q58	M46-R50 WeakPolarHBondContact O-CB 3.48Å; M46-R50 PolarHBondContact O-N 2.9Å; T47-R50 PolarHBondContact O-N 3.19Å; I48-R50 VanDerWaalsContact C-N 3.26Å; I48-R50 PolarHBondContact O-N 2.9Å; R50-F52 VanDerWaalsContact C-N 3.29Å; R50-F52 PolarHBondContact O-N 3Å; R50-G53 PolarHBondContact O-N 3.38Å; R50-L55 HydrophobicContact CB-CD1 3.76Å; R50-L55 HydrophobicContact CB-CG 4.46Å; R50-L55 HydrophobicContact CG-CD1 3.92Å; R50-Q58 PolarHBondContact O-NE2 2.92Å
51	R	96.1	Very high	92.4	Very high	206 Å²	206	99.8 Å²	99.8	78%	0.777	52%	0.52	S	S	*	.	H	α-helix	trans	-61.4	-36.2	179.8	-74.2	178.3	-178	-179.6	1.5	112.5	T47 I48	T47-R51 WeakPolarHBondContact O-CG 3.39Å; T47-R51 PolarHBondContact O-N 3.35Å; I48-R51 PolarHBondContact O-N 3.07Å; I48-R51 VanDerWaalsContact O-N 3.14Å
52	F	95.9	Very high	91.4	Very high	153 Å²	153	98.1 Å²	98.1	67%	0.671	53%	0.526	S	S	*	.	T	Hydrogen-bonded Turn	trans	-94.3	9.6	-179.4	-71.1	-75.5	0	0	0	114.5	I48 K49 R50 L54	I48-F52 HydrophobicContact CG2-CD2 3.84Å; I48-F52 HydrophobicContact CG2-CE2 4Å; I48-F52 VanDerWaalsContact O-CD2 3.32Å; I48-F52 WeakPolarHBondContact O-CD2 3.16Å; I48-F52 PolarHBondContact O-N 3.47Å; I48-F52 VanDerWaalsContact O-N 3.13Å; K49-F52 PolarHBondContact O-N 3.21Å; R50-F52 VanDerWaalsContact C-N 3.29Å; R50-F52 PolarHBondContact O-N 3Å; F52-L54 HydrophobicContact CB-CD1 3.97Å; F52-L54 HydrophobicContact CB-CG 3.88Å; F52-L54 PolarHBondContact O-N 2.98Å
53	G	93.1	Very high	89.7	Confident	37 Å²	37	100.3 Å²	100.3	38%	0.381	54%	0.542	S	S	.	.	T	Hydrogen-bonded Turn	trans	68.9	20.4	178.2	0	0	0	0	0	114.4	K49 R50	K49-G53 PolarHBondContact O-N 3.39Å; R50-G53 PolarHBondContact O-N 3.38Å
54	L	92.9	Very high	88.3	Confident	105 Å²	105	103 Å²	103	55%	0.55	56%	0.556	S	S	.	*			trans	-91.9	-1.8	-172.2	-60.5	177.4	0	0	0	113.7	K49 F52	K49-L54 HydrophobicContact CB-CB 4.25Å; K49-L54 HydrophobicContact CG-CB 4.33Å; K49-L54 PolarHBondContact O-N 3.36Å; F52-L54 HydrophobicContact CB-CD1 3.97Å; F52-L54 HydrophobicContact CB-CG 3.88Å; F52-L54 PolarHBondContact O-N 2.98Å
55	L	92.4	Very high	85.6	Confident	26 Å²	26	113.1 Å²	113.1	14%	0.136	59%	0.59	C	S	.	*	S	Bend	trans	-72.2	140.7	177.9	-62.3	173.1	0	0	0	110.3	M46 K49 R50 T57 Q58	M46-L55 HydrophobicContact SD-CD2 4.33Å; K49-L55 HydrophobicContact CB-CD2 3.76Å; K49-L55 HydrophobicContact CB-CG 4.25Å; K49-L55 HydrophobicContact CD-CD2 4.42Å; R50-L55 HydrophobicContact CB-CD1 3.76Å; R50-L55 HydrophobicContact CB-CG 4.46Å; R50-L55 HydrophobicContact CG-CD1 3.92Å; L55-T57 PolarHBondContact O-N 3.1Å; L55-T57 VanDerWaalsContact O-N 3.16Å; L55-Q58 HydrophobicContact CB-CG 4.06Å; L55-Q58 VanDerWaalsContact CB-OE1 3.29Å; L55-Q58 WeakPolarHBondContact O-CB 3.21Å; L55-Q58 PolarHBondContact O-N 3.03Å
