A0A077Z4T6_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077Z4T6, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 78 aa.

						>A0A077Z4T6_TRITR|A0A077Z4T6
MDADLAELTKSESEEDEEEELEKDTKQEYWLILERLSEILGTVRNVEIKVESWDLDMIRALKLNNGFDALLQPYEHLH
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	62	Low	72.7	Confident	207 Å²	207	111.2 Å²	111.2	100%	1.02	62%	0.615	S	S	*	*				0	-36	0	-90.3	-178.3	153.9	0	0	111.7	A3	M1-A3 PolarHBondContact O-N 3.45Å
2	D	67.9	Low	73.1	Confident	142 Å²	142	112.3 Å²	112.3	76%	0.759	61%	0.612	S	S	*	*	H	α-helix	trans	-69.7	-26.7	177.6	-64.1	-14.7	0	0	0	114.9	L5 A6	D2-L5 PolarHBondContact O-N 3.18Å; D2-A6 PolarHBondContact O-N 3.45Å
3	A	70.9	Confident	73.1	Confident	74 Å²	74	107.8 Å²	107.8	61%	0.612	60%	0.595	S	S	*	*	H	α-helix	trans	-66.7	-44.6	179.1	0	0	0	0	0	112.8	M1 L5 A6 E7	M1-A3 PolarHBondContact O-N 3.45Å; A3-L5 PolarHBondContact O-N 3.23Å; A3-A6 PolarHBondContact O-N 3.3Å; A3-E7 PolarHBondContact O-N 3.15Å
4	D	75.5	Confident	73.4	Confident	107 Å²	107	106.5 Å²	106.5	57%	0.572	58%	0.582	S	S	*	*	H	α-helix	trans	-62.4	-34.5	177.8	-67.6	-19	0	0	0	111.7	E7 L8	D4-E7 PolarHBondContact O-N 3.24Å; D4-L8 WeakPolarHBondContact O-CB 3.38Å; D4-L8 WeakPolarHBondContact O-CG 3.48Å; D4-L8 PolarHBondContact O-N 3.15Å
5	L	74.4	Confident	73.5	Confident	114 Å²	114	108.1 Å²	108.1	60%	0.597	58%	0.584	S	S	*	*	H	α-helix	trans	-73.6	-35.1	-178.3	-133.2	145.2	0	0	0	111.7	D2 A3 T9	D2-L5 PolarHBondContact O-N 3.18Å; A3-L5 PolarHBondContact O-N 3.23Å; L5-T9 PolarHBondContact O-N 2.73Å; L5-T9 VanDerWaalsContact O-N 3.15Å; L5-T9 PolarHBondContact O-OG1 3.01Å
6	A	74.6	Confident	73.5	Confident	59 Å²	59	107.6 Å²	107.6	49%	0.488	58%	0.581	S	S	.	*	H	α-helix	trans	-70.7	-35	173	0	0	0	0	0	112.5	D2 A3 T9 K10	D2-A6 PolarHBondContact O-N 3.45Å; A3-A6 PolarHBondContact O-N 3.3Å; A6-T9 WeakPolarHBondContact CA-OG1 3.47Å; A6-T9 PolarHBondContact O-OG1 3.46Å; A6-K10 WeakPolarHBondContact O-CB 3.32Å; A6-K10 PolarHBondContact O-N 3.44Å; A6-K10 VanDerWaalsContact O-N 3.15Å
7	E	74.1	Confident	73.7	Confident	133 Å²	133	108.7 Å²	108.7	62%	0.621	58%	0.581	S	S	*	*	H	α-helix	trans	-70.1	-43.2	176.6	-154.8	169.3	-150.7	0	0	111	A3 D4 T9 K10 S11	A3-E7 PolarHBondContact O-N 3.15Å; D4-E7 PolarHBondContact O-N 3.24Å; E7-T9 PolarHBondContact O-N 3.33Å; E7-K10 PolarHBondContact O-N 2.63Å; E7-S11 PolarHBondContact O-N 2.99Å; E7-S11 PolarHBondContact O-OG 3.04Å
8	L	73.7	Confident	73.9	Confident	120 Å²	120	110.6 Å²	110.6	63%	0.628	59%	0.586	S	S	*	*	H	α-helix	trans	-59.4	-44.8	174	-77.2	167.1	0	0	0	112.9	D4 K10 S11 E12	D4-L8 WeakPolarHBondContact O-CB 3.38Å; D4-L8 WeakPolarHBondContact O-CG 3.48Å; D4-L8 PolarHBondContact O-N 3.15Å; L8-K10 VanDerWaalsContact C-N 3.31Å; L8-K10 PolarHBondContact O-N 3.04Å; L8-S11 PolarHBondContact O-N 3.2Å; L8-E12 WeakPolarHBondContact O-CB 3.41Å; L8-E12 PolarHBondContact O-N 3.02Å
9	T	74.1	Confident	74.1	Confident	81 Å²	81	109.6 Å²	109.6	50%	0.497	58%	0.578	S	S	.	*	H	α-helix	trans	-68.1	-29.8	178.5	31.3	0	0	0	0	113	L5 A6 E7 S13	L5-T9 PolarHBondContact O-N 2.73Å; L5-T9 VanDerWaalsContact O-N 3.15Å; L5-T9 PolarHBondContact O-OG1 3.01Å; A6-T9 WeakPolarHBondContact CA-OG1 3.47Å; A6-T9 PolarHBondContact O-OG1 3.46Å; E7-T9 PolarHBondContact O-N 3.33Å; T9-S13 PolarHBondContact O-N 3.21Å
10	K	77.1	Confident	74.2	Confident	123 Å²	123	111 Å²	111	54%	0.535	58%	0.581	S	S	.	*	H	α-helix	trans	-73.1	-40.1	173.9	-167	174.1	-178.5	-75.3	0	111.9	A6 E7 L8 S13 E14	A6-K10 WeakPolarHBondContact O-CB 3.32Å; A6-K10 PolarHBondContact O-N 3.44Å; A6-K10 VanDerWaalsContact O-N 3.15Å; E7-K10 PolarHBondContact O-N 2.63Å; L8-K10 VanDerWaalsContact C-N 3.31Å; L8-K10 PolarHBondContact O-N 3.04Å; K10-S13 PolarHBondContact O-N 3.49Å; K10-S13 PolarHBondContact O-OG 3.35Å; K10-E14 IonicContact NZ-OE1 2.63Å; K10-E14 PolarHBondContact NZ-OE1 3.34Å; K10-E14 WeakPolarHBondContact O-CG 3.49Å; K10-E14 PolarHBondContact O-N 3.47Å
11	S	74.9	Confident	74.4	Confident	63 Å²	63	111.1 Å²	111.1	44%	0.441	58%	0.582	S	S	.	*	H	α-helix	trans	-65	-39.8	175.2	-65.1	0	0	0	0	112.1	E7 L8 S13 E14 E15	E7-S11 PolarHBondContact O-N 2.99Å; E7-S11 PolarHBondContact O-OG 3.04Å; L8-S11 PolarHBondContact O-N 3.2Å; S11-S13 VanDerWaalsContact C-N 3.34Å; S11-S13 PolarHBondContact O-N 2.97Å; S11-E14 PolarHBondContact O-N 3.27Å; S11-E15 WeakPolarHBondContact O-CB 3.45Å; S11-E15 PolarHBondContact O-N 3.02Å
12	E	77.6	Confident	75.3	Confident	124 Å²	124	106.2 Å²	106.2	58%	0.579	56%	0.556	S	S	*	*	H	α-helix	trans	-62.2	-41.1	175.1	-169.5	174	-166.4	0	0	111.4	L8 E15 D16	L8-E12 WeakPolarHBondContact O-CB 3.41Å; L8-E12 PolarHBondContact O-N 3.02Å; E12-E15 PolarHBondContact O-N 3.44Å; E12-D16 PolarHBondContact O-N 3.37Å
