A0A077Z4F9_TRITR Loading...

DnaJ homolog subfamily C member 21

Probable component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity.

AlphaFold DB , UniProt , Accession A0A077Z4F9, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 59 aa.

						>A0A077Z4F9_TRITR|A0A077Z4F9
MTRREAFLILGVSPSASKLRVREAHKRVMLLNHPDRGGSPYIAAKINEAKDFLDKSNTR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	87.6	Confident	96.1	Very high	55 Å²	55	69.9 Å²	69.9	27%	0.271	35%	0.349	S	S	.	.				0	128.3	0	-166.8	59.5	65.5	0	0	111.1	E5 A6 I9 E48 A49 F52	M1-E5 WeakPolarHBondContact CA-OE2 3.09Å; M1-E5 HydrophobicContact SD-CB 3.93Å; M1-E5 VanDerWaalsContact SD-CD 3.51Å; M1-E5 HydrophobicContact SD-CG 3.64Å; M1-A6 HydrophobicContact CG-CB 4.06Å; M1-A6 HydrophobicContact SD-CB 3.89Å; M1-I9 HydrophobicContact CE-CD1 3.6Å; M1-I9 HydrophobicContact SD-CD1 3.88Å; M1-E48 HydrophobicContact CB-CG 4.46Å; M1-E48 HydrophobicContact CE-CB 3.91Å; M1-E48 HydrophobicContact CE-CG 3.66Å; M1-A49 HydrophobicContact CE-CB 4.19Å; M1-A49 HydrophobicContact SD-CB 4.46Å; M1-F52 HydrophobicContact CB-CB 4.48Å; M1-F52 HydrophobicContact CB-CD2 3.76Å; M1-F52 HydrophobicContact CB-CE2 4.23Å; M1-F52 HydrophobicContact CB-CG 4.15Å; M1-F52 HydrophobicContact CG-CB 3.78Å; M1-F52 HydrophobicContact CG-CD1 4.11Å; M1-F52 HydrophobicContact CG-CD2 3.75Å; M1-F52 HydrophobicContact CG-CE2 4.38Å; M1-F52 HydrophobicContact CG-CG 3.59Å; M1-F52 WeakPolarHBondContact O-CE2 3.37Å
2	T	94.6	Very high	96.3	Very high	81 Å²	81	65.5 Å²	65.5	50%	0.497	33%	0.329	S	S	.	.			trans	-104.2	161.5	165.1	68.8	0	0	0	0	111.1	R4 E5 A6	T2-R4 VanDerWaalsContact C-N 3.28Å; T2-R4 PolarHBondContact O-N 3.25Å; T2-E5 PolarHBondContact N-OE2 3.26Å; T2-E5 PolarHBondContact O-N 3.3Å; T2-E5 WeakPolarHBondContact OG1-CB 2.99Å; T2-E5 PolarHBondContact OG1-N 3.31Å; T2-E5 VanDerWaalsContact OG1-N 3.08Å; T2-A6 PolarHBondContact O-N 3.16Å
3	R	93.4	Very high	96.3	Very high	124 Å²	124	64.9 Å²	64.9	47%	0.468	34%	0.335	S	S	.	.	H	α-helix	trans	-57.3	-42.6	175.4	-176.1	177.6	-79.4	-138.8	2.3	111.6	A6 F7 F52 L53 S56	R3-A6 PolarHBondContact O-N 2.82Å; R3-F7 HydrophobicContact CG-CD2 3.82Å; R3-F7 HydrophobicContact CG-CE2 3.47Å; R3-F7 VanDerWaalsContact CG-CE2 3.47Å; R3-F7 WeakPolarHBondContact O-CD2 3.34Å; R3-F7 PolarHBondContact O-N 3.41Å; R3-F7 VanDerWaalsContact O-N 3.16Å; R3-F52 HydrophobicContact CB-CE1 3.93Å; R3-L53 HydrophobicContact CG-CD2 4.29Å; R3-S56 PolarHBondContact NH2-O 3.29Å; R3-S56 PolarHBondContact NH2-OG 3.03Å
4	R	95.4	Very high	96.2	Very high	198 Å²	198	67.4 Å²	67.4	75%	0.747	36%	0.357	S	S	*	.	H	α-helix	trans	-62.6	-47	176.8	-178.6	177.5	177	177	-1.1	111.7	T2 A6 F7 L8	T2-R4 VanDerWaalsContact C-N 3.28Å; T2-R4 PolarHBondContact O-N 3.25Å; R4-A6 VanDerWaalsContact C-N 3.34Å; R4-A6 PolarHBondContact O-N 3.03Å; R4-F7 PolarHBondContact O-N 2.94Å; R4-L8 HydrophobicContact CG-CD1 4.15Å; R4-L8 WeakPolarHBondContact O-CG 3.31Å; R4-L8 PolarHBondContact O-N 3.43Å
5	E	97.6	Very high	96.1	Very high	70 Å²	70	69.9 Å²	69.9	33%	0.327	38%	0.382	S	S	.	.	H	α-helix	trans	-58.9	-44.9	177.6	-176.5	-171	-180	0	0	111.5	M1 T2 F7 L8 I9	M1-E5 WeakPolarHBondContact CA-OE2 3.09Å; M1-E5 HydrophobicContact SD-CB 3.93Å; M1-E5 VanDerWaalsContact SD-CD 3.51Å; M1-E5 HydrophobicContact SD-CG 3.64Å; T2-E5 PolarHBondContact N-OE2 3.26Å; T2-E5 PolarHBondContact O-N 3.3Å; T2-E5 WeakPolarHBondContact OG1-CB 2.99Å; T2-E5 PolarHBondContact OG1-N 3.31Å; T2-E5 VanDerWaalsContact OG1-N 3.08Å; E5-F7 PolarHBondContact O-N 2.95Å; E5-L8 PolarHBondContact O-N 3.35Å; E5-L8 VanDerWaalsContact O-N 3.15Å; E5-I9 HydrophobicContact CG-CD1 3.93Å; E5-I9 WeakPolarHBondContact O-CG1 3.45Å; E5-I9 PolarHBondContact O-N 3.47Å
6	A	98.1	Very high	96	Very high	0 Å²	0	66.7 Å²	66.7	0%	0	37%	0.368	C	S	.	.	H	α-helix	trans	-62.3	-42.4	179.3	0	0	0	0	0	112.6	M1 T2 R3 R4 L8 I9 L10 A49 F52 L53	M1-A6 HydrophobicContact CG-CB 4.06Å; M1-A6 HydrophobicContact SD-CB 3.89Å; T2-A6 PolarHBondContact O-N 3.16Å; R3-A6 PolarHBondContact O-N 2.82Å; R4-A6 VanDerWaalsContact C-N 3.34Å; R4-A6 PolarHBondContact O-N 3.03Å; A6-L8 VanDerWaalsContact C-N 3.33Å; A6-L8 PolarHBondContact O-N 3.16Å; A6-I9 PolarHBondContact O-N 3.44Å; A6-L10 PolarHBondContact O-N 2.94Å; A6-L10 VanDerWaalsContact O-N 3.17Å; A6-A49 HydrophobicContact CB-CB 3.99Å; A6-F52 HydrophobicContact CB-CD1 4.06Å; A6-L53 HydrophobicContact CB-CD1 4.03Å; A6-L53 HydrophobicContact CB-CD2 3.98Å; A6-L53 HydrophobicContact CB-CG 3.72Å
