A0A077Z524_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077Z524, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 98 aa.

						>A0A077Z524_TRITR|A0A077Z524
MAGSGVAWRGLVAQSDMARCSVVWGAWWSARYARGGAVRCGVVARKGMALCGVAWRGATWRGVARRSVAWRDVAWRGVAWRRVAQYGVVWCPRGAVIS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	41.7	Very low	51.9	Low	248 Å²	248	112.5 Å²	112.5	100%	1.222	66%	0.662	S	S	*	*				0	66.9	0	-61.4	175.3	-153	0	0	110.3
2	A	50.9	Low	52.2	Low	101 Å²	101	111.7 Å²	111.7	84%	0.835	66%	0.658	S	S	*	*			trans	-117.9	2.3	-176.3	0	0	0	0	0	114.1
3	G	52.8	Low	52.3	Low	59 Å²	59	106.8 Å²	106.8	61%	0.608	64%	0.638	S	S	*	*	S	Bend	trans	-89.6	-19.8	-177.2	0	0	0	0	0	115.5
4	S	55.6	Low	52.6	Low	80 Å²	80	109.4 Å²	109.4	56%	0.559	64%	0.64	S	S	*	*	H	α-helix	trans	-80.9	-30.9	-171.9	-52.8	0	0	0	0	113.4	V6 A7 W8	S4-V6 VanDerWaalsContact C-N 3.34Å; S4-V6 PolarHBondContact O-N 3.29Å; S4-A7 PolarHBondContact O-N 3.45Å; S4-W8 PolarHBondContact O-NE1 3.37Å
5	G	52.9	Low	52.8	Low	47 Å²	47	106.5 Å²	106.5	49%	0.485	63%	0.629	S	S	.	*	H	α-helix	trans	-65.1	-30.7	-171.4	0	0	0	0	0	115.3
6	V	57.3	Low	53.2	Low	113 Å²	113	106.3 Å²	106.3	69%	0.685	62%	0.624	S	S	*	*	H	α-helix	trans	-78.1	-31.9	-178.5	-66.1	0	0	0	0	112.5	S4 G10	S4-V6 VanDerWaalsContact C-N 3.34Å; S4-V6 PolarHBondContact O-N 3.29Å; V6-G10 PolarHBondContact O-N 3.46Å
7	A	51.8	Low	53.5	Low	56 Å²	56	108.1 Å²	108.1	46%	0.463	63%	0.627	S	S	.	*	H	α-helix	trans	-69.4	-41.5	178.6	0	0	0	0	0	111.9	S4 G10 L11	S4-A7 PolarHBondContact O-N 3.45Å; A7-G10 PolarHBondContact O-N 3.02Å; A7-L11 WeakPolarHBondContact O-CG 3.42Å; A7-L11 PolarHBondContact O-N 3.22Å; A7-L11 VanDerWaalsContact O-N 3.13Å
8	W	48	Very low	53.8	Low	180 Å²	180	105.1 Å²	105.1	68%	0.682	62%	0.617	S	S	*	*	H	α-helix	trans	-66.5	-38.8	178.1	-59.2	109.6	0	0	0	112.6	S4 G10 L11 V12	S4-W8 PolarHBondContact O-NE1 3.37Å; W8-G10 PolarHBondContact O-N 3.43Å; W8-L11 PolarHBondContact O-N 3.1Å; W8-V12 WeakPolarHBondContact O-CG2 3.44Å; W8-V12 PolarHBondContact O-N 3.13Å; W8-V12 VanDerWaalsContact O-N 3.1Å
9	R	54.8	Low	54.1	Low	209 Å²	209	109.5 Å²	109.5	79%	0.789	62%	0.622	S	S	*	*	H	α-helix	trans	-64.9	-39.2	176.3	-73.6	-171.6	-166.8	-79.8	-0.1	112	A13	R9-A13 WeakPolarHBondContact O-CB 3.37Å; R9-A13 PolarHBondContact O-N 3.32Å; R9-A13 VanDerWaalsContact O-N 3.12Å
10	G	54.3	Low	54.3	Low	39 Å²	39	107.7 Å²	107.7	40%	0.402	62%	0.616	S	S	.	*	H	α-helix	trans	-62.4	-46.8	176.1	0	0	0	0	0	112.9	V6 A7 W8 A13 Q14	V6-G10 PolarHBondContact O-N 3.46Å; A7-G10 PolarHBondContact O-N 3.02Å; W8-G10 PolarHBondContact O-N 3.43Å; G10-A13 PolarHBondContact O-N 3.36Å; G10-Q14 WeakPolarHBondContact O-CB 3.34Å; G10-Q14 PolarHBondContact O-N 3.5Å
11	L	50.6	Low	54.7	Low	106 Å²	106	106.6 Å²	106.6	56%	0.555	62%	0.615	S	S	*	*	H	α-helix	trans	-68.5	-37.6	-178.2	-68.5	173.4	0	0	0	113.3	A7 W8 S15	A7-L11 WeakPolarHBondContact O-CG 3.42Å; A7-L11 PolarHBondContact O-N 3.22Å; A7-L11 VanDerWaalsContact O-N 3.13Å; W8-L11 PolarHBondContact O-N 3.1Å; L11-S15 WeakPolarHBondContact O-CB 3.39Å; L11-S15 PolarHBondContact O-N 3.12Å; L11-S15 PolarHBondContact O-OG 2.79Å
12	V	55.8	Low	55.8	Low	102 Å²	102	99.9 Å²	99.9	62%	0.618	59%	0.587	S	S	*	*	H	α-helix	trans	-67.8	-43.7	175.9	175	0	0	0	0	110.6	W8 Q14 S15 D16	W8-V12 WeakPolarHBondContact O-CG2 3.44Å; W8-V12 PolarHBondContact O-N 3.13Å; W8-V12 VanDerWaalsContact O-N 3.1Å; V12-Q14 VanDerWaalsContact C-N 3.35Å; V12-Q14 PolarHBondContact O-N 3.49Å; V12-S15 PolarHBondContact O-N 3.05Å; V12-D16 PolarHBondContact O-N 3.06Å