13	S	73	Confident	76	Confident	55 Å²	55	104.9 Å²	104.9	39%	0.385	54%	0.544	S	S	.	.	H	α-helix	trans	-70.5	-35.6	176.7	87.1	0	0	0	0	113.3	T9 K10 S11 E17	T9-S13 PolarHBondContact O-N 3.21Å; K10-S13 PolarHBondContact O-N 3.49Å; K10-S13 PolarHBondContact O-OG 3.35Å; S11-S13 VanDerWaalsContact C-N 3.34Å; S11-S13 PolarHBondContact O-N 2.97Å; S13-E17 WeakPolarHBondContact O-CG 3.39Å; S13-E17 PolarHBondContact O-N 2.96Å
14	E	77.7	Confident	76.5	Confident	89 Å²	89	105.9 Å²	105.9	42%	0.416	54%	0.539	S	S	.	.	H	α-helix	trans	-66.1	-39.3	174.8	-77	174.9	-175.8	0	0	111.2	K10 S11 E17 E18	K10-E14 IonicContact NZ-OE1 2.63Å; K10-E14 PolarHBondContact NZ-OE1 3.34Å; K10-E14 WeakPolarHBondContact O-CG 3.49Å; K10-E14 PolarHBondContact O-N 3.47Å; S11-E14 PolarHBondContact O-N 3.27Å; E14-E17 PolarHBondContact O-N 3.37Å; E14-E18 PolarHBondContact O-N 3.11Å
15	E	74.8	Confident	76.9	Confident	131 Å²	131	104.7 Å²	104.7	61%	0.612	54%	0.536	S	S	*	.	H	α-helix	trans	-67	-40.3	176.6	-165.1	170.5	-162	0	0	111.7	S11 E12 E18 E19	S11-E15 WeakPolarHBondContact O-CB 3.45Å; S11-E15 PolarHBondContact O-N 3.02Å; E12-E15 PolarHBondContact O-N 3.44Å; E15-E18 PolarHBondContact O-N 3.4Å; E15-E19 PolarHBondContact O-N 2.95Å
16	D	74.1	Confident	77.4	Confident	99 Å²	99	104 Å²	104	53%	0.529	53%	0.528	S	S	.	.	H	α-helix	trans	-63.5	-41.4	173.3	-87.9	-16.2	0	0	0	112.4	E12 E19 E20	E12-D16 PolarHBondContact O-N 3.37Å; D16-E19 PolarHBondContact O-N 3.41Å; D16-E20 PolarHBondContact O-N 2.98Å
17	E	76.2	Confident	77.9	Confident	127 Å²	127	107.8 Å²	107.8	59%	0.593	54%	0.535	S	S	*	.	H	α-helix	trans	-64.9	-40.9	175.7	-77.6	-178.3	-171.5	0	0	111.9	S13 E14 E20 L21	S13-E17 WeakPolarHBondContact O-CG 3.39Å; S13-E17 PolarHBondContact O-N 2.96Å; E14-E17 PolarHBondContact O-N 3.37Å; E17-E20 PolarHBondContact O-N 3.4Å; E17-L21 WeakPolarHBondContact O-CG 3.41Å; E17-L21 PolarHBondContact O-N 2.96Å; E17-L21 VanDerWaalsContact O-N 3.11Å
18	E	76.7	Confident	78.6	Confident	142 Å²	142	107.8 Å²	107.8	66%	0.664	54%	0.535	S	S	*	.	H	α-helix	trans	-64.4	-40.2	174.6	-77.7	-173.7	176.5	0	0	112	E14 E15 L21 E22	E14-E18 PolarHBondContact O-N 3.11Å; E15-E18 PolarHBondContact O-N 3.4Å; E18-L21 PolarHBondContact O-N 3.13Å; E18-E22 PolarHBondContact O-N 3.42Å
19	E	78.7	Confident	79.3	Confident	93 Å²	93	108.8 Å²	108.8	44%	0.435	53%	0.532	S	S	.	.	H	α-helix	trans	-63.2	-40.2	175.1	-90.4	-154.5	-172.9	0	0	113	E15 D16 E22 K23	E15-E19 PolarHBondContact O-N 2.95Å; D16-E19 PolarHBondContact O-N 3.41Å; E19-E22 PolarHBondContact O-N 3.39Å; E19-K23 WeakPolarHBondContact O-CB 3.43Å; E19-K23 WeakPolarHBondContact O-CG 3.49Å; E19-K23 PolarHBondContact O-N 3.47Å; E19-K23 IonicContact OE2-NZ 2.83Å; E19-K23 PolarHBondContact OE2-NZ 2.98Å
20	E	76.9	Confident	80.1	Confident	136 Å²	136	113.3 Å²	113.3	64%	0.636	54%	0.54	S	S	*	.	H	α-helix	trans	-64.3	-44.7	175.9	-79.1	-160.2	158.2	0	0	111.3	D16 E17 E22 K23 D24	D16-E20 PolarHBondContact O-N 2.98Å; E17-E20 PolarHBondContact O-N 3.4Å; E20-E22 VanDerWaalsContact C-N 3.32Å; E20-E22 PolarHBondContact O-N 2.94Å; E20-K23 WeakPolarHBondContact O-CB 3.49Å; E20-K23 PolarHBondContact O-N 3.35Å; E20-K23 VanDerWaalsContact O-N 3.15Å; E20-D24 PolarHBondContact O-N 3.4Å
21	L	77	Confident	80.8	Confident	115 Å²	115	111 Å²	111	60%	0.602	53%	0.533	S	S	*	.	H	α-helix	trans	-62.1	-38.8	176.1	-70.8	171.2	0	0	0	112.2	E17 E18 D24 T25	E17-L21 WeakPolarHBondContact O-CG 3.41Å; E17-L21 PolarHBondContact O-N 2.96Å; E17-L21 VanDerWaalsContact O-N 3.11Å; E18-L21 PolarHBondContact O-N 3.13Å; L21-D24 PolarHBondContact O-N 2.83Å; L21-T25 WeakPolarHBondContact O-CG2 3.33Å; L21-T25 PolarHBondContact O-N 3.02Å; L21-T25 PolarHBondContact O-OG1 3.02Å
22	E	81	Confident	81.7	Confident	103 Å²	103	112.3 Å²	112.3	48%	0.481	53%	0.534	S	S	.	.	H	α-helix	trans	-68	-36	176	-151.1	-158	174	0	0	111.7	E18 E19 E20 T25 K26	E18-E22 PolarHBondContact O-N 3.42Å; E19-E22 PolarHBondContact O-N 3.39Å; E20-E22 VanDerWaalsContact C-N 3.32Å; E20-E22 PolarHBondContact O-N 2.94Å; E22-T25 WeakPolarHBondContact CA-OG1 3.42Å; E22-T25 PolarHBondContact O-OG1 2.95Å; E22-K26 WeakPolarHBondContact O-CB 3.36Å; E22-K26 WeakPolarHBondContact O-CD 3.31Å; E22-K26 VanDerWaalsContact O-CG 3.22Å; E22-K26 WeakPolarHBondContact O-CG 3.29Å; E22-K26 PolarHBondContact O-N 2.91Å; E22-K26 WeakPolarHBondContact OE1-CE 3.48Å; E22-K26 IonicContact OE1-NZ 2.75Å; E22-K26 PolarHBondContact OE1-NZ 3.47Å; E22-K26 IonicContact OE2-NZ 2.82Å; E22-K26 PolarHBondContact OE2-NZ 3.29Å
23	K	83.4	Confident	82.5	Confident	115 Å²	115	109.3 Å²	109.3	50%	0.5	52%	0.522	S	S	.	.	H	α-helix	trans	-66.2	-43.7	174.3	-77.2	167.8	-170.8	140.2	0	111.7	E19 E20 K26 Q27	E19-K23 WeakPolarHBondContact O-CB 3.43Å; E19-K23 WeakPolarHBondContact O-CG 3.49Å; E19-K23 PolarHBondContact O-N 3.47Å; E19-K23 IonicContact OE2-NZ 2.83Å; E19-K23 PolarHBondContact OE2-NZ 2.98Å; E20-K23 WeakPolarHBondContact O-CB 3.49Å; E20-K23 PolarHBondContact O-N 3.35Å; E20-K23 VanDerWaalsContact O-N 3.15Å; K23-K26 PolarHBondContact O-N 2.92Å; K23-Q27 PolarHBondContact O-N 3.15Å