7	F	97.7	Very high	95.9	Very high	14 Å²	14	66.9 Å²	66.9	6%	0.061	38%	0.375	C	S	.	.	H	α-helix	trans	-62.4	-39.4	174.2	-79.5	-58.7	0	0	0	112.5	R3 R4 E5 G11 V12 S13 P14 V21 L53	R3-F7 HydrophobicContact CG-CD2 3.82Å; R3-F7 HydrophobicContact CG-CE2 3.47Å; R3-F7 VanDerWaalsContact CG-CE2 3.47Å; R3-F7 WeakPolarHBondContact O-CD2 3.34Å; R3-F7 PolarHBondContact O-N 3.41Å; R3-F7 VanDerWaalsContact O-N 3.16Å; R4-F7 PolarHBondContact O-N 2.94Å; E5-F7 PolarHBondContact O-N 2.95Å; F7-G11 PolarHBondContact O-N 3.08Å; F7-V12 WeakPolarHBondContact CB-O 3.21Å; F7-V12 HydrophobicContact CD1-CG2 3.68Å; F7-V12 HydrophobicContact CE1-CG2 4.3Å; F7-V12 PolarHBondContact O-N 3.04Å; F7-S13 VanDerWaalsContact CD1-O 3.31Å; F7-S13 WeakPolarHBondContact CD1-O 3.07Å; F7-S13 VanDerWaalsContact CE1-O 3.3Å; F7-S13 WeakPolarHBondContact CE1-O 3.3Å; F7-P14 HydrophobicContact CD2-CB 3.97Å; F7-P14 HydrophobicContact CD2-CG 4.23Å; F7-P14 VanDerWaalsContact CE2-CA 3.5Å; F7-P14 HydrophobicContact CE2-CB 3.97Å; F7-P14 HydrophobicContact CG-CB 4.48Å; F7-P14 HydrophobicContact CG-CG 4.47Å; F7-P14 HydrophobicContact CZ-CB 4.49Å; F7-P14 VanDerWaalsContact CZ-O 3.3Å; F7-P14 WeakPolarHBondContact CZ-O 3.3Å; F7-V21 HydrophobicContact CE1-CG2 4.48Å; F7-L53 HydrophobicContact CD1-CD1 4.01Å; F7-L53 HydrophobicContact CD1-CD2 4.23Å; F7-L53 HydrophobicContact CD2-CD2 4.04Å; F7-L53 HydrophobicContact CE1-CD1 4.03Å; F7-L53 HydrophobicContact CE1-CD2 3.9Å; F7-L53 HydrophobicContact CE2-CD2 3.7Å; F7-L53 HydrophobicContact CG-CD2 4.29Å; F7-L53 HydrophobicContact CZ-CD2 3.61Å
8	L	98.2	Very high	95.8	Very high	122 Å²	122	68.2 Å²	68.2	64%	0.639	38%	0.376	S	S	*	.	H	α-helix	trans	-67	-44.2	176.7	-71.2	172.3	0	0	0	112.2	R4 E5 A6 L10 G11	R4-L8 HydrophobicContact CG-CD1 4.15Å; R4-L8 WeakPolarHBondContact O-CG 3.31Å; R4-L8 PolarHBondContact O-N 3.43Å; E5-L8 PolarHBondContact O-N 3.35Å; E5-L8 VanDerWaalsContact O-N 3.15Å; A6-L8 VanDerWaalsContact C-N 3.33Å; A6-L8 PolarHBondContact O-N 3.16Å; L8-L10 VanDerWaalsContact C-N 3.29Å; L8-L10 PolarHBondContact O-N 3.23Å; L8-G11 PolarHBondContact O-N 3.43Å
9	I	98.4	Very high	95.8	Very high	48 Å²	48	70.7 Å²	70.7	25%	0.246	39%	0.388	C	S	.	.	H	α-helix	trans	-59	-41.6	177.9	-71.6	167.6	0	0	0	111.1	M1 E5 A6 G11 I46 A49	M1-I9 HydrophobicContact CE-CD1 3.6Å; M1-I9 HydrophobicContact SD-CD1 3.88Å; E5-I9 HydrophobicContact CG-CD1 3.93Å; E5-I9 WeakPolarHBondContact O-CG1 3.45Å; E5-I9 PolarHBondContact O-N 3.47Å; A6-I9 PolarHBondContact O-N 3.44Å; I9-G11 VanDerWaalsContact C-N 3.32Å; I9-I46 HydrophobicContact CG2-CG1 4.13Å; I9-A49 HydrophobicContact CB-CB 3.82Å; I9-A49 HydrophobicContact CD1-CB 4.08Å; I9-A49 HydrophobicContact CG2-CB 3.65Å
10	L	98.3	Very high	95.8	Very high	0 Å²	0	75.4 Å²	75.4	0%	0	40%	0.4	C	S	.	.	H	α-helix	trans	-82.9	-8.9	178.1	-60.6	-173.5	0	0	0	113.5	A6 L8 V12 V21 A24 H25 I46 A49 K50 L53	A6-L10 PolarHBondContact O-N 2.94Å; A6-L10 VanDerWaalsContact O-N 3.17Å; L8-L10 VanDerWaalsContact C-N 3.29Å; L8-L10 PolarHBondContact O-N 3.23Å; L10-V12 HydrophobicContact CB-CG2 3.9Å; L10-V21 HydrophobicContact CD1-CG1 3.75Å; L10-A24 HydrophobicContact CB-CB 4.42Å; L10-H25 HydrophobicContact CD2-CB 4.23Å; L10-I46 HydrophobicContact CD2-CG2 4.01Å; L10-A49 HydrophobicContact CD2-CB 4.32Å; L10-A49 HydrophobicContact CG-CB 4.16Å; L10-K50 HydrophobicContact CD1-CB 4.31Å; L10-L53 HydrophobicContact CD1-CD1 3.75Å
11	G	98	Very high	95.9	Very high	57 Å²	57	72.2 Å²	72.2	59%	0.588	38%	0.383	S	S	*	.	T	Hydrogen-bonded Turn	trans	62.6	40.2	-177.4	0	0	0	0	0	113.1	F7 L8 I9	F7-G11 PolarHBondContact O-N 3.08Å; L8-G11 PolarHBondContact O-N 3.43Å; I9-G11 VanDerWaalsContact C-N 3.32Å
12	V	97.8	Very high	96.4	Very high	17 Å²	17	75.6 Å²	75.6	10%	0.103	39%	0.393	C	S	.	.			trans	-125.2	150.7	-179.9	-68.3	0	0	0	0	112.3	F7 L10 A16 R20 V21 A24	F7-V12 WeakPolarHBondContact CB-O 3.21Å; F7-V12 HydrophobicContact CD1-CG2 3.68Å; F7-V12 HydrophobicContact CE1-CG2 4.3Å; F7-V12 PolarHBondContact O-N 3.04Å; L10-V12 HydrophobicContact CB-CG2 3.9Å; V12-A16 HydrophobicContact CB-CB 3.97Å; V12-A16 HydrophobicContact CG2-CB 4.28Å; V12-R20 HydrophobicContact CG1-CG 4.25Å; V12-V21 HydrophobicContact CG2-CG2 4.24Å; V12-A24 HydrophobicContact CG1-CB 3.33Å