13	A	53.2	Low	56.6	Low	48 Å²	48	100 Å²	100	40%	0.397	58%	0.577	S	S	.	*	H	α-helix	trans	-63	-39.6	177.8	0	0	0	0	0	112.7	R9 G10 D16 M17	R9-A13 WeakPolarHBondContact O-CB 3.37Å; R9-A13 PolarHBondContact O-N 3.32Å; R9-A13 VanDerWaalsContact O-N 3.12Å; G10-A13 PolarHBondContact O-N 3.36Å; A13-D16 PolarHBondContact O-N 3.12Å; A13-M17 PolarHBondContact O-N 3.44Å
14	Q	56.6	Low	56.8	Low	143 Å²	143	105.1 Å²	105.1	67%	0.668	58%	0.578	S	S	*	*	H	α-helix	trans	-70.9	-34.5	178.8	-166	160	-0.3	0	0	112.4	G10 V12 A18	G10-Q14 WeakPolarHBondContact O-CB 3.34Å; G10-Q14 PolarHBondContact O-N 3.5Å; V12-Q14 VanDerWaalsContact C-N 3.35Å; V12-Q14 PolarHBondContact O-N 3.49Å; Q14-A18 PolarHBondContact O-N 3.21Å; Q14-A18 VanDerWaalsContact O-N 3.12Å
15	S	55.5	Low	57.6	Low	66 Å²	66	102.9 Å²	102.9	46%	0.462	57%	0.568	S	S	.	*	H	α-helix	trans	-68.9	-37.2	175.5	-60.1	0	0	0	0	112.5	L11 V12 A18 R19	L11-S15 WeakPolarHBondContact O-CB 3.39Å; L11-S15 PolarHBondContact O-N 3.12Å; L11-S15 PolarHBondContact O-OG 2.79Å; V12-S15 PolarHBondContact O-N 3.05Å; S15-A18 PolarHBondContact O-N 2.86Å; S15-R19 WeakPolarHBondContact O-CG 3.44Å; S15-R19 PolarHBondContact O-N 3.04Å
16	D	59.7	Low	58.4	Low	103 Å²	103	103.4 Å²	103.4	55%	0.551	57%	0.568	S	S	*	*	H	α-helix	trans	-66.9	-44.6	177.6	-153.1	-103.8	0	0	0	111	V12 A13 A18 R19 C20	V12-D16 PolarHBondContact O-N 3.06Å; A13-D16 PolarHBondContact O-N 3.12Å; D16-A18 VanDerWaalsContact C-N 3.35Å; D16-A18 PolarHBondContact O-N 3.25Å; D16-R19 PolarHBondContact O-N 3.39Å; D16-C20 WeakPolarHBondContact O-CB 3.48Å; D16-C20 PolarHBondContact O-N 3.44Å; D16-C20 PolarHBondContact O-SG 3.37Å; D16-C20 VanDerWaalsContact O-SG 3.36Å
17	M	58.8	Low	59.1	Low	138 Å²	138	104 Å²	104	68%	0.68	56%	0.557	S	S	*	*	H	α-helix	trans	-61.6	-39.8	174.4	-71.3	-168.5	-141.3	0	0	113	A13 C20 S21	A13-M17 PolarHBondContact O-N 3.44Å; M17-C20 PolarHBondContact O-N 2.89Å; M17-S21 PolarHBondContact O-N 3.36Å
18	A	57.9	Low	59.5	Low	54 Å²	54	107 Å²	107	45%	0.446	56%	0.557	S	S	.	*	H	α-helix	trans	-65.5	-41.4	177.9	0	0	0	0	0	111.7	Q14 S15 D16 S21 V22	Q14-A18 PolarHBondContact O-N 3.21Å; Q14-A18 VanDerWaalsContact O-N 3.12Å; S15-A18 PolarHBondContact O-N 2.86Å; D16-A18 VanDerWaalsContact C-N 3.35Å; D16-A18 PolarHBondContact O-N 3.25Å; A18-S21 PolarHBondContact O-N 3.47Å; A18-V22 WeakPolarHBondContact O-CG2 3.03Å; A18-V22 PolarHBondContact O-N 3.07Å; A18-V22 VanDerWaalsContact O-N 3.07Å
19	R	60.3	Low	60.3	Low	189 Å²	189	102.3 Å²	102.3	71%	0.713	55%	0.551	S	S	*	*	H	α-helix	trans	-65	-42.8	174	-74.2	179.6	177.1	-161.4	-0.4	111.5	S15 D16 S21 V22 V23	S15-R19 WeakPolarHBondContact O-CG 3.44Å; S15-R19 PolarHBondContact O-N 3.04Å; D16-R19 PolarHBondContact O-N 3.39Å; R19-S21 VanDerWaalsContact C-N 3.3Å; R19-S21 PolarHBondContact O-N 3.3Å; R19-V22 PolarHBondContact O-N 3.4Å; R19-V23 WeakPolarHBondContact O-CB 3.2Å; R19-V23 VanDerWaalsContact O-CG2 3.23Å; R19-V23 WeakPolarHBondContact O-CG2 3.23Å; R19-V23 PolarHBondContact O-N 2.94Å