24	D	81	Confident	83.5	Confident	95 Å²	95	112.1 Å²	112.1	51%	0.508	53%	0.529	S	S	.	.	H	α-helix	trans	-63.4	-47	178.6	-84.1	0.4	0	0	0	111.5	E20 L21 K26 Q27 E28	E20-D24 PolarHBondContact O-N 3.4Å; L21-D24 PolarHBondContact O-N 2.83Å; D24-K26 VanDerWaalsContact C-N 3.34Å; D24-K26 PolarHBondContact O-N 3.44Å; D24-Q27 WeakPolarHBondContact O-CB 3.22Å; D24-Q27 PolarHBondContact O-N 3.01Å; D24-Q27 VanDerWaalsContact O-N 3.13Å; D24-E28 PolarHBondContact O-N 2.96Å
25	T	84.4	Confident	84.3	Confident	82 Å²	82	114.8 Å²	114.8	50%	0.503	54%	0.535	S	S	.	.	H	α-helix	trans	-63.7	-38	176.6	52.3	0	0	0	0	112.4	L21 E22 E28 Y29	L21-T25 WeakPolarHBondContact O-CG2 3.33Å; L21-T25 PolarHBondContact O-N 3.02Å; L21-T25 PolarHBondContact O-OG1 3.02Å; E22-T25 WeakPolarHBondContact CA-OG1 3.42Å; E22-T25 PolarHBondContact O-OG1 2.95Å; T25-E28 PolarHBondContact O-N 3.47Å; T25-Y29 WeakPolarHBondContact O-CB 3.18Å; T25-Y29 PolarHBondContact O-N 3.47Å
26	K	84.8	Confident	85.2	Confident	98 Å²	98	112.7 Å²	112.7	43%	0.426	53%	0.528	S	S	.	.	H	α-helix	trans	-62.3	-42.1	172.1	-78.5	169.2	-175.2	160.5	0	111.3	E22 K23 D24 Y29 W30	E22-K26 WeakPolarHBondContact O-CB 3.36Å; E22-K26 WeakPolarHBondContact O-CD 3.31Å; E22-K26 VanDerWaalsContact O-CG 3.22Å; E22-K26 WeakPolarHBondContact O-CG 3.29Å; E22-K26 PolarHBondContact O-N 2.91Å; E22-K26 WeakPolarHBondContact OE1-CE 3.48Å; E22-K26 IonicContact OE1-NZ 2.75Å; E22-K26 PolarHBondContact OE1-NZ 3.47Å; E22-K26 IonicContact OE2-NZ 2.82Å; E22-K26 PolarHBondContact OE2-NZ 3.29Å; K23-K26 PolarHBondContact O-N 2.92Å; D24-K26 VanDerWaalsContact C-N 3.34Å; D24-K26 PolarHBondContact O-N 3.44Å; K26-Y29 PolarHBondContact O-N 2.92Å; K26-W30 PolarHBondContact O-N 3.26Å
27	Q	85.7	Confident	86.2	Confident	140 Å²	140	111.4 Å²	111.4	65%	0.654	53%	0.526	S	S	*	.	H	α-helix	trans	-61.7	-46.9	176.2	-94.4	-171	5	0	0	112.2	K23 D24 Y29 W30 L31	K23-Q27 PolarHBondContact O-N 3.15Å; D24-Q27 WeakPolarHBondContact O-CB 3.22Å; D24-Q27 PolarHBondContact O-N 3.01Å; D24-Q27 VanDerWaalsContact O-N 3.13Å; Q27-Y29 VanDerWaalsContact C-N 3.29Å; Q27-Y29 PolarHBondContact O-N 3.25Å; Q27-W30 PolarHBondContact O-N 2.98Å; Q27-L31 PolarHBondContact O-N 3.44Å
28	E	87.6	Confident	87.1	Confident	132 Å²	132	111.1 Å²	111.1	62%	0.617	53%	0.525	S	S	*	.	H	α-helix	trans	-59.7	-42.8	176.5	-73.2	-168.4	160.3	0	0	111.6	D24 T25 W30 L31 I32	D24-E28 PolarHBondContact O-N 2.96Å; T25-E28 PolarHBondContact O-N 3.47Å; E28-W30 PolarHBondContact O-N 2.95Å; E28-L31 PolarHBondContact O-N 3.41Å; E28-I32 VanDerWaalsContact O-CG1 3.31Å; E28-I32 WeakPolarHBondContact O-CG1 3.34Å; E28-I32 PolarHBondContact O-N 2.82Å
29	Y	89.4	Confident	87.9	Confident	142 Å²	142	109.1 Å²	109.1	56%	0.557	52%	0.518	S	S	*	.	H	α-helix	trans	-60.2	-45.6	176.9	-175.6	-100.8	0	0	0	112.1	T25 K26 Q27 L31 I32 L33	T25-Y29 WeakPolarHBondContact O-CB 3.18Å; T25-Y29 PolarHBondContact O-N 3.47Å; K26-Y29 PolarHBondContact O-N 2.92Å; Q27-Y29 VanDerWaalsContact C-N 3.29Å; Q27-Y29 PolarHBondContact O-N 3.25Å; Y29-L31 VanDerWaalsContact C-N 3.34Å; Y29-L31 PolarHBondContact O-N 3.36Å; Y29-I32 PolarHBondContact O-N 2.75Å; Y29-L33 HydrophobicContact CD1-CD1 3.85Å; Y29-L33 HydrophobicContact CD1-CG 4.35Å; Y29-L33 HydrophobicContact CE1-CD1 3.33Å; Y29-L33 HydrophobicContact CE1-CG 3.97Å; Y29-L33 WeakPolarHBondContact O-CG 3.49Å; Y29-L33 PolarHBondContact O-N 3.19Å
30	W	89.7	Confident	88.7	Confident	176 Å²	176	110.5 Å²	110.5	67%	0.667	53%	0.527	S	S	*	.	H	α-helix	trans	-61.9	-41.2	175.7	-79.7	116.3	0	0	0	112.4	K26 Q27 E28 I32 L33 E34	K26-W30 PolarHBondContact O-N 3.26Å; Q27-W30 PolarHBondContact O-N 2.98Å; E28-W30 PolarHBondContact O-N 2.95Å; W30-I32 VanDerWaalsContact C-N 3.34Å; W30-I32 PolarHBondContact O-N 2.98Å; W30-L33 HydrophobicContact CE3-CD1 4.09Å; W30-L33 HydrophobicContact CZ3-CD1 4.18Å; W30-L33 PolarHBondContact O-N 3.49Å; W30-E34 PolarHBondContact O-N 3.36Å
31	L	92.4	Very high	89.6	Confident	75 Å²	75	105.6 Å²	105.6	39%	0.393	51%	0.514	S	S	.	.	H	α-helix	trans	-63.8	-39.8	177	-175.1	66.7	0	0	0	111.8	Q27 E28 Y29 E34 R35	Q27-L31 PolarHBondContact O-N 3.44Å; E28-L31 PolarHBondContact O-N 3.41Å; Y29-L31 VanDerWaalsContact C-N 3.34Å; Y29-L31 PolarHBondContact O-N 3.36Å; L31-E34 PolarHBondContact O-N 3.34Å; L31-R35 VanDerWaalsContact O-CG 3.29Å; L31-R35 WeakPolarHBondContact O-CG 3.28Å; L31-R35 PolarHBondContact O-N 3.02Å