13	S	96.9	Very high	96.6	Very high	58 Å²	58	76.2 Å²	76.2	41%	0.406	39%	0.39	S	S	.	.			trans	-60.8	147	176.3	175.9	0	0	0	0	111.4	F7 S15 A16	F7-S13 VanDerWaalsContact CD1-O 3.31Å; F7-S13 WeakPolarHBondContact CD1-O 3.07Å; F7-S13 VanDerWaalsContact CE1-O 3.3Å; F7-S13 WeakPolarHBondContact CE1-O 3.3Å; S13-S15 PolarHBondContact O-N 3.34Å; S13-S15 PolarHBondContact OG-N 2.88Å; S13-S15 PolarHBondContact OG-OG 2.83Å; S13-A16 WeakPolarHBondContact O-CB 3.09Å; S13-A16 PolarHBondContact O-N 3.22Å
14	P	94.9	Very high	96.8	Very high	99 Å²	99	70.6 Å²	70.6	64%	0.643	37%	0.371	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56	-20.4	169.6	-26	35.4	0	0	0	115.3	F7	F7-P14 HydrophobicContact CD2-CB 3.97Å; F7-P14 HydrophobicContact CD2-CG 4.23Å; F7-P14 VanDerWaalsContact CE2-CA 3.5Å; F7-P14 HydrophobicContact CE2-CB 3.97Å; F7-P14 HydrophobicContact CG-CB 4.48Å; F7-P14 HydrophobicContact CG-CG 4.47Å; F7-P14 HydrophobicContact CZ-CB 4.49Å; F7-P14 VanDerWaalsContact CZ-O 3.3Å; F7-P14 WeakPolarHBondContact CZ-O 3.3Å
15	S	94.1	Very high	97	Very high	106 Å²	106	62.7 Å²	62.7	74%	0.741	34%	0.342	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.8	6.7	174.9	60.4	0	0	0	0	114	S13	S13-S15 PolarHBondContact O-N 3.34Å; S13-S15 PolarHBondContact OG-N 2.88Å; S13-S15 PolarHBondContact OG-OG 2.83Å
16	A	94.5	Very high	97	Very high	18 Å²	18	65.2 Å²	65.2	15%	0.149	35%	0.352	C	S	.	.			trans	-63.3	138.5	-177.7	0	0	0	0	0	111.8	V12 S13 R20 V21	V12-A16 HydrophobicContact CB-CB 3.97Å; V12-A16 HydrophobicContact CG2-CB 4.28Å; S13-A16 WeakPolarHBondContact O-CB 3.09Å; S13-A16 PolarHBondContact O-N 3.22Å; A16-R20 HydrophobicContact CB-CB 4.24Å; A16-R20 HydrophobicContact CB-CG 4.27Å; A16-V21 HydrophobicContact CB-CG2 4.29Å
17	S	94.5	Very high	97	Very high	70 Å²	70	72 Å²	72	49%	0.49	38%	0.377	S	S	.	.			trans	-66.4	157.7	173.1	68	0	0	0	0	111.4	L19 R20 V21	S17-L19 PolarHBondContact O-N 3.06Å; S17-R20 WeakPolarHBondContact O-CB 3.41Å; S17-R20 PolarHBondContact O-N 3.11Å; S17-R20 PolarHBondContact OG-N 3.4Å; S17-V21 PolarHBondContact O-N 3.47Å
18	K	94.2	Very high	97.1	Very high	91 Å²	91	72.3 Å²	72.3	40%	0.396	38%	0.381	S	S	.	.	H	α-helix	trans	-52.9	-39.6	174.8	-65.9	-173.2	-179.3	-171.5	0	112.3	V21 R22 N57	K18-V21 PolarHBondContact O-N 2.93Å; K18-R22 WeakPolarHBondContact O-CG 3.29Å; K18-R22 PolarHBondContact O-N 3.18Å; K18-R22 VanDerWaalsContact O-N 3.1Å; K18-N57 WeakPolarHBondContact CE-ND2 3.47Å; K18-N57 PolarHBondContact NZ-O 3.19Å
19	L	95.9	Very high	97.1	Very high	116 Å²	116	67.7 Å²	67.7	61%	0.607	36%	0.356	S	S	*	.	H	α-helix	trans	-60.5	-47.3	176.4	179.6	61.3	0	0	0	111	S17 V21 R22 E23	S17-L19 PolarHBondContact O-N 3.06Å; L19-V21 VanDerWaalsContact C-N 3.32Å; L19-V21 PolarHBondContact O-N 3.07Å; L19-R22 PolarHBondContact O-N 2.96Å; L19-E23 HydrophobicContact CD1-CG 4.35Å; L19-E23 WeakPolarHBondContact O-CG 3.44Å; L19-E23 PolarHBondContact O-N 3.37Å
20	R	96.6	Very high	97.1	Very high	164 Å²	164	70.2 Å²	70.2	62%	0.619	37%	0.369	S	S	*	.	H	α-helix	trans	-64.1	-36.1	179.2	-171.9	169.1	-172.3	149.1	1.4	112.5	V12 A16 S17 A24	V12-R20 HydrophobicContact CG1-CG 4.25Å; A16-R20 HydrophobicContact CB-CB 4.24Å; A16-R20 HydrophobicContact CB-CG 4.27Å; S17-R20 WeakPolarHBondContact O-CB 3.41Å; S17-R20 PolarHBondContact O-N 3.11Å; S17-R20 PolarHBondContact OG-N 3.4Å; R20-A24 VanDerWaalsContact O-CB 3.26Å; R20-A24 WeakPolarHBondContact O-CB 3.49Å; R20-A24 PolarHBondContact O-N 3.43Å
21	V	97.2	Very high	97	Very high	8 Å²	8	76 Å²	76	5%	0.048	40%	0.4	C	S	.	.	H	α-helix	trans	-62	-45.4	174	169.4	0	0	0	0	111.2	F7 L10 V12 A16 S17 K18 L19 A24 H25 L53	F7-V21 HydrophobicContact CE1-CG2 4.48Å; L10-V21 HydrophobicContact CD1-CG1 3.75Å; V12-V21 HydrophobicContact CG2-CG2 4.24Å; A16-V21 HydrophobicContact CB-CG2 4.29Å; S17-V21 PolarHBondContact O-N 3.47Å; K18-V21 PolarHBondContact O-N 2.93Å; L19-V21 VanDerWaalsContact C-N 3.32Å; L19-V21 PolarHBondContact O-N 3.07Å; V21-A24 PolarHBondContact O-N 3.05Å; V21-H25 WeakPolarHBondContact O-CB 3.35Å; V21-H25 PolarHBondContact O-N 3.01Å; V21-L53 HydrophobicContact CG1-CB 4.31Å; V21-L53 HydrophobicContact CG1-CD1 4.05Å; V21-L53 HydrophobicContact CG2-CD1 4.32Å