20	C	57.9	Low	60.7	Low	73 Å²	73	94.3 Å²	94.3	49%	0.493	53%	0.53	S	S	.	.	H	α-helix	trans	-58.5	-42.1	173.7	-73.6	0	0	0	0	111.5	D16 M17 W24	D16-C20 WeakPolarHBondContact O-CB 3.48Å; D16-C20 PolarHBondContact O-N 3.44Å; D16-C20 PolarHBondContact O-SG 3.37Å; D16-C20 VanDerWaalsContact O-SG 3.36Å; M17-C20 PolarHBondContact O-N 2.89Å; C20-W24 WeakPolarHBondContact O-CB 3.43Å; C20-W24 PolarHBondContact O-N 2.8Å
21	S	61.8	Low	61.1	Low	85 Å²	85	99.3 Å²	99.3	59%	0.594	54%	0.537	S	S	*	.	H	α-helix	trans	-65.6	-44.7	179.4	-172.2	0	0	0	0	112.7	M17 A18 R19 G25	M17-S21 PolarHBondContact O-N 3.36Å; A18-S21 PolarHBondContact O-N 3.47Å; R19-S21 VanDerWaalsContact C-N 3.3Å; R19-S21 PolarHBondContact O-N 3.3Å; S21-G25 WeakPolarHBondContact O-CA 3.34Å; S21-G25 PolarHBondContact O-N 3.39Å
22	V	65.1	Low	61.1	Low	107 Å²	107	101 Å²	101	65%	0.648	54%	0.537	S	S	*	.	H	α-helix	trans	-69.1	-43.2	179.4	178.4	0	0	0	0	111.1	A18 R19 G25 A26	A18-V22 WeakPolarHBondContact O-CG2 3.03Å; A18-V22 PolarHBondContact O-N 3.07Å; A18-V22 VanDerWaalsContact O-N 3.07Å; R19-V22 PolarHBondContact O-N 3.4Å; V22-G25 PolarHBondContact O-N 2.83Å; V22-A26 WeakPolarHBondContact O-CB 3.5Å; V22-A26 PolarHBondContact O-N 2.84Å
23	V	68.2	Low	61.1	Low	102 Å²	102	99.2 Å²	99.2	62%	0.618	53%	0.533	S	S	*	.	H	α-helix	trans	-65.5	-43	177.8	172.9	0	0	0	0	110.7	R19 W27	R19-V23 WeakPolarHBondContact O-CB 3.2Å; R19-V23 VanDerWaalsContact O-CG2 3.23Å; R19-V23 WeakPolarHBondContact O-CG2 3.23Å; R19-V23 PolarHBondContact O-N 2.94Å; V23-W27 VanDerWaalsContact O-CB 3.29Å; V23-W27 WeakPolarHBondContact O-CB 3.37Å; V23-W27 PolarHBondContact O-N 2.74Å
24	W	57.2	Low	61.4	Low	168 Å²	168	105.8 Å²	105.8	64%	0.636	55%	0.548	S	S	*	.	H	α-helix	trans	-67.2	-43.6	177.7	-165.7	-76.6	0	0	0	111.6	C20 W27 W28	C20-W24 WeakPolarHBondContact O-CB 3.43Å; C20-W24 PolarHBondContact O-N 2.8Å; W24-W27 PolarHBondContact O-N 2.84Å; W24-W28 AromaticContact CD1-CD1 3.56Å; W24-W28 AromaticContact CD1-NE1 3.93Å; W24-W28 AromaticContact CE2-NE1 3.93Å; W24-W28 AromaticContact NE1-CD1 3.29Å; W24-W28 VanDerWaalsContact NE1-CD1 3.29Å; W24-W28 AromaticContact NE1-NE1 3.18Å; W24-W28 VanDerWaalsContact NE1-NE1 3.18Å; W24-W28 WeakPolarHBondContact O-CB 3.37Å; W24-W28 PolarHBondContact O-N 3.38Å
25	G	71.1	Confident	61.5	Low	33 Å²	33	101.4 Å²	101.4	34%	0.34	54%	0.541	S	S	.	.	H	α-helix	trans	-63.3	-41.6	176.5	0	0	0	0	0	112.7	S21 V22 S29	S21-G25 WeakPolarHBondContact O-CA 3.34Å; S21-G25 PolarHBondContact O-N 3.39Å; V22-G25 PolarHBondContact O-N 2.83Å; G25-S29 VanDerWaalsContact O-CB 3.29Å; G25-S29 WeakPolarHBondContact O-CB 3.29Å; G25-S29 PolarHBondContact O-N 2.92Å; G25-S29 PolarHBondContact O-OG 3.29Å
26	A	70.7	Confident	61.4	Low	58 Å²	58	100 Å²	100	48%	0.479	54%	0.538	S	S	.	.	H	α-helix	trans	-65.9	-42.5	174.4	0	0	0	0	0	111.7	V22 S29 A30	V22-A26 WeakPolarHBondContact O-CB 3.5Å; V22-A26 PolarHBondContact O-N 2.84Å; A26-S29 PolarHBondContact O-N 2.81Å; A26-A30 VanDerWaalsContact O-CB 3.3Å; A26-A30 WeakPolarHBondContact O-CB 3.4Å; A26-A30 PolarHBondContact O-N 3.33Å
27	W	72	Confident	61	Low	124 Å²	124	98.5 Å²	98.5	47%	0.47	54%	0.539	S	S	.	.	H	α-helix	trans	-67.3	-40.7	178	-169.1	79	0	0	0	112.6	V23 W24 R31	V23-W27 VanDerWaalsContact O-CB 3.29Å; V23-W27 WeakPolarHBondContact O-CB 3.37Å; V23-W27 PolarHBondContact O-N 2.74Å; W24-W27 PolarHBondContact O-N 2.84Å; W27-R31 WeakPolarHBondContact O-CB 3.27Å; W27-R31 PolarHBondContact O-N 2.86Å