32	I	94.3	Very high	90.4	Very high	89 Å²	89	104.3 Å²	104.3	46%	0.456	51%	0.511	S	S	.	.	H	α-helix	trans	-63.3	-44.6	174.8	-69.6	165.5	0	0	0	110.2	E28 Y29 W30 E34 R35 L36	E28-I32 VanDerWaalsContact O-CG1 3.31Å; E28-I32 WeakPolarHBondContact O-CG1 3.34Å; E28-I32 PolarHBondContact O-N 2.82Å; Y29-I32 PolarHBondContact O-N 2.75Å; W30-I32 VanDerWaalsContact C-N 3.34Å; W30-I32 PolarHBondContact O-N 2.98Å; I32-E34 PolarHBondContact O-N 2.89Å; I32-R35 PolarHBondContact O-N 3.38Å; I32-L36 HydrophobicContact CG2-CD1 3.89Å; I32-L36 HydrophobicContact CG2-CG 4.33Å; I32-L36 WeakPolarHBondContact O-CB 3.41Å; I32-L36 VanDerWaalsContact O-CG 3.28Å; I32-L36 WeakPolarHBondContact O-CG 3.3Å; I32-L36 PolarHBondContact O-N 3.5Å
33	L	94	Very high	90.9	Very high	62 Å²	62	103.7 Å²	103.7	33%	0.325	51%	0.514	S	S	.	.	H	α-helix	trans	-62.3	-42.3	177.6	-75.5	180	0	0	0	112.5	Y29 W30 L36 S37	Y29-L33 HydrophobicContact CD1-CD1 3.85Å; Y29-L33 HydrophobicContact CD1-CG 4.35Å; Y29-L33 HydrophobicContact CE1-CD1 3.33Å; Y29-L33 HydrophobicContact CE1-CG 3.97Å; Y29-L33 WeakPolarHBondContact O-CG 3.49Å; Y29-L33 PolarHBondContact O-N 3.19Å; W30-L33 HydrophobicContact CE3-CD1 4.09Å; W30-L33 HydrophobicContact CZ3-CD1 4.18Å; W30-L33 PolarHBondContact O-N 3.49Å; L33-L36 PolarHBondContact O-N 3.46Å; L33-S37 WeakPolarHBondContact O-CB 3.41Å; L33-S37 PolarHBondContact O-N 3.24Å
34	E	93.6	Very high	91.3	Very high	114 Å²	114	106.2 Å²	106.2	53%	0.533	52%	0.52	S	S	.	.	H	α-helix	trans	-60.2	-49.9	176.5	-173.6	172.1	-146.6	0	0	110.5	W30 L31 I32 L36 S37 E38	W30-E34 PolarHBondContact O-N 3.36Å; L31-E34 PolarHBondContact O-N 3.34Å; I32-E34 PolarHBondContact O-N 2.89Å; E34-L36 VanDerWaalsContact C-N 3.34Å; E34-L36 PolarHBondContact O-N 2.91Å; E34-S37 WeakPolarHBondContact O-CA 3.44Å; E34-S37 WeakPolarHBondContact O-CB 3.42Å; E34-S37 PolarHBondContact O-N 3.44Å; E34-S37 PolarHBondContact O-OG 3.36Å; E34-E38 PolarHBondContact O-N 3.27Å
35	R	94.1	Very high	91.7	Very high	145 Å²	145	106.4 Å²	106.4	55%	0.547	52%	0.521	S	S	.	.	H	α-helix	trans	-59.1	-42.6	176.3	-71.4	172.7	179.1	-177.6	1.7	112.4	L31 I32 S37 E38 I39	L31-R35 VanDerWaalsContact O-CG 3.29Å; L31-R35 WeakPolarHBondContact O-CG 3.28Å; L31-R35 PolarHBondContact O-N 3.02Å; I32-R35 PolarHBondContact O-N 3.38Å; R35-S37 VanDerWaalsContact C-N 3.29Å; R35-S37 PolarHBondContact O-N 3.04Å; R35-E38 PolarHBondContact O-N 2.82Å; R35-I39 VanDerWaalsContact O-CG1 3.3Å; R35-I39 WeakPolarHBondContact O-CG1 3.39Å; R35-I39 PolarHBondContact O-N 3.05Å
36	L	94	Very high	91.8	Very high	87 Å²	87	106.3 Å²	106.3	46%	0.455	52%	0.52	S	S	.	.	H	α-helix	trans	-62.6	-38.2	176.1	-75	172.4	0	0	0	111.5	I32 L33 E34 I39 L40	I32-L36 HydrophobicContact CG2-CD1 3.89Å; I32-L36 HydrophobicContact CG2-CG 4.33Å; I32-L36 WeakPolarHBondContact O-CB 3.41Å; I32-L36 VanDerWaalsContact O-CG 3.28Å; I32-L36 WeakPolarHBondContact O-CG 3.3Å; I32-L36 PolarHBondContact O-N 3.5Å; L33-L36 PolarHBondContact O-N 3.46Å; E34-L36 VanDerWaalsContact C-N 3.34Å; E34-L36 PolarHBondContact O-N 2.91Å; L36-I39 PolarHBondContact O-N 2.83Å; L36-L40 WeakPolarHBondContact O-CB 3.49Å; L36-L40 PolarHBondContact O-N 3.16Å
37	S	94.8	Very high	91.8	Very high	72 Å²	72	107 Å²	107	50%	0.503	53%	0.525	S	S	.	.	H	α-helix	trans	-64.8	-40.2	176.8	83.2	0	0	0	0	112.2	L33 E34 R35 L40 G41	L33-S37 WeakPolarHBondContact O-CB 3.41Å; L33-S37 PolarHBondContact O-N 3.24Å; E34-S37 WeakPolarHBondContact O-CA 3.44Å; E34-S37 WeakPolarHBondContact O-CB 3.42Å; E34-S37 PolarHBondContact O-N 3.44Å; E34-S37 PolarHBondContact O-OG 3.36Å; R35-S37 VanDerWaalsContact C-N 3.29Å; R35-S37 PolarHBondContact O-N 3.04Å; S37-L40 PolarHBondContact O-N 2.98Å; S37-G41 PolarHBondContact O-N 3.25Å
38	E	95.4	Very high	91.8	Very high	120 Å²	120	104.7 Å²	104.7	56%	0.561	52%	0.516	S	S	*	.	H	α-helix	trans	-65.2	-42.7	175.6	-69.6	-177.7	163.2	0	0	111.9	E34 R35 G41 T42	E34-E38 PolarHBondContact O-N 3.27Å; R35-E38 PolarHBondContact O-N 2.82Å; E38-G41 PolarHBondContact O-N 3.26Å; E38-T42 WeakPolarHBondContact O-CB 3.42Å; E38-T42 PolarHBondContact O-N 3.31Å; E38-T42 PolarHBondContact O-OG1 2.89Å
39	I	94.7	Very high	91.6	Very high	101 Å²	101	104.7 Å²	104.7	52%	0.518	51%	0.514	S	S	.	.	H	α-helix	trans	-60.9	-48.8	175.5	-68.2	166	0	0	0	109.7	R35 L36 G41 T42 V43	R35-I39 VanDerWaalsContact O-CG1 3.3Å; R35-I39 WeakPolarHBondContact O-CG1 3.39Å; R35-I39 PolarHBondContact O-N 3.05Å; L36-I39 PolarHBondContact O-N 2.83Å; I39-G41 PolarHBondContact O-N 2.9Å; I39-T42 WeakPolarHBondContact O-CB 3.48Å; I39-T42 PolarHBondContact O-N 3.02Å; I39-T42 VanDerWaalsContact O-N 3.16Å; I39-V43 HydrophobicContact CG2-CG2 4.32Å; I39-V43 WeakPolarHBondContact O-CG2 3.48Å; I39-V43 PolarHBondContact O-N 3.46Å