22	R	97.8	Very high	97.1	Very high	126 Å²	126	75.8 Å²	75.8	48%	0.475	39%	0.385	S	S	.	.	H	α-helix	trans	-65.1	-43.3	178.5	-69.1	175.1	-172.7	166.1	-0.1	112.6	K18 L19 H25 K26	K18-R22 WeakPolarHBondContact O-CG 3.29Å; K18-R22 PolarHBondContact O-N 3.18Å; K18-R22 VanDerWaalsContact O-N 3.1Å; L19-R22 PolarHBondContact O-N 2.96Å; R22-H25 PolarHBondContact O-N 3Å; R22-K26 WeakPolarHBondContact O-CG 3.23Å; R22-K26 PolarHBondContact O-N 3.49Å
23	E	98.4	Very high	97.1	Very high	94 Å²	94	78 Å²	78	44%	0.439	39%	0.394	S	S	.	.	H	α-helix	trans	-66.7	-39.4	178	-68	-53.4	119.4	0	0	111.8	L19 K26 R27	L19-E23 HydrophobicContact CD1-CG 4.35Å; L19-E23 WeakPolarHBondContact O-CG 3.44Å; L19-E23 PolarHBondContact O-N 3.37Å; E23-K26 PolarHBondContact O-N 3.17Å; E23-K26 IonicContact OE1-NZ 3.62Å; E23-K26 PolarHBondContact OE1-NZ 2.88Å; E23-R27 WeakPolarHBondContact O-CB 3.5Å; E23-R27 PolarHBondContact O-N 2.79Å
24	A	98.5	Very high	97.1	Very high	7 Å²	7	77.3 Å²	77.3	6%	0.058	39%	0.388	C	S	.	.	H	α-helix	trans	-64	-43.2	173.2	0	0	0	0	0	112.3	L10 V12 R20 V21 R27 V28	L10-A24 HydrophobicContact CB-CB 4.42Å; V12-A24 HydrophobicContact CG1-CB 3.33Å; R20-A24 VanDerWaalsContact O-CB 3.26Å; R20-A24 WeakPolarHBondContact O-CB 3.49Å; R20-A24 PolarHBondContact O-N 3.43Å; V21-A24 PolarHBondContact O-N 3.05Å; A24-R27 PolarHBondContact O-N 3.15Å; A24-V28 WeakPolarHBondContact O-CB 3.35Å; A24-V28 VanDerWaalsContact O-CG2 3.29Å; A24-V28 WeakPolarHBondContact O-CG2 3.37Å; A24-V28 PolarHBondContact O-N 3.48Å
25	H	98.7	Very high	97.3	Very high	32 Å²	32	79.3 Å²	79.3	15%	0.148	39%	0.394	C	S	.	.	H	α-helix	trans	-57	-52	174.4	170.6	-100.9	0	0	0	111.6	L10 V21 R22 R27 V28 M29 N47 K50	L10-H25 HydrophobicContact CD2-CB 4.23Å; V21-H25 WeakPolarHBondContact O-CB 3.35Å; V21-H25 PolarHBondContact O-N 3.01Å; R22-H25 PolarHBondContact O-N 3Å; H25-R27 VanDerWaalsContact C-N 3.34Å; H25-R27 PolarHBondContact O-N 2.98Å; H25-V28 PolarHBondContact O-N 3.4Å; H25-M29 WeakPolarHBondContact O-CB 3.43Å; H25-M29 PolarHBondContact O-N 3.33Å; H25-N47 PolarHBondContact NE2-OD1 3.21Å; H25-K50 HydrophobicContact CB-CB 4.13Å; H25-K50 HydrophobicContact CB-CG 3.95Å; H25-K50 WeakPolarHBondContact CD2-CB 3.46Å
26	K	98.7	Very high	97.4	Very high	122 Å²	122	82.6 Å²	82.6	53%	0.53	39%	0.39	S	S	.	.	H	α-helix	trans	-56.5	-47.4	177.3	-70.5	174.3	-172.9	166.3	0	112	R22 E23 L30	R22-K26 WeakPolarHBondContact O-CG 3.23Å; R22-K26 PolarHBondContact O-N 3.49Å; E23-K26 PolarHBondContact O-N 3.17Å; E23-K26 IonicContact OE1-NZ 3.62Å; E23-K26 PolarHBondContact OE1-NZ 2.88Å; K26-L30 VanDerWaalsContact O-CB 3.31Å; K26-L30 WeakPolarHBondContact O-CB 3.42Å; K26-L30 PolarHBondContact O-N 3.2Å
27	R	98.5	Very high	97.5	Very high	143 Å²	143	85.4 Å²	85.4	54%	0.54	42%	0.42	S	S	.	.	H	α-helix	trans	-62.4	-51.3	-178.8	-177.2	-177.4	66.5	94.9	2.7	111.8	E23 A24 H25 L30 L31	E23-R27 WeakPolarHBondContact O-CB 3.5Å; E23-R27 PolarHBondContact O-N 2.79Å; A24-R27 PolarHBondContact O-N 3.15Å; H25-R27 VanDerWaalsContact C-N 3.34Å; H25-R27 PolarHBondContact O-N 2.98Å; R27-L30 PolarHBondContact O-N 3.44Å; R27-L31 WeakPolarHBondContact O-CG 3.43Å; R27-L31 PolarHBondContact O-N 3.02Å
28	V	98.4	Very high	97.7	Very high	21 Å²	21	83 Å²	83	13%	0.127	41%	0.407	C	S	.	.	H	α-helix	trans	-69.9	-37.8	-177.2	178.6	0	0	0	0	110.4	A24 H25 L31 N32 I46	A24-V28 WeakPolarHBondContact O-CB 3.35Å; A24-V28 VanDerWaalsContact O-CG2 3.29Å; A24-V28 WeakPolarHBondContact O-CG2 3.37Å; A24-V28 PolarHBondContact O-N 3.48Å; H25-V28 PolarHBondContact O-N 3.4Å; V28-L31 PolarHBondContact O-N 3.36Å; V28-N32 PolarHBondContact O-N 2.99Å; V28-N32 VanDerWaalsContact O-N 3.15Å; V28-N32 PolarHBondContact O-ND2 2.9Å; V28-I46 HydrophobicContact CG1-CD1 3.68Å; V28-I46 HydrophobicContact CG1-CG1 3.91Å