28	W	59.6	Low	60.7	Low	120 Å²	120	97.1 Å²	97.1	46%	0.455	54%	0.538	S	S	.	.	H	α-helix	trans	-60.2	-52.4	170.4	-99.8	57.2	0	0	0	110.7	W24 A30 R31 Y32	W24-W28 AromaticContact CD1-CD1 3.56Å; W24-W28 AromaticContact CD1-NE1 3.93Å; W24-W28 AromaticContact CE2-NE1 3.93Å; W24-W28 AromaticContact NE1-CD1 3.29Å; W24-W28 VanDerWaalsContact NE1-CD1 3.29Å; W24-W28 AromaticContact NE1-NE1 3.18Å; W24-W28 VanDerWaalsContact NE1-NE1 3.18Å; W24-W28 WeakPolarHBondContact O-CB 3.37Å; W24-W28 PolarHBondContact O-N 3.38Å; W28-A30 VanDerWaalsContact C-N 3.29Å; W28-A30 PolarHBondContact O-N 2.88Å; W28-R31 PolarHBondContact O-N 2.88Å; W28-Y32 HydrophobicContact CB-CD2 4.43Å; W28-Y32 HydrophobicContact CD2-CD2 4.18Å; W28-Y32 AromaticContact CD2-CE2 3.58Å; W28-Y32 HydrophobicContact CD2-CE2 3.58Å; W28-Y32 AromaticContact CE3-CD2 3.82Å; W28-Y32 HydrophobicContact CE3-CD2 3.82Å; W28-Y32 AromaticContact CE3-CE2 3.19Å; W28-Y32 HydrophobicContact CE3-CE2 3.19Å; W28-Y32 AromaticContact CE3-CZ 3.96Å; W28-Y32 HydrophobicContact CG-CD2 4.5Å; W28-Y32 HydrophobicContact CG-CE2 4.26Å; W28-Y32 AromaticContact CH2-CE2 3.97Å; W28-Y32 HydrophobicContact CH2-CE2 3.97Å; W28-Y32 WeakPolarHBondContact CH2-OH 3.29Å; W28-Y32 HydrophobicContact CZ2-CE2 4.31Å; W28-Y32 HydrophobicContact CZ3-CD2 4.37Å; W28-Y32 AromaticContact CZ3-CE2 3.4Å; W28-Y32 HydrophobicContact CZ3-CE2 3.4Å; W28-Y32 VanDerWaalsContact CZ3-CE2 3.4Å; W28-Y32 AromaticContact CZ3-CZ 3.67Å; W28-Y32 WeakPolarHBondContact CZ3-OH 3.3Å; W28-Y32 VanDerWaalsContact O-CD2 3.27Å; W28-Y32 WeakPolarHBondContact O-CD2 3.39Å; W28-Y32 PolarHBondContact O-N 3.47Å
29	S	65.2	Low	60.2	Low	81 Å²	81	104.3 Å²	104.3	57%	0.566	55%	0.554	S	S	*	*	H	α-helix	trans	-56.9	-42.8	179.9	-59.7	0	0	0	0	111.9	G25 A26 R31 A33	G25-S29 VanDerWaalsContact O-CB 3.29Å; G25-S29 WeakPolarHBondContact O-CB 3.29Å; G25-S29 PolarHBondContact O-N 2.92Å; G25-S29 PolarHBondContact O-OG 3.29Å; A26-S29 PolarHBondContact O-N 2.81Å; S29-R31 PolarHBondContact O-N 3.05Å; S29-A33 WeakPolarHBondContact O-CB 3.16Å; S29-A33 PolarHBondContact O-N 3.46Å
30	A	63.4	Low	59.4	Low	42 Å²	42	99.7 Å²	99.7	35%	0.347	55%	0.55	S	S	.	.	H	α-helix	trans	-69.3	-29.5	178	0	0	0	0	0	113.8	A26 W28 R34	A26-A30 VanDerWaalsContact O-CB 3.3Å; A26-A30 WeakPolarHBondContact O-CB 3.4Å; A26-A30 PolarHBondContact O-N 3.33Å; W28-A30 VanDerWaalsContact C-N 3.29Å; W28-A30 PolarHBondContact O-N 2.88Å; A30-R34 PolarHBondContact O-NE 3.46Å; A30-R34 VanDerWaalsContact O-NE 3.16Å
31	R	63.5	Low	59.2	Low	144 Å²	144	98.5 Å²	98.5	54%	0.543	55%	0.55	S	S	.	.	H	α-helix	trans	-80.3	-42.1	176.6	-172.3	-179	-88.3	-173.3	-11	111.5	W27 W28 S29 R34 G35	W27-R31 WeakPolarHBondContact O-CB 3.27Å; W27-R31 PolarHBondContact O-N 2.86Å; W28-R31 PolarHBondContact O-N 2.88Å; S29-R31 PolarHBondContact O-N 3.05Å; R31-R34 PolarHBondContact O-N 3.27Å; R31-G35 PolarHBondContact O-N 2.9Å
32	Y	49.1	Very low	58.8	Low	140 Å²	140	98.9 Å²	98.9	55%	0.549	55%	0.548	S	S	.	.	