40	L	94.5	Very high	91.2	Very high	121 Å²	121	99.7 Å²	99.7	63%	0.634	50%	0.498	S	S	*	.	H	α-helix	trans	-59.2	-44.3	177.6	-96.8	150.6	0	0	0	112.2	L36 S37 T42 V43 R44	L36-L40 WeakPolarHBondContact O-CB 3.49Å; L36-L40 PolarHBondContact O-N 3.16Å; S37-L40 PolarHBondContact O-N 2.98Å; L40-T42 VanDerWaalsContact C-N 3.31Å; L40-T42 PolarHBondContact O-N 2.64Å; L40-V43 PolarHBondContact O-N 2.85Å; L40-R44 WeakPolarHBondContact O-CB 3.33Å; L40-R44 PolarHBondContact O-N 3.41Å
41	G	95.6	Very high	90.7	Very high	34 Å²	34	98.5 Å²	98.5	35%	0.351	50%	0.5	S	S	.	.	H	α-helix	trans	-60.7	-41.7	175.3	0	0	0	0	0	112.2	S37 E38 I39 R44 N45	S37-G41 PolarHBondContact O-N 3.25Å; E38-G41 PolarHBondContact O-N 3.26Å; I39-G41 PolarHBondContact O-N 2.9Å; G41-R44 PolarHBondContact O-N 3.37Å; G41-N45 WeakPolarHBondContact O-CB 3.41Å; G41-N45 VanDerWaalsContact O-CG 3.28Å; G41-N45 PolarHBondContact O-N 2.91Å; G41-N45 PolarHBondContact O-ND2 2.89Å
42	T	94.3	Very high	90.1	Very high	88 Å²	88	99.5 Å²	99.5	54%	0.54	51%	0.513	S	S	.	.	H	α-helix	trans	-65.5	-47.5	177.5	-57.8	0	0	0	0	111.5	E38 I39 L40 R44 N45 V46	E38-T42 WeakPolarHBondContact O-CB 3.42Å; E38-T42 PolarHBondContact O-N 3.31Å; E38-T42 PolarHBondContact O-OG1 2.89Å; I39-T42 WeakPolarHBondContact O-CB 3.48Å; I39-T42 PolarHBondContact O-N 3.02Å; I39-T42 VanDerWaalsContact O-N 3.16Å; L40-T42 VanDerWaalsContact C-N 3.31Å; L40-T42 PolarHBondContact O-N 2.64Å; T42-R44 VanDerWaalsContact C-N 3.29Å; T42-R44 PolarHBondContact O-N 3.39Å; T42-N45 PolarHBondContact O-N 3.41Å; T42-V46 WeakPolarHBondContact O-CG2 3.47Å; T42-V46 PolarHBondContact O-N 3.16Å
43	V	90.9	Very high	89.6	Confident	89 Å²	89	99.3 Å²	99.3	54%	0.539	51%	0.507	S	S	.	.	H	α-helix	trans	-57.2	-45.6	176.8	170	0	0	0	0	110.4	I39 L40 N45 V46 E47	I39-V43 HydrophobicContact CG2-CG2 4.32Å; I39-V43 WeakPolarHBondContact O-CG2 3.48Å; I39-V43 PolarHBondContact O-N 3.46Å; L40-V43 PolarHBondContact O-N 2.85Å; V43-N45 PolarHBondContact O-N 3.05Å; V43-V46 PolarHBondContact O-N 3.1Å; V43-E47 PolarHBondContact O-N 3.43Å
44	R	91.4	Very high	89.1	Confident	168 Å²	168	100.7 Å²	100.7	63%	0.634	52%	0.515	S	S	*	.	H	α-helix	trans	-65.6	-38.6	178.8	-170.2	159.2	-172.3	161.3	2.3	113	L40 G41 T42 V46 E47 I48	L40-R44 WeakPolarHBondContact O-CB 3.33Å; L40-R44 PolarHBondContact O-N 3.41Å; G41-R44 PolarHBondContact O-N 3.37Å; T42-R44 VanDerWaalsContact C-N 3.29Å; T42-R44 PolarHBondContact O-N 3.39Å; R44-V46 VanDerWaalsContact C-N 3.3Å; R44-V46 PolarHBondContact O-N 2.89Å; R44-E47 PolarHBondContact O-N 2.93Å; R44-I48 HydrophobicContact CG-CD1 4.29Å; R44-I48 WeakPolarHBondContact O-CG1 3.5Å; R44-I48 PolarHBondContact O-N 3.2Å
45	N	90.2	Very high	88.5	Confident	100 Å²	100	101.1 Å²	101.1	54%	0.535	52%	0.52	S	S	.	.	H	α-helix	trans	-64.5	-36.3	174.5	-76.3	-26	0	0	0	112.2	G41 T42 V43 K49	G41-N45 WeakPolarHBondContact O-CB 3.41Å; G41-N45 VanDerWaalsContact O-CG 3.28Å; G41-N45 PolarHBondContact O-N 2.91Å; G41-N45 PolarHBondContact O-ND2 2.89Å; T42-N45 PolarHBondContact O-N 3.41Å; V43-N45 PolarHBondContact O-N 3.05Å; N45-K49 WeakPolarHBondContact O-CG 3.36Å; N45-K49 PolarHBondContact O-N 3.37Å
46	V	86.9	Confident	87.9	Confident	79 Å²	79	99.1 Å²	99.1	48%	0.479	52%	0.52	S	S	.	.	H	α-helix	trans	-67.3	-45.3	173.6	173	0	0	0	0	110.3	T42 V43 R44 I48 K49 V50	T42-V46 WeakPolarHBondContact O-CG2 3.47Å; T42-V46 PolarHBondContact O-N 3.16Å; V43-V46 PolarHBondContact O-N 3.1Å; R44-V46 VanDerWaalsContact C-N 3.3Å; R44-V46 PolarHBondContact O-N 2.89Å; V46-I48 PolarHBondContact O-N 2.95Å; V46-K49 WeakPolarHBondContact O-CB 3.48Å; V46-K49 PolarHBondContact O-N 3.31Å; V46-K49 VanDerWaalsContact O-N 3.08Å; V46-V50 HydrophobicContact CG1-CG2 4.16Å; V46-V50 WeakPolarHBondContact O-CG2 3.4Å; V46-V50 PolarHBondContact O-N 2.89Å
47	E	84.1	Confident	87.2	Confident	112 Å²	112	99 Å²	99	52%	0.523	52%	0.518	S	S	.	.	H	α-helix	trans	-55	-50.9	177.5	-175	177.8	-153.3	0	0	111.7	V43 R44 K49 V50 E51	V43-E47 PolarHBondContact O-N 3.43Å; R44-E47 PolarHBondContact O-N 2.93Å; E47-K49 VanDerWaalsContact C-N 3.26Å; E47-K49 PolarHBondContact O-N 2.97Å; E47-V50 PolarHBondContact O-N 3.38Å; E47-E51 PolarHBondContact O-N 3.47Å
48	I	86.2	Confident	86.6	Confident	92 Å²	92	97.7 Å²	97.7	47%	0.472	51%	0.505	S	S	.	.	H	α-helix	trans	-58.1	-39.1	177	-67.3	166	0	0	0	111.4	R44 V46 E51	R44-I48 HydrophobicContact CG-CD1 4.29Å; R44-I48 WeakPolarHBondContact O-CG1 3.5Å; R44-I48 PolarHBondContact O-N 3.2Å; V46-I48 PolarHBondContact O-N 2.95Å; I48-E51 PolarHBondContact O-N 3.22Å
49	K	84.2	Confident	85.8	Confident	133 Å²	133	99.6 Å²	99.6	58%	0.578	51%	0.507	S	S	*	.	H	α-helix	trans	-67.6	-41.9	176.5	-75.8	178.3	179.5	-177.7	0	111.6	N45 V46 E47 E51 S52 W53	N45-K49 WeakPolarHBondContact O-CG 3.36Å; N45-K49 PolarHBondContact O-N 3.37Å; V46-K49 WeakPolarHBondContact O-CB 3.48Å; V46-K49 PolarHBondContact O-N 3.31Å; V46-K49 VanDerWaalsContact O-N 3.08Å; E47-K49 VanDerWaalsContact C-N 3.26Å; E47-K49 PolarHBondContact O-N 2.97Å; K49-E51 VanDerWaalsContact C-N 3.27Å; K49-E51 PolarHBondContact O-N 3.47Å; K49-S52 PolarHBondContact O-N 3.2Å; K49-S52 PolarHBondContact O-OG 3.41Å; K49-W53 PolarHBondContact O-N 3.44Å; K49-W53 PolarHBondContact O-NE1 3.03Å