29	M	98.6	Very high	97.8	Very high	24 Å²	24	81.1 Å²	81.1	12%	0.118	41%	0.405	C	S	.	.	H	α-helix	trans	-61.8	-48.1	174.4	179.9	57.8	76.2	0	0	111.4	H25 L31 N32 H33 A43 I46 N47	H25-M29 WeakPolarHBondContact O-CB 3.43Å; H25-M29 PolarHBondContact O-N 3.33Å; M29-L31 PolarHBondContact O-N 3.32Å; M29-N32 CarbonylContact O-C 3.39Å; M29-N32 PolarHBondContact O-N 2.87Å; M29-H33 WeakPolarHBondContact O-CA 3.38Å; M29-H33 WeakPolarHBondContact O-CB 3.48Å; M29-H33 PolarHBondContact O-N 3.22Å; M29-A43 HydrophobicContact CE-CB 4.2Å; M29-A43 WeakPolarHBondContact CE-O 3.41Å; M29-A43 HydrophobicContact SD-CB 3.84Å; M29-I46 HydrophobicContact CB-CG2 4.22Å; M29-I46 HydrophobicContact CE-CB 4.07Å; M29-I46 HydrophobicContact CE-CG2 3.91Å; M29-N47 WeakPolarHBondContact CE-ND2 3.47Å; M29-N47 WeakPolarHBondContact CE-OD1 3.42Å
30	L	98.2	Very high	97.9	Very high	102 Å²	102	79.9 Å²	79.9	53%	0.534	40%	0.404	S	S	.	.	H	α-helix	trans	-59	-36	179.6	-178.6	64.5	0	0	0	112.3	K26 R27 N32 R36	K26-L30 VanDerWaalsContact O-CB 3.31Å; K26-L30 WeakPolarHBondContact O-CB 3.42Å; K26-L30 PolarHBondContact O-N 3.2Å; R27-L30 PolarHBondContact O-N 3.44Å; L30-N32 VanDerWaalsContact C-N 3.35Å; L30-R36 VanDerWaalsContact O-CD 3.26Å; L30-R36 WeakPolarHBondContact O-CD 3.43Å; L30-R36 PolarHBondContact O-NE 3.47Å
31	L	97.5	Very high	98	Very high	122 Å²	122	79.3 Å²	79.3	64%	0.639	40%	0.403	S	S	*	.	H	α-helix	trans	-72.8	-26.5	176.8	-69.7	170.7	0	0	0	113.4	R27 V28 M29	R27-L31 WeakPolarHBondContact O-CG 3.43Å; R27-L31 PolarHBondContact O-N 3.02Å; V28-L31 PolarHBondContact O-N 3.36Å; M29-L31 PolarHBondContact O-N 3.32Å
32	N	98.1	Very high	98.1	Very high	52 Å²	52	82.1 Å²	82.1	28%	0.278	42%	0.417	S	S	.	.	H	α-helix	trans	-114.6	13.8	-174.7	-66.4	-85.6	0	0	0	112.9	V28 M29 L30 G38 I42 I46	V28-N32 PolarHBondContact O-N 2.99Å; V28-N32 VanDerWaalsContact O-N 3.15Å; V28-N32 PolarHBondContact O-ND2 2.9Å; M29-N32 CarbonylContact O-C 3.39Å; M29-N32 PolarHBondContact O-N 2.87Å; L30-N32 VanDerWaalsContact C-N 3.35Å; N32-G38 WeakPolarHBondContact O-CA 3.33Å; N32-I42 HydrophobicContact CB-CG2 3.9Å; N32-I46 HydrophobicContact CB-CD1 3.64Å
33	H	98.2	Very high	98.1	Very high	63 Å²	63	76.5 Å²	76.5	29%	0.292	40%	0.398	S	S	.	.			trans	-66.9	136.5	-176.1	-165.6	-90.5	0	0	0	110.3	M29 D35 R36 G38	M29-H33 WeakPolarHBondContact O-CA 3.38Å; M29-H33 WeakPolarHBondContact O-CB 3.48Å; M29-H33 PolarHBondContact O-N 3.22Å; H33-D35 VanDerWaalsContact C-N 3.29Å; H33-D35 IonicContact CE1-OD1 3.19Å; H33-D35 IonicContact CE1-OD2 3.62Å; H33-D35 PolarHBondContact CE1-OD2 3.1Å; H33-D35 WeakPolarHBondContact ND1-CB 2.95Å; H33-D35 PolarHBondContact ND1-N 2.99Å; H33-D35 IonicContact ND1-OD1 2.82Å; H33-D35 IonicContact ND1-OD2 2.67Å; H33-D35 PolarHBondContact O-N 3.37Å; H33-R36 HydrophobicContact CB-CB 4.46Å; H33-R36 HydrophobicContact CB-CG 4.31Å; H33-R36 WeakPolarHBondContact O-CA 3.41Å; H33-R36 PolarHBondContact O-N 3.1Å; H33-G38 WeakPolarHBondContact O-CA 3.47Å; H33-G38 PolarHBondContact O-N 3.23Å
34	P	98.4	Very high	98.1	Very high	43 Å²	43	74.6 Å²	74.6	28%	0.279	40%	0.398	S	S	.	.	G	3₁₀ helix	trans	-53.5	-43.1	-179.4	-29.9	38.7	0	0	0	113.8	R36 G37 G38 P40 A43	P34-R36 PolarHBondContact O-N 2.67Å; P34-G37 PolarHBondContact O-N 2.95Å; P34-G38 WeakPolarHBondContact CA-O 3.47Å; P34-P40 HydrophobicContact CB-CG 4.16Å; P34-P40 HydrophobicContact CG-CB 4.31Å; P34-P40 HydrophobicContact CG-CG 4.12Å; P34-A43 HydrophobicContact CG-CB 4.13Å
35	D	98	Very high	98.1	Very high	142 Å²	142	76.9 Å²	76.9	76%	0.759	41%	0.407	S	S	*	.	G	3₁₀ helix	trans	-64.9	-11.7	178.7	-53.6	-2.1	0	0	0	113.9	H33	H33-D35 VanDerWaalsContact C-N 3.29Å; H33-D35 IonicContact CE1-OD1 3.19Å; H33-D35 IonicContact CE1-OD2 3.62Å; H33-D35 PolarHBondContact CE1-OD2 3.1Å; H33-D35 WeakPolarHBondContact ND1-CB 2.95Å; H33-D35 PolarHBondContact ND1-N 2.99Å; H33-D35 IonicContact ND1-OD1 2.82Å; H33-D35 IonicContact ND1-OD2 2.67Å; H33-D35 PolarHBondContact O-N 3.37Å
36	R	96.6	Very high	98.1	Very high	174 Å²	174	75.5 Å²	75.5	66%	0.657	40%	0.401	S	S	*	.	G	3₁₀ helix	trans	-108.2	20.5	178	-59.3	178.9	67.8	83.4	2.6	111.8	L30 H33 P34 G38	L30-R36 VanDerWaalsContact O-CD 3.26Å; L30-R36 WeakPolarHBondContact O-CD 3.43Å; L30-R36 PolarHBondContact O-NE 3.47Å; H33-R36 HydrophobicContact CB-CB 4.46Å; H33-R36 HydrophobicContact CB-CG 4.31Å; H33-R36 WeakPolarHBondContact O-CA 3.41Å; H33-R36 PolarHBondContact O-N 3.1Å; P34-R36 PolarHBondContact O-N 2.67Å; R36-G38 VanDerWaalsContact C-N 3.31Å