H	α-helix	trans	-70.8	-36.4	176.8	-80.7	-85.4	0	0	0	112.6	W28 R34 G35 G36	W28-Y32 HydrophobicContact CB-CD2 4.43Å; W28-Y32 HydrophobicContact CD2-CD2 4.18Å; W28-Y32 AromaticContact CD2-CE2 3.58Å; W28-Y32 HydrophobicContact CD2-CE2 3.58Å; W28-Y32 AromaticContact CE3-CD2 3.82Å; W28-Y32 HydrophobicContact CE3-CD2 3.82Å; W28-Y32 AromaticContact CE3-CE2 3.19Å; W28-Y32 HydrophobicContact CE3-CE2 3.19Å; W28-Y32 AromaticContact CE3-CZ 3.96Å; W28-Y32 HydrophobicContact CG-CD2 4.5Å; W28-Y32 HydrophobicContact CG-CE2 4.26Å; W28-Y32 AromaticContact CH2-CE2 3.97Å; W28-Y32 HydrophobicContact CH2-CE2 3.97Å; W28-Y32 WeakPolarHBondContact CH2-OH 3.29Å; W28-Y32 HydrophobicContact CZ2-CE2 4.31Å; W28-Y32 HydrophobicContact CZ3-CD2 4.37Å; W28-Y32 AromaticContact CZ3-CE2 3.4Å; W28-Y32 HydrophobicContact CZ3-CE2 3.4Å; W28-Y32 VanDerWaalsContact CZ3-CE2 3.4Å; W28-Y32 AromaticContact CZ3-CZ 3.67Å; W28-Y32 WeakPolarHBondContact CZ3-OH 3.3Å; W28-Y32 VanDerWaalsContact O-CD2 3.27Å; W28-Y32 WeakPolarHBondContact O-CD2 3.39Å; W28-Y32 PolarHBondContact O-N 3.47Å; Y32-R34 VanDerWaalsContact C-N 3.33Å; Y32-R34 PolarHBondContact O-N 3.03Å; Y32-G35 PolarHBondContact O-N 3.16Å; Y32-G36 PolarHBondContact O-N 3.01Å
33	A	56.5	Low	58.3	Low	66 Å²	66	98.4 Å²	98.4	55%	0.545	55%	0.545	S	S	.	.	H	α-helix	trans	-62.2	-40.8	173.9	0	0	0	0	0	111.9	S29 A37	S29-A33 WeakPolarHBondContact O-CB 3.16Å; S29-A33 PolarHBondContact O-N 3.46Å; A33-A37 PolarHBondContact O-N 3.33Å
34	R	58.6	Low	57.5	Low	185 Å²	185	96.3 Å²	96.3	70%	0.698	54%	0.539	S	S	*	.	H	α-helix	trans	-69.6	-36.5	174.9	-80.8	-175.1	-73.3	-156.5	0.1	113.1	A30 R31 Y32	A30-R34 PolarHBondContact O-NE 3.46Å; A30-R34 VanDerWaalsContact O-NE 3.16Å; R31-R34 PolarHBondContact O-N 3.27Å; Y32-R34 VanDerWaalsContact C-N 3.33Å; Y32-R34 PolarHBondContact O-N 3.03Å
35	G	58.9	Low	57.4	Low	51 Å²	51	98.4 Å²	98.4	53%	0.526	55%	0.547	S	S	.	.	H	α-helix	trans	-73.1	-35.6	176.1	0	0	0	0	0	114.2	R31 Y32	R31-G35 PolarHBondContact O-N 2.9Å; Y32-G35 PolarHBondContact O-N 3.16Å
36	G	53.8	Low	56.7	Low	38 Å²	38	103.8 Å²	103.8	39%	0.392	56%	0.561	S	S	.	*	H	α-helix	trans	-75.4	-37.2	-175.4	0	0	0	0	0	113.9	Y32 V38 R39 C40	Y32-G36 PolarHBondContact O-N 3.01Å; G36-V38 VanDerWaalsContact C-N 3.3Å; G36-V38 PolarHBondContact O-N 3.31Å; G36-R39 PolarHBondContact O-N 2.77Å; G36-C40 PolarHBondContact O-N 3.12Å; G36-C40 VanDerWaalsContact O-N 3.12Å
37	A	52.5	Low	56	Low	71 Å²	71	102.6 Å²	102.6	59%	0.587	55%	0.554	S	S	*	*	H	α-helix	trans	-62.9	-35.8	-178.1	0	0	0	0	0	112.7	A33 R39 G41	A33-A37 PolarHBondContact O-N 3.33Å; A37-R39 PolarHBondContact O-N 2.9Å; A37-G41 PolarHBondContact O-N 3.22Å
38	V	51.9	Low	55.2	Low	109 Å²	109	103.8 Å²	103.8	66%	0.661	57%	0.567	S	S	*	*	H	α-helix	trans	-74.5	-27.8	-177.9	-165.9	0	0	0	0	111.7	G36	G36-V38 VanDerWaalsContact C-N 3.3Å; G36-V38 PolarHBondContact O-N 3.31Å
39	R	48.1	Very low	55	Low	205 Å²	205	101 Å²	101	77%	0.774	57%	0.569	S	S	*	*	H	α-helix	trans	-83	-34.3	177.7	-124.4	177.5	-174.7	128.7	-0.9	112.8	G36 A37 G41 V43	G36-R39 PolarHBondContact O-N 2.77Å; A37-R39 PolarHBondContact O-N 2.9Å; R39-G41 PolarHBondContact O-N 3.16Å; R39-V43 WeakPolarHBondContact O-CB 3.06Å; R39-V43 VanDerWaalsContact O-CG2 3.26Å; R39-V43 WeakPolarHBondContact O-CG2 3.29Å; R39-V43 PolarHBondContact O-N 3.35Å; R39-V43 VanDerWaalsContact O-N 3.16Å
40	C	43.2	Very low	54.5	Low	92 Å²	92	103 Å²	103	62%	0.622	57%	0.572	S	S	*	*	H	α-helix	trans	-66.3	-36.5	177.5	-94.4	0	0	0	0	113	G36 V42 A44	G36-C40 PolarHBondContact O-N 3.12Å; G36-C40 VanDerWaalsContact O-N 3.12Å; C40-V42 PolarHBondContact O-N 2.92Å; C40-A44 WeakPolarHBondContact O-CB 3.45Å; C40-A44 PolarHBondContact O-N 3.42Å