50	V	80.6	Confident	85.2	Confident	37 Å²	37	97.5 Å²	97.5	22%	0.224	51%	0.505	C	S	.	.	H	α-helix	trans	-63.2	-34.3	178.2	172.4	0	0	0	0	111.3	V46 E47 S52 W53 I58	V46-V50 HydrophobicContact CG1-CG2 4.16Å; V46-V50 WeakPolarHBondContact O-CG2 3.4Å; V46-V50 PolarHBondContact O-N 2.89Å; E47-V50 PolarHBondContact O-N 3.38Å; V50-S52 PolarHBondContact O-N 2.97Å; V50-W53 HydrophobicContact CG1-CE3 4.45Å; V50-W53 HydrophobicContact CG2-CD2 4.28Å; V50-W53 HydrophobicContact CG2-CE3 4.04Å; V50-W53 HydrophobicContact CG2-CH2 4.21Å; V50-W53 HydrophobicContact CG2-CZ2 4.43Å; V50-W53 HydrophobicContact CG2-CZ3 4Å; V50-W53 WeakPolarHBondContact O-CB 3.37Å; V50-W53 PolarHBondContact O-N 2.92Å; V50-I58 HydrophobicContact CG1-CG1 4.45Å
51	E	78	Confident	84.6	Confident	150 Å²	150	95 Å²	95	70%	0.701	49%	0.492	S	S	*	.	H	α-helix	trans	-61	-27.9	173.5	-71.1	-177.1	163.4	0	0	113.1	E47 I48 K49	E47-E51 PolarHBondContact O-N 3.47Å; I48-E51 PolarHBondContact O-N 3.22Å; K49-E51 VanDerWaalsContact C-N 3.27Å; K49-E51 PolarHBondContact O-N 3.47Å
52	S	81.6	Confident	83.8	Confident	96 Å²	96	100.4 Å²	100.4	67%	0.671	51%	0.506	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86.1	-5.2	176.3	73.6	0	0	0	0	114.1	K49 V50	K49-S52 PolarHBondContact O-N 3.2Å; K49-S52 PolarHBondContact O-OG 3.41Å; V50-S52 PolarHBondContact O-N 2.97Å
53	W	83.5	Confident	83.1	Confident	85 Å²	85	101.7 Å²	101.7	32%	0.322	51%	0.509	S	S	.	.	S	Bend	trans	-78.1	148.5	-179.4	-68.3	0.2	0	0	0	111.4	K49 V50 M57 I58 L61	K49-W53 PolarHBondContact O-N 3.44Å; K49-W53 PolarHBondContact O-NE1 3.03Å; V50-W53 HydrophobicContact CG1-CE3 4.45Å; V50-W53 HydrophobicContact CG2-CD2 4.28Å; V50-W53 HydrophobicContact CG2-CE3 4.04Å; V50-W53 HydrophobicContact CG2-CH2 4.21Å; V50-W53 HydrophobicContact CG2-CZ2 4.43Å; V50-W53 HydrophobicContact CG2-CZ3 4Å; V50-W53 WeakPolarHBondContact O-CB 3.37Å; V50-W53 PolarHBondContact O-N 2.92Å; W53-M57 HydrophobicContact CB-CB 4.05Å; W53-M57 HydrophobicContact CB-SD 4.35Å; W53-M57 HydrophobicContact CD2-CE 3.44Å; W53-M57 VanDerWaalsContact CD2-CE 3.44Å; W53-M57 HydrophobicContact CD2-SD 4.35Å; W53-M57 HydrophobicContact CE3-CB 4.24Å; W53-M57 HydrophobicContact CE3-CE 3.71Å; W53-M57 HydrophobicContact CG-CE 3.84Å; W53-M57 HydrophobicContact CG-SD 4.17Å; W53-M57 HydrophobicContact CH2-CE 4.18Å; W53-M57 HydrophobicContact CZ2-CE 3.95Å; W53-M57 HydrophobicContact CZ3-CE 4.07Å; W53-I58 HydrophobicContact CB-CG1 4.27Å; W53-L61 HydrophobicContact CZ3-CD1 4.13Å; W53-L61 HydrophobicContact CZ3-CD2 4.24Å
54	D	82	Confident	82.6	Confident	91 Å²	91	101.8 Å²	101.8	49%	0.487	51%	0.506	S	S	.	.			trans	-67.3	159.1	173.7	77.4	63.9	0	0	0	111.2	D56 M57 I58	D54-D56 PolarHBondContact O-N 2.91Å; D54-D56 VanDerWaalsContact OD1-CA 3.25Å; D54-D56 WeakPolarHBondContact OD1-CA 3.47Å; D54-D56 VanDerWaalsContact OD1-CB 3.29Å; D54-D56 WeakPolarHBondContact OD1-CB 3.4Å; D54-D56 PolarHBondContact OD1-N 3.24Å; D54-M57 PolarHBondContact O-N 3.43Å; D54-M57 PolarHBondContact OD1-N 3.48Å; D54-I58 PolarHBondContact O-N 3.26Å; D54-I58 VanDerWaalsContact O-N 3.09Å
55	L	81.3	Confident	82.1	Confident	124 Å²	124	98 Å²	98	65%	0.649	50%	0.499	S	S	*	.	H	α-helix	trans	-59	-30.9	-177.3	-88.6	160.5	0	0	0	113.4	R59	L55-R59 WeakPolarHBondContact O-CB 3.5Å; L55-R59 VanDerWaalsContact O-CG 3.24Å; L55-R59 WeakPolarHBondContact O-CG 3.46Å; L55-R59 PolarHBondContact O-N 2.63Å
56	D	81	Confident	81.6	Confident	103 Å²	103	94.8 Å²	94.8	55%	0.551	49%	0.489	S	S	*	.	H	α-helix	trans	-76.8	-36.1	-179.9	-64.2	-35.4	0	0	0	111.3	D54 R59 A60	D54-D56 PolarHBondContact O-N 2.91Å; D54-D56 VanDerWaalsContact OD1-CA 3.25Å; D54-D56 WeakPolarHBondContact OD1-CA 3.47Å; D54-D56 VanDerWaalsContact OD1-CB 3.29Å; D54-D56 WeakPolarHBondContact OD1-CB 3.4Å; D54-D56 PolarHBondContact OD1-N 3.24Å; D56-R59 PolarHBondContact O-N 3.01Å; D56-R59 IonicContact OD1-NH1 3.19Å; D56-R59 PolarHBondContact OD1-NH1 3.23Å; D56-A60 WeakPolarHBondContact O-CB 3.34Å; D56-A60 PolarHBondContact O-N 3.45Å
57	M	81.1	Confident	81.1	Confident	84 Å²	84	96.4 Å²	96.4	41%	0.414	49%	0.49	S	S	.	.	H	α-helix	trans	-60	-44.9	167.3	-88.6	-175.5	79.4	0	0	111.8	W53 D54 R59 A60 L61	W53-M57 HydrophobicContact CB-CB 4.05Å; W53-M57 HydrophobicContact CB-SD 4.35Å; W53-M57 HydrophobicContact CD2-CE 3.44Å; W53-M57 VanDerWaalsContact CD2-CE 3.44Å; W53-M57 HydrophobicContact CD2-SD 4.35Å; W53-M57 HydrophobicContact CE3-CB 4.24Å; W53-M57 HydrophobicContact CE3-CE 3.71Å; W53-M57 HydrophobicContact CG-CE 3.84Å; W53-M57 HydrophobicContact CG-SD 4.17Å; W53-M57 HydrophobicContact CH2-CE 4.18Å; W53-M57 HydrophobicContact CZ2-CE 3.95Å; W53-M57 HydrophobicContact CZ3-CE 4.07Å; D54-M57 PolarHBondContact O-N 3.43Å; D54-M57 PolarHBondContact OD1-N 3.48Å; M57-R59 VanDerWaalsContact C-N 3.3Å; M57-R59 PolarHBondContact O-N 3.06Å; M57-A60 PolarHBondContact O-N 3.27Å; M57-L61 PolarHBondContact O-N 3.02Å