37	G	96.7	Very high	98.1	Very high	77 Å²	77	72.9 Å²	72.9	79%	0.794	39%	0.392	S	S	*	.	T	Hydrogen-bonded Turn	trans	80.4	10	-176.8	0	0	0	0	0	113.9	P34	P34-G37 PolarHBondContact O-N 2.95Å
38	G	97.5	Very high	98.1	Very high	21 Å²	21	69.6 Å²	69.6	22%	0.216	38%	0.383	C	S	.	.			trans	-75.1	170	173.1	0	0	0	0	0	112.7	N32 H33 P34 R36	N32-G38 WeakPolarHBondContact O-CA 3.33Å; H33-G38 WeakPolarHBondContact O-CA 3.47Å; H33-G38 PolarHBondContact O-N 3.23Å; P34-G38 WeakPolarHBondContact CA-O 3.47Å; R36-G38 VanDerWaalsContact C-N 3.31Å
39	S	97.9	Very high	98.1	Very high	50 Å²	50	68.6 Å²	68.6	35%	0.35	38%	0.377	S	S	.	.			trans	-91.2	130.5	177.9	171.9	0	0	0	0	110.9	Y41 I42 A43	S39-Y41 PolarHBondContact O-N 3.41Å; S39-Y41 PolarHBondContact OG-N 3.42Å; S39-I42 PolarHBondContact O-N 2.88Å; S39-A43 PolarHBondContact O-N 3.13Å
40	P	98.3	Very high	98.1	Very high	91 Å²	91	69.7 Å²	69.7	59%	0.591	38%	0.381	S	S	*	.	H	α-helix	trans	-52.7	-36.2	170.8	-26.8	34.2	0	0	0	113	P34 A44	P34-P40 HydrophobicContact CB-CG 4.16Å; P34-P40 HydrophobicContact CG-CB 4.31Å; P34-P40 HydrophobicContact CG-CG 4.12Å; P40-A44 WeakPolarHBondContact O-CB 3.26Å; P40-A44 PolarHBondContact O-N 2.96Å
41	Y	98.4	Very high	98	Very high	151 Å²	151	68.3 Å²	68.3	59%	0.592	37%	0.374	S	S	*	.	H	α-helix	trans	-65.1	-43.9	176.7	174.7	-103.9	0	0	0	112.1	S39 A44 K45	S39-Y41 PolarHBondContact O-N 3.41Å; S39-Y41 PolarHBondContact OG-N 3.42Å; Y41-A44 PolarHBondContact O-N 3.35Å; Y41-K45 HydrophobicContact CE1-CG 4.22Å; Y41-K45 HydrophobicContact CE2-CG 4.35Å; Y41-K45 WeakPolarHBondContact O-CG 3.35Å; Y41-K45 PolarHBondContact O-N 2.89Å; Y41-K45 WeakPolarHBondContact OH-CE 3Å
42	I	98.2	Very high	98	Very high	68 Å²	68	65.9 Å²	65.9	35%	0.349	36%	0.359	S	S	.	.	H	α-helix	trans	-67.5	-43.4	178.2	-61.3	-63.1	0	0	0	110.8	N32 S39 A44 K45 I46	N32-I42 HydrophobicContact CB-CG2 3.9Å; S39-I42 PolarHBondContact O-N 2.88Å; I42-A44 VanDerWaalsContact C-N 3.32Å; I42-A44 PolarHBondContact O-N 3.34Å; I42-K45 WeakPolarHBondContact O-CB 3.33Å; I42-K45 PolarHBondContact O-N 3.43Å; I42-K45 VanDerWaalsContact O-N 3.13Å; I42-I46 HydrophobicContact CG2-CD1 3.91Å; I42-I46 WeakPolarHBondContact O-CD1 3.29Å; I42-I46 WeakPolarHBondContact O-CG1 3.41Å; I42-I46 PolarHBondContact O-N 2.91Å
43	A	98.7	Very high	97.9	Very high	7 Å²	7	63.8 Å²	63.8	6%	0.058	35%	0.348	C	S	.	.	H	α-helix	trans	-58.4	-44	174	0	0	0	0	0	111.7	M29 P34 S39 K45 I46 N47	M29-A43 HydrophobicContact CE-CB 4.2Å; M29-A43 WeakPolarHBondContact CE-O 3.41Å; M29-A43 HydrophobicContact SD-CB 3.84Å; P34-A43 HydrophobicContact CG-CB 4.13Å; S39-A43 PolarHBondContact O-N 3.13Å; A43-K45 VanDerWaalsContact C-N 3.32Å; A43-K45 PolarHBondContact O-N 3.46Å; A43-I46 PolarHBondContact O-N 2.91Å; A43-N47 PolarHBondContact O-N 2.98Å; A43-N47 PolarHBondContact O-ND2 3.01Å
44	A	98.5	Very high	97.6	Very high	55 Å²	55	62.5 Å²	62.5	46%	0.455	34%	0.343	S	S	.	.	H	α-helix	trans	-59.8	-41.6	174.5	0	0	0	0	0	112	P40 Y41 I42 N47 E48	P40-A44 WeakPolarHBondContact O-CB 3.26Å; P40-A44 PolarHBondContact O-N 2.96Å; Y41-A44 PolarHBondContact O-N 3.35Å; I42-A44 VanDerWaalsContact C-N 3.32Å; I42-A44 PolarHBondContact O-N 3.34Å; A44-N47 PolarHBondContact O-N 2.82Å; A44-E48 WeakPolarHBondContact O-CB 3.38Å; A44-E48 PolarHBondContact O-N 3.03Å
45	K	98.6	Very high	97.2	Very high	54 Å²	54	68.4 Å²	68.4	24%	0.235	36%	0.364	C	S	.	.	H	α-helix	trans	-64.5	-38.3	175.9	-74.1	-73.5	165.8	-160.9	0	113.2	Y41 I42 A43 E48 A49	Y41-K45 HydrophobicContact CE1-CG 4.22Å; Y41-K45 HydrophobicContact CE2-CG 4.35Å; Y41-K45 WeakPolarHBondContact O-CG 3.35Å; Y41-K45 PolarHBondContact O-N 2.89Å; Y41-K45 WeakPolarHBondContact OH-CE 3Å; I42-K45 WeakPolarHBondContact O-CB 3.33Å; I42-K45 PolarHBondContact O-N 3.43Å; I42-K45 VanDerWaalsContact O-N 3.13Å; A43-K45 VanDerWaalsContact C-N 3.32Å; A43-K45 PolarHBondContact O-N 3.46Å; K45-E48 IonicContact NZ-OE2 3.82Å; K45-E48 PolarHBondContact NZ-OE2 3.27Å; K45-E48 PolarHBondContact O-N 3.3Å; K45-A49 WeakPolarHBondContact O-CB 3.42Å; K45-A49 PolarHBondContact O-N 3Å