41	G	52.8	Low	54.1	Low	48 Å²	48	104.2 Å²	104.2	50%	0.495	58%	0.578	S	S	.	*	H	α-helix	trans	-62.2	-44.5	179.7	0	0	0	0	0	113.5	A37 R39 R45	A37-G41 PolarHBondContact O-N 3.22Å; R39-G41 PolarHBondContact O-N 3.16Å; G41-R45 PolarHBondContact O-N 3.46Å
42	V	54.6	Low	53.8	Low	93 Å²	93	99.7 Å²	99.7	56%	0.564	58%	0.576	S	S	*	*	H	α-helix	trans	-76.3	-38.4	-178.4	-177.7	0	0	0	0	111.6	C40 R45 K46	C40-V42 PolarHBondContact O-N 2.92Å; V42-R45 PolarHBondContact O-N 3.45Å; V42-K46 PolarHBondContact O-N 3.49Å
43	V	54.1	Low	54.2	Low	97 Å²	97	98.2 Å²	98.2	59%	0.588	58%	0.581	S	S	*	*	H	α-helix	trans	-68.9	-39.3	177.5	176.3	0	0	0	0	111	R39 R45 K46 G47	R39-V43 WeakPolarHBondContact O-CB 3.06Å; R39-V43 VanDerWaalsContact O-CG2 3.26Å; R39-V43 WeakPolarHBondContact O-CG2 3.29Å; R39-V43 PolarHBondContact O-N 3.35Å; R39-V43 VanDerWaalsContact O-N 3.16Å; V43-R45 PolarHBondContact O-N 3.49Å; V43-K46 PolarHBondContact O-N 2.78Å; V43-G47 PolarHBondContact O-N 3.49Å
44	A	50.6	Low	54.2	Low	58 Å²	58	97.9 Å²	97.9	48%	0.479	58%	0.579	S	S	.	*	H	α-helix	trans	-63.3	-42.3	174.9	0	0	0	0	0	111.6	C40 G47 M48	C40-A44 WeakPolarHBondContact O-CB 3.45Å; C40-A44 PolarHBondContact O-N 3.42Å; A44-G47 PolarHBondContact O-N 3.49Å; A44-M48 WeakPolarHBondContact O-CB 3.24Å; A44-M48 VanDerWaalsContact O-CG 3.28Å; A44-M48 WeakPolarHBondContact O-CG 3.46Å; A44-M48 PolarHBondContact O-N 3.19Å
45	R	54.4	Low	54	Low	212 Å²	212	98.1 Å²	98.1	80%	0.8	58%	0.58	S	S	*	*	H	α-helix	trans	-66.7	-40.7	179.2	-152.9	176.9	-162.7	176.9	5.1	112.4	G41 V42 V43 A49	G41-R45 PolarHBondContact O-N 3.46Å; V42-R45 PolarHBondContact O-N 3.45Å; V43-R45 PolarHBondContact O-N 3.49Å; R45-A49 WeakPolarHBondContact O-CB 3.13Å; R45-A49 PolarHBondContact O-N 2.88Å
46	K	56.5	Low	53.9	Low	146 Å²	146	104.1 Å²	104.1	64%	0.635	59%	0.587	S	S	*	*	H	α-helix	trans	-70.7	-40.2	174.1	-83.9	-172.6	172.5	-173.9	0	112.6	V42 V43 A49 L50	V42-K46 PolarHBondContact O-N 3.49Å; V43-K46 PolarHBondContact O-N 2.78Å; K46-A49 PolarHBondContact O-N 3.16Å; K46-L50 WeakPolarHBondContact O-CB 3.45Å; K46-L50 VanDerWaalsContact O-CG 3.27Å; K46-L50 WeakPolarHBondContact O-CG 3.28Å; K46-L50 PolarHBondContact O-N 3.45Å
47	G	56.3	Low	54.2	Low	33 Å²	33	103.9 Å²	103.9	34%	0.34	58%	0.584	S	S	.	*	H	α-helix	trans	-62.5	-45.2	178.7	0	0	0	0	0	112.4	V43 A44 A49 L50 C51	V43-G47 PolarHBondContact O-N 3.49Å; A44-G47 PolarHBondContact O-N 3.49Å; G47-A49 PolarHBondContact O-N 3.26Å; G47-L50 PolarHBondContact O-N 2.96Å; G47-C51 PolarHBondContact O-N 3.1Å
48	M	55.4	Low	54.5	Low	149 Å²	149	103.5 Å²	103.5	73%	0.734	58%	0.581	S	S	*	*	H	α-helix	trans	-64.8	-40.2	176.6	-69.4	-64.2	-170.6	0	0	112.3	A44 C51 G52	A44-M48 WeakPolarHBondContact O-CB 3.24Å; A44-M48 VanDerWaalsContact O-CG 3.28Å; A44-M48 WeakPolarHBondContact O-CG 3.46Å; A44-M48 PolarHBondContact O-N 3.19Å; M48-C51 PolarHBondContact O-N 2.76Å; M48-G52 PolarHBondContact O-N 3.44Å
49	A	55.9	Low	54.8	Low	61 Å²	61	102.5 Å²	102.5	50%	0.504	58%	0.575	S	S	.	*	H	α-helix	trans	-65.2	-40.8	176.3	0	0	0	0	0	112.3	R45 K46 G47 G52 V53	R45-A49 WeakPolarHBondContact O-CB 3.13Å; R45-A49 PolarHBondContact O-N 2.88Å; K46-A49 PolarHBondContact O-N 3.16Å; G47-A49 PolarHBondContact O-N 3.26Å; A49-G52 PolarHBondContact O-N 3.47Å; A49-V53 WeakPolarHBondContact O-CG2 3.26Å; A49-V53 PolarHBondContact O-N 3.17Å; A49-V53 VanDerWaalsContact O-N 3.15Å