56	P	89.2	Confident	85.1	Confident	110 Å²	110	113.6 Å²	113.6	71%	0.714	60%	0.6	S	S	*	*	G	3₁₀ helix	trans	-55	-33.6	176	-26.6	35	0	0	0	113.5	Q58 K59	P56-Q58 PolarHBondContact O-N 3.03Å; P56-K59 PolarHBondContact O-N 3.08Å
57	T	90.7	Very high	84.6	Confident	128 Å²	128	116.1 Å²	116.1	79%	0.785	62%	0.615	S	S	*	*	G	3₁₀ helix	trans	-70.3	-14.3	177.9	53.4	0	0	0	0	114.2	L55	L55-T57 PolarHBondContact O-N 3.1Å; L55-T57 VanDerWaalsContact O-N 3.16Å
58	Q	89.4	Confident	83.9	Confident	89 Å²	89	119.7 Å²	119.7	42%	0.416	63%	0.631	S	S	.	*	G	3₁₀ helix	trans	-91.4	-13.8	176.2	-66.4	172.7	-59.5	0	0	112.2	R50 L55 P56	R50-Q58 PolarHBondContact O-NE2 2.92Å; L55-Q58 HydrophobicContact CB-CG 4.06Å; L55-Q58 VanDerWaalsContact CB-OE1 3.29Å; L55-Q58 WeakPolarHBondContact O-CB 3.21Å; L55-Q58 PolarHBondContact O-N 3.03Å; P56-Q58 PolarHBondContact O-N 3.03Å
59	K	84.2	Confident	83.1	Confident	143 Å²	143	121.3 Å²	121.3	62%	0.622	64%	0.64	S	S	*	*	S	Bend	trans	-83.7	143.4	176.9	-63.1	-174.4	178	-173.2	0	109.4	P56 A61	P56-K59 PolarHBondContact O-N 3.08Å; K59-A61 PolarHBondContact O-N 2.98Å
60	A	81.6	Confident	82.3	Confident	90 Å²	90	123.6 Å²	123.6	74%	0.744	66%	0.658	S	S	*	*			trans	-53.9	140.1	168.7	0	0	0	0	0	108.9	T62	A60-T62 PolarHBondContact O-N 3.47Å
61	A	78.8	Confident	81.4	Confident	100 Å²	100	122.4 Å²	122.4	83%	0.826	67%	0.666	S	S	*	*			trans	-56.2	111.3	174.4	0	0	0	0	0	107.9	K59 S63	K59-A61 PolarHBondContact O-N 2.98Å; A61-S63 VanDerWaalsContact C-N 3.27Å; A61-S63 PolarHBondContact O-N 3.33Å
62	T	72.9	Confident	80.4	Confident	127 Å²	127	116.4 Å²	116.4	78%	0.779	66%	0.658	S	S	*	*			trans	-65.1	96.9	172.7	-55	0	0	0	0	106.5	A60 T64	A60-T62 PolarHBondContact O-N 3.47Å; T62-T64 PolarHBondContact O-N 3.5Å
63	S	58.4	Low	79.2	Confident	98 Å²	98	113.6 Å²	113.6	69%	0.685	66%	0.657	S	S	*	*			trans	-66.8	86.4	168.6	153.3	0	0	0	0	107.2	A61 R65	A61-S63 VanDerWaalsContact C-N 3.27Å; A61-S63 PolarHBondContact O-N 3.33Å; S63-R65 PolarHBondContact O-N 3.43Å; S63-R65 VanDerWaalsContact O-N 3.16Å
64	T	64.9	Low	78.1	Confident	126 Å²	126	120 Å²	120	77%	0.773	68%	0.68	S	S	*	*			trans	-70.5	105.3	164.8	-45.7	0	0	0	0	106.9	T62	T62-T64 PolarHBondContact O-N 3.5Å
65	R	41.3	Very low	76.7	Confident	298 Å²	298	121.4 Å²	121.4	100%	1.125	69%	0.691	S	S	*	*			trans	-80.7	0	162.2	-77.4	-173.8	178.6	-178.6	-0.8	109.6	S63	S63-R65 PolarHBondContact O-N 3.43Å; S63-R65 VanDerWaalsContact O-N 3.16Å

Retrieved 65 of 65 residues in 102.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).