46	I	98.8	Very high	96.2	Very high	4 Å²	4	63.2 Å²	63.2	2%	0.021	34%	0.339	C	S	.	.	H	α-helix	trans	-64.2	-42.6	175.1	-67.1	157.7	0	0	0	110.7	I9 L10 V28 M29 N32 I42 A43 A49 K50	I9-I46 HydrophobicContact CG2-CG1 4.13Å; L10-I46 HydrophobicContact CD2-CG2 4.01Å; V28-I46 HydrophobicContact CG1-CD1 3.68Å; V28-I46 HydrophobicContact CG1-CG1 3.91Å; M29-I46 HydrophobicContact CB-CG2 4.22Å; M29-I46 HydrophobicContact CE-CB 4.07Å; M29-I46 HydrophobicContact CE-CG2 3.91Å; N32-I46 HydrophobicContact CB-CD1 3.64Å; I42-I46 HydrophobicContact CG2-CD1 3.91Å; I42-I46 WeakPolarHBondContact O-CD1 3.29Å; I42-I46 WeakPolarHBondContact O-CG1 3.41Å; I42-I46 PolarHBondContact O-N 2.91Å; A43-I46 PolarHBondContact O-N 2.91Å; I46-A49 PolarHBondContact O-N 3.18Å; I46-K50 PolarHBondContact O-N 2.84Å; I46-K50 VanDerWaalsContact O-N 3.1Å
47	N	98.5	Very high	94.8	Very high	66 Å²	66	58.4 Å²	58.4	35%	0.353	33%	0.326	S	S	.	.	H	α-helix	trans	-64.4	-46.9	174.9	-74.2	-29.1	0	0	0	112	H25 M29 A43 A44 A49 K50 D51	H25-N47 PolarHBondContact NE2-OD1 3.21Å; M29-N47 WeakPolarHBondContact CE-ND2 3.47Å; M29-N47 WeakPolarHBondContact CE-OD1 3.42Å; A43-N47 PolarHBondContact O-N 2.98Å; A43-N47 PolarHBondContact O-ND2 3.01Å; A44-N47 PolarHBondContact O-N 2.82Å; N47-A49 VanDerWaalsContact C-N 3.28Å; N47-A49 PolarHBondContact O-N 2.95Å; N47-K50 PolarHBondContact O-N 2.81Å; N47-D51 WeakPolarHBondContact O-CB 3.42Å; N47-D51 PolarHBondContact O-N 3.37Å
48	E	98.4	Very high	93	Very high	74 Å²	74	60.2 Å²	60.2	35%	0.346	32%	0.322	S	S	.	.	H	α-helix	trans	-55.7	-43.8	176.8	-169.8	-171.1	167.7	0	0	111.1	M1 A44 K45 F52	M1-E48 HydrophobicContact CB-CG 4.46Å; M1-E48 HydrophobicContact CE-CB 3.91Å; M1-E48 HydrophobicContact CE-CG 3.66Å; A44-E48 WeakPolarHBondContact O-CB 3.38Å; A44-E48 PolarHBondContact O-N 3.03Å; K45-E48 IonicContact NZ-OE2 3.82Å; K45-E48 PolarHBondContact NZ-OE2 3.27Å; K45-E48 PolarHBondContact O-N 3.3Å; E48-F52 VanDerWaalsContact O-CB 3.23Å; E48-F52 WeakPolarHBondContact O-CB 3.42Å; E48-F52 PolarHBondContact O-N 3.26Å
49	A	98.4	Very high	90.6	Very high	0 Å²	0	73.5 Å²	73.5	0%	0	37%	0.365	C	S	.	.	H	α-helix	trans	-63.9	-46.9	178.3	0	0	0	0	0	112.5	M1 A6 I9 L10 K45 I46 N47 F52 L53	M1-A49 HydrophobicContact CE-CB 4.19Å; M1-A49 HydrophobicContact SD-CB 4.46Å; A6-A49 HydrophobicContact CB-CB 3.99Å; I9-A49 HydrophobicContact CB-CB 3.82Å; I9-A49 HydrophobicContact CD1-CB 4.08Å; I9-A49 HydrophobicContact CG2-CB 3.65Å; L10-A49 HydrophobicContact CD2-CB 4.32Å; L10-A49 HydrophobicContact CG-CB 4.16Å; K45-A49 WeakPolarHBondContact O-CB 3.42Å; K45-A49 PolarHBondContact O-N 3Å; I46-A49 PolarHBondContact O-N 3.18Å; N47-A49 VanDerWaalsContact C-N 3.28Å; N47-A49 PolarHBondContact O-N 2.95Å; A49-F52 PolarHBondContact O-N 3.47Å; A49-L53 WeakPolarHBondContact O-CG 3.44Å; A49-L53 PolarHBondContact O-N 3.38Å; A49-L53 VanDerWaalsContact O-N 3.11Å
50	K	97.7	Very high	90.2	Very high	47 Å²	47	74.7 Å²	74.7	20%	0.204	37%	0.366	C	S	.	.	H	α-helix	trans	-61.3	-49	177.1	175.9	-77.7	-163.9	-170.6	0	110.5	L10 H25 I46 N47 F52 L53 D54	L10-K50 HydrophobicContact CD1-CB 4.31Å; H25-K50 HydrophobicContact CB-CB 4.13Å; H25-K50 HydrophobicContact CB-CG 3.95Å; H25-K50 WeakPolarHBondContact CD2-CB 3.46Å; I46-K50 PolarHBondContact O-N 2.84Å; I46-K50 VanDerWaalsContact O-N 3.1Å; N47-K50 PolarHBondContact O-N 2.81Å; K50-F52 VanDerWaalsContact C-N 3.3Å; K50-F52 PolarHBondContact O-N 3.01Å; K50-L53 PolarHBondContact O-N 3.47Å; K50-D54 WeakPolarHBondContact CD-OD2 3.45Å; K50-D54 WeakPolarHBondContact CE-OD2 3.38Å; K50-D54 IonicContact NZ-OD2 2.79Å; K50-D54 PolarHBondContact NZ-OD2 3.15Å; K50-D54 PolarHBondContact O-N 2.98Å
51	D	97.2	Very high	89.8	Confident	74 Å²	74	73.8 Å²	73.8	40%	0.396	35%	0.354	S	S	.	.	H	α-helix	trans	-66.4	-34.9	-176.6	-72.7	-18.3	0	0	0	112	N47 K55	N47-D51 WeakPolarHBondContact O-CB 3.42Å; N47-D51 PolarHBondContact O-N 3.37Å; D51-K55 WeakPolarHBondContact O-CB 3.07Å; D51-K55 VanDerWaalsContact O-CG 3.29Å; D51-K55 WeakPolarHBondContact O-CG 3.31Å; D51-K55 PolarHBondContact O-N 3.42Å