58	I	80.5	Confident	80.7	Confident	45 Å²	45	95.1 Å²	95.1	23%	0.231	49%	0.487	C	S	.	.	H	α-helix	trans	-62.1	-40.9	177.2	-65.3	171.6	0	0	0	110.7	V50 W53 D54 K62	V50-I58 HydrophobicContact CG1-CG1 4.45Å; W53-I58 HydrophobicContact CB-CG1 4.27Å; D54-I58 PolarHBondContact O-N 3.26Å; D54-I58 VanDerWaalsContact O-N 3.09Å; I58-K62 HydrophobicContact CG2-CD 4.28Å; I58-K62 WeakPolarHBondContact O-CG 3.43Å; I58-K62 PolarHBondContact O-N 3.34Å
59	R	79.9	Confident	80.4	Confident	159 Å²	159	93.6 Å²	93.6	60%	0.6	49%	0.488	S	S	*	.	H	α-helix	trans	-65	-44.6	176.2	-76.8	167.8	176.6	173.4	-3.1	112.1	L55 D56 M57 L61 K62 L63	L55-R59 WeakPolarHBondContact O-CB 3.5Å; L55-R59 VanDerWaalsContact O-CG 3.24Å; L55-R59 WeakPolarHBondContact O-CG 3.46Å; L55-R59 PolarHBondContact O-N 2.63Å; D56-R59 PolarHBondContact O-N 3.01Å; D56-R59 IonicContact OD1-NH1 3.19Å; D56-R59 PolarHBondContact OD1-NH1 3.23Å; M57-R59 VanDerWaalsContact C-N 3.3Å; M57-R59 PolarHBondContact O-N 3.06Å; R59-L61 VanDerWaalsContact C-N 3.33Å; R59-L61 PolarHBondContact O-N 3.43Å; R59-K62 PolarHBondContact O-N 3.05Å; R59-L63 WeakPolarHBondContact O-CB 3.27Å; R59-L63 PolarHBondContact O-N 3.4Å
60	A	82.1	Confident	80.1	Confident	57 Å²	57	93.1 Å²	93.1	47%	0.471	49%	0.491	S	S	.	.	H	α-helix	trans	-60.6	-43.2	177.2	0	0	0	0	0	111.4	D56 M57 L63 N64	D56-A60 WeakPolarHBondContact O-CB 3.34Å; D56-A60 PolarHBondContact O-N 3.45Å; M57-A60 PolarHBondContact O-N 3.27Å; A60-L63 PolarHBondContact O-N 3.08Å; A60-N64 PolarHBondContact O-N 3.48Å
61	L	81.2	Confident	79.9	Confident	69 Å²	69	95.9 Å²	95.9	36%	0.361	50%	0.504	S	S	.	.	H	α-helix	trans	-63.2	-46.1	176.8	-164.5	85.3	0	0	0	111.9	W53 M57 R59 L63 N64 N65	W53-L61 HydrophobicContact CZ3-CD1 4.13Å; W53-L61 HydrophobicContact CZ3-CD2 4.24Å; M57-L61 PolarHBondContact O-N 3.02Å; R59-L61 VanDerWaalsContact C-N 3.33Å; R59-L61 PolarHBondContact O-N 3.43Å; L61-L63 VanDerWaalsContact C-N 3.31Å; L61-L63 PolarHBondContact O-N 3.31Å; L61-N64 PolarHBondContact O-N 2.96Å; L61-N65 PolarHBondContact O-N 2.96Å; L61-N65 PolarHBondContact O-OD1 3.07Å
62	K	79.3	Confident	80	Confident	148 Å²	148	94.5 Å²	94.5	64%	0.643	50%	0.498	S	S	*	.	H	α-helix	trans	-61.3	-40.3	176.8	-76.2	178.6	178.9	-179.7	0	112.2	I58 R59 G66	I58-K62 HydrophobicContact CG2-CD 4.28Å; I58-K62 WeakPolarHBondContact O-CG 3.43Å; I58-K62 PolarHBondContact O-N 3.34Å; R59-K62 PolarHBondContact O-N 3.05Å; K62-G66 PolarHBondContact O-N 2.86Å
63	L	80.2	Confident	79.8	Confident	114 Å²	114	94.1 Å²	94.1	60%	0.597	49%	0.493	S	S	*	.	H	α-helix	trans	-61.5	-47.9	175.6	-172.7	73.7	0	0	0	110.4	R59 A60 L61 G66 F67	R59-L63 WeakPolarHBondContact O-CB 3.27Å; R59-L63 PolarHBondContact O-N 3.4Å; A60-L63 PolarHBondContact O-N 3.08Å; L61-L63 VanDerWaalsContact C-N 3.31Å; L61-L63 PolarHBondContact O-N 3.31Å; L63-G66 PolarHBondContact O-N 2.99Å; L63-F67 HydrophobicContact CD1-CD2 4.38Å; L63-F67 HydrophobicContact CD1-CE2 3.97Å; L63-F67 HydrophobicContact CD2-CE2 4.4Å; L63-F67 HydrophobicContact CG-CD2 4.04Å; L63-F67 HydrophobicContact CG-CE2 3.93Å; L63-F67 WeakPolarHBondContact O-CD2 3.39Å; L63-F67 PolarHBondContact O-N 3.35Å
64	N	80	Confident	79.6	Confident	92 Å²	92	97.6 Å²	97.6	49%	0.492	51%	0.507	S	S	.	.	H	α-helix	trans	-63.1	-47.2	-179.2	-157.6	38.8	0	0	0	112	A60 L61 G66 F67 D68	A60-N64 PolarHBondContact O-N 3.48Å; L61-N64 PolarHBondContact O-N 2.96Å; N64-G66 PolarHBondContact O-N 2.85Å; N64-F67 WeakPolarHBondContact O-CA 3.45Å; N64-F67 WeakPolarHBondContact O-CB 3.36Å; N64-F67 PolarHBondContact O-N 3.31Å; N64-D68 PolarHBondContact O-N 3.3Å
65	N	80.8	Confident	79.3	Confident	88 Å²	88	100 Å²	100	47%	0.471	52%	0.515	S	S	.	.	H	α-helix	trans	-61	-34.1	176.5	-69	-2.1	0	0	0	112.3	L61 A69	L61-N65 PolarHBondContact O-N 2.96Å; L61-N65 PolarHBondContact O-OD1 3.07Å; N65-A69 WeakPolarHBondContact O-CB 3.36Å; N65-A69 PolarHBondContact O-N 3.04Å
66	G	80	Confident	78.9	Confident	33 Å²	33	101.5 Å²	101.5	34%	0.34	52%	0.519	S	S	.	.	H	α-helix	trans	-67.1	-38.9	173.8	0	0	0	0	0	112.6	K62 L63 N64 L70	K62-G66 PolarHBondContact O-N 2.86Å; L63-G66 PolarHBondContact O-N 2.99Å; N64-G66 PolarHBondContact O-N 2.85Å; G66-L70 VanDerWaalsContact O-CG 3.27Å; G66-L70 WeakPolarHBondContact O-CG 3.35Å; G66-L70 PolarHBondContact O-N 3.48Å