50	L	54.3	Low	55	Low	122 Å²	122	100.7 Å²	100.7	64%	0.639	57%	0.568	S	S	*	*	H	α-helix	trans	-68.6	-38.6	177.3	-71.9	171	0	0	0	112.1	K46 G47 V53 A54	K46-L50 WeakPolarHBondContact O-CB 3.45Å; K46-L50 VanDerWaalsContact O-CG 3.27Å; K46-L50 WeakPolarHBondContact O-CG 3.28Å; K46-L50 PolarHBondContact O-N 3.45Å; G47-L50 PolarHBondContact O-N 2.96Å; L50-V53 PolarHBondContact O-N 3.19Å; L50-A54 WeakPolarHBondContact O-CB 3.44Å; L50-A54 PolarHBondContact O-N 3.49Å
51	C	56	Low	56	Low	68 Å²	68	104.9 Å²	104.9	46%	0.459	57%	0.571	S	S	.	*	H	α-helix	trans	-60.3	-51.6	172.1	-78.9	0	0	0	0	110.5	G47 M48 V53 A54 W55	G47-C51 PolarHBondContact O-N 3.1Å; M48-C51 PolarHBondContact O-N 2.76Å; C51-V53 VanDerWaalsContact C-N 3.3Å; C51-V53 PolarHBondContact O-N 2.75Å; C51-A54 PolarHBondContact O-N 3.11Å; C51-A54 VanDerWaalsContact O-N 3.16Å; C51-W55 WeakPolarHBondContact O-CB 3.14Å; C51-W55 PolarHBondContact O-N 3.08Å
52	G	57.1	Low	56.5	Low	49 Å²	49	104.3 Å²	104.3	51%	0.505	57%	0.565	S	S	.	*	H	α-helix	trans	-55.1	-43.1	-179.7	0	0	0	0	0	113.6	M48 A49 R56	M48-G52 PolarHBondContact O-N 3.44Å; A49-G52 PolarHBondContact O-N 3.47Å; G52-R56 PolarHBondContact O-N 3.37Å
53	V	57.4	Low	56.8	Low	109 Å²	109	103.7 Å²	103.7	66%	0.661	56%	0.561	S	S	*	*	H	α-helix	trans	-72.7	-41.4	178.1	175.2	0	0	0	0	112.1	A49 L50 C51 R56 G57	A49-V53 WeakPolarHBondContact O-CG2 3.26Å; A49-V53 PolarHBondContact O-N 3.17Å; A49-V53 VanDerWaalsContact O-N 3.15Å; L50-V53 PolarHBondContact O-N 3.19Å; C51-V53 VanDerWaalsContact C-N 3.3Å; C51-V53 PolarHBondContact O-N 2.75Å; V53-R56 PolarHBondContact O-N 3.07Å; V53-G57 PolarHBondContact O-N 2.77Å
54	A	55.3	Low	57	Low	60 Å²	60	101.6 Å²	101.6	50%	0.496	55%	0.554	S	S	.	*	H	α-helix	trans	-65	-41.3	179.7	0	0	0	0	0	112	L50 C51 R56 G57 A58	L50-A54 WeakPolarHBondContact O-CB 3.44Å; L50-A54 PolarHBondContact O-N 3.49Å; C51-A54 PolarHBondContact O-N 3.11Å; C51-A54 VanDerWaalsContact O-N 3.16Å; A54-R56 VanDerWaalsContact C-N 3.35Å; A54-R56 PolarHBondContact O-N 3.44Å; A54-G57 PolarHBondContact O-N 3.5Å; A54-A58 VanDerWaalsContact O-CB 3.24Å; A54-A58 WeakPolarHBondContact O-CB 3.01Å; A54-A58 PolarHBondContact O-N 3.07Å
55	W	54.6	Low	57.6	Low	189 Å²	189	107.8 Å²	107.8	72%	0.716	57%	0.565	S	S	*	*	H	α-helix	trans	-63.7	-40.5	176.7	-82.7	85.7	0	0	0	111.9	C51 T59	C51-W55 WeakPolarHBondContact O-CB 3.14Å; C51-W55 PolarHBondContact O-N 3.08Å; W55-T59 WeakPolarHBondContact O-CB 3.4Å; W55-T59 PolarHBondContact O-N 3.41Å; W55-T59 PolarHBondContact O-OG1 3.33Å
56	R	57.9	Low	58.3	Low	178 Å²	178	106.5 Å²	106.5	67%	0.672	56%	0.56	S	S	*	*	H	α-helix	trans	-64.4	-51.1	173	-124.3	175	-178.4	-114.2	0.6	110.7	G52 V53 A54 A58 T59 W60	G52-R56 PolarHBondContact O-N 3.37Å; V53-R56 PolarHBondContact O-N 3.07Å; A54-R56 VanDerWaalsContact C-N 3.35Å; A54-R56 PolarHBondContact O-N 3.44Å; R56-A58 PolarHBondContact O-N 3.16Å; R56-T59 PolarHBondContact O-N 2.91Å; R56-W60 PolarHBondContact O-N 3.36Å; R56-W60 VanDerWaalsContact O-N 3.09Å
57	G	58.5	Low	58.8	Low	32 Å²	32	103 Å²	103	33%	0.33	55%	0.554	S	S	.	*	H	α-helix	trans	-60.6	-39.8	-179.3	0	0	0	0	0	114.1	V53 A54 R61	V53-G57 PolarHBondContact O-N 2.77Å; A54-G57 PolarHBondContact O-N 3.5Å; G57-R61 WeakPolarHBondContact O-CB 3.28Å; G57-R61 WeakPolarHBondContact O-CG 3.48Å; G57-R61 PolarHBondContact O-N 2.96Å