52	F	96.9	Very high	89.3	Confident	71 Å²	71	69.6 Å²	69.6	31%	0.311	34%	0.341	S	S	.	.	H	α-helix	trans	-60.7	-46.8	172.4	-175	-85.6	0	0	0	111.6	M1 R3 A6 E48 A49 K50 S56	M1-F52 HydrophobicContact CB-CB 4.48Å; M1-F52 HydrophobicContact CB-CD2 3.76Å; M1-F52 HydrophobicContact CB-CE2 4.23Å; M1-F52 HydrophobicContact CB-CG 4.15Å; M1-F52 HydrophobicContact CG-CB 3.78Å; M1-F52 HydrophobicContact CG-CD1 4.11Å; M1-F52 HydrophobicContact CG-CD2 3.75Å; M1-F52 HydrophobicContact CG-CE2 4.38Å; M1-F52 HydrophobicContact CG-CG 3.59Å; M1-F52 WeakPolarHBondContact O-CE2 3.37Å; R3-F52 HydrophobicContact CB-CE1 3.93Å; A6-F52 HydrophobicContact CB-CD1 4.06Å; E48-F52 VanDerWaalsContact O-CB 3.23Å; E48-F52 WeakPolarHBondContact O-CB 3.42Å; E48-F52 PolarHBondContact O-N 3.26Å; A49-F52 PolarHBondContact O-N 3.47Å; K50-F52 VanDerWaalsContact C-N 3.3Å; K50-F52 PolarHBondContact O-N 3.01Å; F52-S56 WeakPolarHBondContact O-CB 3.26Å; F52-S56 PolarHBondContact O-N 2.82Å
53	L	95.5	Very high	88.8	Confident	8 Å²	8	69.6 Å²	69.6	4%	0.042	34%	0.341	C	S	.	.	H	α-helix	trans	-67.3	-42.5	-179.5	-70	173.2	0	0	0	112	R3 A6 F7 L10 V21 A49 K50 K55 S56 N57	R3-L53 HydrophobicContact CG-CD2 4.29Å; A6-L53 HydrophobicContact CB-CD1 4.03Å; A6-L53 HydrophobicContact CB-CD2 3.98Å; A6-L53 HydrophobicContact CB-CG 3.72Å; F7-L53 HydrophobicContact CD1-CD1 4.01Å; F7-L53 HydrophobicContact CD1-CD2 4.23Å; F7-L53 HydrophobicContact CD2-CD2 4.04Å; F7-L53 HydrophobicContact CE1-CD1 4.03Å; F7-L53 HydrophobicContact CE1-CD2 3.9Å; F7-L53 HydrophobicContact CE2-CD2 3.7Å; F7-L53 HydrophobicContact CG-CD2 4.29Å; F7-L53 HydrophobicContact CZ-CD2 3.61Å; L10-L53 HydrophobicContact CD1-CD1 3.75Å; V21-L53 HydrophobicContact CG1-CB 4.31Å; V21-L53 HydrophobicContact CG1-CD1 4.05Å; V21-L53 HydrophobicContact CG2-CD1 4.32Å; A49-L53 WeakPolarHBondContact O-CG 3.44Å; A49-L53 PolarHBondContact O-N 3.38Å; A49-L53 VanDerWaalsContact O-N 3.11Å; K50-L53 PolarHBondContact O-N 3.47Å; L53-K55 PolarHBondContact O-N 2.92Å; L53-S56 PolarHBondContact O-N 3.02Å; L53-S56 PolarHBondContact O-OG 3.42Å; L53-N57 WeakPolarHBondContact O-CB 3.41Å; L53-N57 PolarHBondContact O-N 3.21Å
54	D	93.2	Very high	88.2	Confident	35 Å²	35	73.6 Å²	73.6	19%	0.187	36%	0.358	C	S	.	.	H	α-helix	trans	-59.7	-46.9	176.4	-85.8	-14.7	0	0	0	112	K50 S56 N57 T58	K50-D54 WeakPolarHBondContact CD-OD2 3.45Å; K50-D54 WeakPolarHBondContact CE-OD2 3.38Å; K50-D54 IonicContact NZ-OD2 2.79Å; K50-D54 PolarHBondContact NZ-OD2 3.15Å; K50-D54 PolarHBondContact O-N 2.98Å; D54-S56 VanDerWaalsContact C-N 3.32Å; D54-S56 PolarHBondContact O-N 3.24Å; D54-N57 PolarHBondContact O-N 3.25Å; D54-T58 PolarHBondContact O-OG1 3.02Å
55	K	89.3	Confident	87.5	Confident	168 Å²	168	74.8 Å²	74.8	73%	0.73	35%	0.352	S	S	*	.	H	α-helix	trans	-61.3	-41.2	176.5	-74.2	175.5	-177.7	177.9	0	111.9	D51 L53 N57 T58	D51-K55 WeakPolarHBondContact O-CB 3.07Å; D51-K55 VanDerWaalsContact O-CG 3.29Å; D51-K55 WeakPolarHBondContact O-CG 3.31Å; D51-K55 PolarHBondContact O-N 3.42Å; L53-K55 PolarHBondContact O-N 2.92Å; K55-N57 PolarHBondContact O-N 2.91Å; K55-N57 VanDerWaalsContact O-N 3.16Å; K55-T58 PolarHBondContact O-N 3.01Å
56	S	77.7	Confident	86.7	Confident	33 Å²	33	76.3 Å²	76.3	23%	0.231	36%	0.36	C	S	.	.	H	α-helix	trans	-68	-14.1	-177.7	82.8	0	0	0	0	114.2	R3 F52 L53 D54	R3-S56 PolarHBondContact NH2-O 3.29Å; R3-S56 PolarHBondContact NH2-OG 3.03Å; F52-S56 WeakPolarHBondContact O-CB 3.26Å; F52-S56 PolarHBondContact O-N 2.82Å; L53-S56 PolarHBondContact O-N 3.02Å; L53-S56 PolarHBondContact O-OG 3.42Å; D54-S56 VanDerWaalsContact C-N 3.32Å; D54-S56 PolarHBondContact O-N 3.24Å
57	N	67.3	Low	85.8	Confident	73 Å²	73	81.8 Å²	81.8	39%	0.39	39%	0.387	S	S	.	.	T	Hydrogen-bonded Turn	trans	-109.7	14.3	-173.9	-133.3	102.1	0	0	0	113.2	K18 L53 D54 K55	K18-N57 WeakPolarHBondContact CE-ND2 3.47Å; K18-N57 PolarHBondContact NZ-O 3.19Å; L53-N57 WeakPolarHBondContact O-CB 3.41Å; L53-N57 PolarHBondContact O-N 3.21Å; D54-N57 PolarHBondContact O-N 3.25Å; K55-N57 PolarHBondContact O-N 2.91Å; K55-N57 VanDerWaalsContact O-N 3.16Å
58	T	58.9	Low	84.7	Confident	114 Å²	114	83.2 Å²	83.2	70%	0.699	39%	0.389	S	S	*	.			trans	-113.1	21.8	179.4	-48.8	0	0	0	0	111.8	D54 K55	D54-T58 PolarHBondContact O-OG1 3.02Å; K55-T58 PolarHBondContact O-N 3.01Å
59	R	46	Very low	83.5	Confident	301 Å²	301	84 Å²	84	100%	1.136	39%	0.393	S	S	*	.			trans	-104.9	0	159.2	-78.9	-171.7	-175.5	-177.8	1.3	108.3

Retrieved 59 of 59 residues in 169 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).