67	F	75.1	Confident	78.5	Confident	113 Å²	113	102.6 Å²	102.6	50%	0.496	52%	0.524	S	S	.	.	H	α-helix	trans	-66.3	-45.1	173.7	-89.3	-73.9	0	0	0	112.1	L63 N64 A69 L70 L71	L63-F67 HydrophobicContact CD1-CD2 4.38Å; L63-F67 HydrophobicContact CD1-CE2 3.97Å; L63-F67 HydrophobicContact CD2-CE2 4.4Å; L63-F67 HydrophobicContact CG-CD2 4.04Å; L63-F67 HydrophobicContact CG-CE2 3.93Å; L63-F67 WeakPolarHBondContact O-CD2 3.39Å; L63-F67 PolarHBondContact O-N 3.35Å; N64-F67 WeakPolarHBondContact O-CA 3.45Å; N64-F67 WeakPolarHBondContact O-CB 3.36Å; N64-F67 PolarHBondContact O-N 3.31Å; F67-A69 VanDerWaalsContact C-N 3.31Å; F67-A69 PolarHBondContact O-N 3.25Å; F67-L70 WeakPolarHBondContact O-CB 3.41Å; F67-L70 PolarHBondContact O-N 3.03Å; F67-L70 VanDerWaalsContact O-N 3.1Å; F67-L71 WeakPolarHBondContact O-CB 3.43Å; F67-L71 WeakPolarHBondContact O-CG 3.29Å; F67-L71 PolarHBondContact O-N 3.42Å
68	D	76.6	Confident	77.4	Confident	85 Å²	85	110.7 Å²	110.7	46%	0.455	56%	0.56	S	S	.	*	H	α-helix	trans	-59.4	-43.8	176.7	-70.7	-19.7	0	0	0	110.9	N64 L70 L71 Q72	N64-D68 PolarHBondContact O-N 3.3Å; D68-L70 VanDerWaalsContact C-N 3.31Å; D68-L70 PolarHBondContact O-N 2.93Å; D68-L71 PolarHBondContact O-N 3.34Å; D68-L71 VanDerWaalsContact O-N 3.16Å; D68-Q72 PolarHBondContact O-N 3.04Å
69	A	79.4	Confident	77.3	Confident	60 Å²	60	114 Å²	114	50%	0.496	58%	0.577	S	S	.	*	H	α-helix	trans	-63.1	-35	175.7	0	0	0	0	0	113.1	N65 F67	N65-A69 WeakPolarHBondContact O-CB 3.36Å; N65-A69 PolarHBondContact O-N 3.04Å; F67-A69 VanDerWaalsContact C-N 3.31Å; F67-A69 PolarHBondContact O-N 3.25Å
70	L	77.8	Confident	77.1	Confident	122 Å²	122	111.6 Å²	111.6	64%	0.639	58%	0.576	S	S	*	*	H	α-helix	trans	-73.7	-28.6	175.5	-75.1	170.3	0	0	0	112.8	G66 F67 D68 P73 Y74	G66-L70 VanDerWaalsContact O-CG 3.27Å; G66-L70 WeakPolarHBondContact O-CG 3.35Å; G66-L70 PolarHBondContact O-N 3.48Å; F67-L70 WeakPolarHBondContact O-CB 3.41Å; F67-L70 PolarHBondContact O-N 3.03Å; F67-L70 VanDerWaalsContact O-N 3.1Å; D68-L70 VanDerWaalsContact C-N 3.31Å; D68-L70 PolarHBondContact O-N 2.93Å; L70-P73 WeakPolarHBondContact O-CD 3.38Å; L70-Y74 WeakPolarHBondContact O-CD2 3.48Å
71	L	76.2	Confident	76.9	Confident	95 Å²	95	114.7 Å²	114.7	50%	0.497	58%	0.581	S	S	.	*	H	α-helix	trans	-85	-23.7	178.8	-72.3	171.7	0	0	0	112.8	F67 D68 P73 Y74 E75	F67-L71 WeakPolarHBondContact O-CB 3.43Å; F67-L71 WeakPolarHBondContact O-CG 3.29Å; F67-L71 PolarHBondContact O-N 3.42Å; D68-L71 PolarHBondContact O-N 3.34Å; D68-L71 VanDerWaalsContact O-N 3.16Å; L71-P73 VanDerWaalsContact C-N 3.31Å; L71-P73 VanDerWaalsContact O-N 3.16Å; L71-Y74 WeakPolarHBondContact O-CA 3.25Å; L71-Y74 WeakPolarHBondContact O-CB 3.24Å; L71-Y74 PolarHBondContact O-N 2.87Å; L71-E75 PolarHBondContact O-N 3.21Å
72	Q	80.4	Confident	76.6	Confident	122 Å²	122	117.4 Å²	117.4	57%	0.57	59%	0.594	S	S	*	*	G	3₁₀ helix	trans	-48.8	-42.1	-179.3	-148.5	-164.8	-1	0	0	114.4	D68 Y74 E75	D68-Q72 PolarHBondContact O-N 3.04Å; Q72-Y74 PolarHBondContact O-N 3.19Å; Q72-E75 PolarHBondContact O-N 3.09Å
73	P	77.4	Confident	76.4	Confident	88 Å²	88	115.4 Å²	115.4	57%	0.571	59%	0.591	S	S	*	*	G	3₁₀ helix	trans	-64.5	-22.9	176.1	-21.9	34.7	0	0	0	114.3	L70 L71	L70-P73 WeakPolarHBondContact O-CD 3.38Å; L71-P73 VanDerWaalsContact C-N 3.31Å; L71-P73 VanDerWaalsContact O-N 3.16Å
74	Y	79.3	Confident	76.2	Confident	158 Å²	158	115.5 Å²	115.5	62%	0.62	59%	0.591	S	S	*	*	G	3₁₀ helix	trans	-92.8	-17.4	-178.3	-60.1	-83.5	0	0	0	113	L70 L71 Q72 H76 L77	L70-Y74 WeakPolarHBondContact O-CD2 3.48Å; L71-Y74 WeakPolarHBondContact O-CA 3.25Å; L71-Y74 WeakPolarHBondContact O-CB 3.24Å; L71-Y74 PolarHBondContact O-N 2.87Å; Q72-Y74 PolarHBondContact O-N 3.19Å; Y74-H76 PolarHBondContact O-N 3.19Å; Y74-L77 HydrophobicContact CD1-CD1 4.36Å; Y74-L77 PolarHBondContact O-N 2.73Å
75	E	75.5	Confident	75.9	Confident	141 Å²	141	117.2 Å²	117.2	66%	0.659	60%	0.598	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.6	-23.8	179.4	-73.1	-174.2	145.2	0	0	113.3	L71 Q72	L71-E75 PolarHBondContact O-N 3.21Å; Q72-E75 PolarHBondContact O-N 3.09Å
76	H	72.3	Confident	75.5	Confident	156 Å²	156	119.5 Å²	119.5	72%	0.722	61%	0.608	S	S	*	*	T	Hydrogen-bonded Turn	trans	-104.9	12.7	-175.5	-60.6	61.5	0	0	0	112.7	Y74 H78	Y74-H76 PolarHBondContact O-N 3.19Å; H76-H78 VanDerWaalsContact C-N 3.34Å; H76-H78 PolarHBondContact O-N 2.98Å
77	L	73.9	Confident	75.2	Confident	125 Å²	125	126.7 Å²	126.7	65%	0.654	63%	0.63	S	S	*	*			trans	-94.2	21.5	-173.7	-124.6	139.1	0	0	0	113.9	Y74	Y74-L77 HydrophobicContact CD1-CD1 4.36Å; Y74-L77 PolarHBondContact O-N 2.73Å
78	H	58.1	Low	75.2	Confident	255 Å²	255	127.9 Å²	127.9	100%	1.181	64%	0.642	S	S	*	*			trans	-124.6	0	176.9	-86.5	-50.1	0	0	0	113.1	H76	H76-H78 VanDerWaalsContact C-N 3.34Å; H76-H78 PolarHBondContact O-N 2.98Å

Retrieved 78 of 78 residues in 54 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).