58	A	59.4	Low	59.2	Low	64 Å²	64	105.6 Å²	105.6	53%	0.529	56%	0.563	S	S	.	*	H	α-helix	trans	-67.2	-42	178.1	0	0	0	0	0	111.7	A54 R56 R61 G62	A54-A58 VanDerWaalsContact O-CB 3.24Å; A54-A58 WeakPolarHBondContact O-CB 3.01Å; A54-A58 PolarHBondContact O-N 3.07Å; R56-A58 PolarHBondContact O-N 3.16Å; A58-R61 PolarHBondContact O-N 3.46Å; A58-G62 PolarHBondContact O-N 3.4Å
59	T	57.4	Low	59.7	Low	87 Å²	87	101.1 Å²	101.1	53%	0.534	55%	0.55	S	S	.	.	H	α-helix	trans	-63.2	-47.2	177.7	-52.4	0	0	0	0	110.8	W55 R56 R61 G62 V63	W55-T59 WeakPolarHBondContact O-CB 3.4Å; W55-T59 PolarHBondContact O-N 3.41Å; W55-T59 PolarHBondContact O-OG1 3.33Å; R56-T59 PolarHBondContact O-N 2.91Å; T59-R61 PolarHBondContact O-N 3.26Å; T59-G62 PolarHBondContact O-N 3.48Å; T59-V63 WeakPolarHBondContact O-CG2 3.42Å; T59-V63 PolarHBondContact O-N 3.01Å
60	W	54.2	Low	60.1	Low	168 Å²	168	107 Å²	107	64%	0.636	56%	0.559	S	S	*	*	H	α-helix	trans	-63.2	-41.4	177.4	-71.9	110.5	0	0	0	112.8	R56 A64	R56-W60 PolarHBondContact O-N 3.36Å; R56-W60 VanDerWaalsContact O-N 3.09Å; W60-A64 WeakPolarHBondContact O-CB 3.37Å; W60-A64 PolarHBondContact O-N 3.08Å
61	R	63.8	Low	60.9	Low	180 Å²	180	109.5 Å²	109.5	68%	0.679	56%	0.56	S	S	*	*	H	α-helix	trans	-66.6	-38	176.8	-76.3	-178.4	-178.8	-166.3	0.7	112.5	G57 A58 T59 R65	G57-R61 WeakPolarHBondContact O-CB 3.28Å; G57-R61 WeakPolarHBondContact O-CG 3.48Å; G57-R61 PolarHBondContact O-N 2.96Å; A58-R61 PolarHBondContact O-N 3.46Å; T59-R61 PolarHBondContact O-N 3.26Å; R61-R65 WeakPolarHBondContact O-CB 3.33Å; R61-R65 VanDerWaalsContact O-CG 3.31Å; R61-R65 WeakPolarHBondContact O-CG 3.38Å; R61-R65 PolarHBondContact O-N 2.96Å
62	G	62.8	Low	61.6	Low	35 Å²	35	110.3 Å²	110.3	36%	0.361	56%	0.56	S	S	.	*	H	α-helix	trans	-65.2	-45.8	176.6	0	0	0	0	0	112.3	A58 T59 R66	A58-G62 PolarHBondContact O-N 3.4Å; T59-G62 PolarHBondContact O-N 3.48Å; G62-R66 PolarHBondContact O-N 3.14Å
63	V	60.3	Low	62	Low	80 Å²	80	112.6 Å²	112.6	49%	0.485	56%	0.564	S	S	.	*	H	α-helix	trans	-64.8	-47.1	177.6	174.5	0	0	0	0	111	T59 R65 R66 S67	T59-V63 WeakPolarHBondContact O-CG2 3.42Å; T59-V63 PolarHBondContact O-N 3.01Å; V63-R65 PolarHBondContact O-N 3.34Å; V63-R66 PolarHBondContact O-N 3.03Å; V63-S67 PolarHBondContact O-N 3.34Å; V63-S67 PolarHBondContact O-OG 3Å
64	A	59.7	Low	62.4	Low	54 Å²	54	110.2 Å²	110.2	45%	0.446	56%	0.555	S	S	.	*	H	α-helix	trans	-61.7	-43.3	179.6	0	0	0	0	0	112.3	W60 S67 V68	W60-A64 WeakPolarHBondContact O-CB 3.37Å; W60-A64 PolarHBondContact O-N 3.08Å; A64-S67 PolarHBondContact O-N 3.46Å; A64-V68 WeakPolarHBondContact O-CG2 3.31Å; A64-V68 PolarHBondContact O-N 3.35Å
65	R	62.7	Low	62.8	Low	188 Å²	188	115.5 Å²	115.5	71%	0.709	56%	0.562	S	S	*	*	H	α-helix	trans	-64	-41.8	177	-77.1	-179.4	178.6	172.7	-1.5	112.5	R61 V63 V68 A69	R61-R65 WeakPolarHBondContact O-CB 3.33Å; R61-R65 VanDerWaalsContact O-CG 3.31Å; R61-R65 WeakPolarHBondContact O-CG 3.38Å; R61-R65 PolarHBondContact O-N 2.96Å; V63-R65 PolarHBondContact O-N 3.34Å; R65-V68 PolarHBondContact O-N 2.9Å; R65-A69 WeakPolarHBondContact O-CB 3.36Å; R65-A69 PolarHBondContact O-N 3.4Å
66	R	68.6	Low	63.5	Low	185 Å²	185	114.2 Å²	114.2	70%	0.698	56%	0.557	S	S	*	*	H	α-helix	trans	-60.6	-50.4	174.4	-95.9	176.7	158.4	-166.8	-5.2	110.6	G62 V63 V68 A69 W70	G62-R66 PolarHBondContact O-N 3.14Å; V63-R66 PolarHBondContact O-N 3.03Å; R66-V68 VanDerWaalsContact C-N 3.31Å; R66-V68 PolarHBondContact O-N 2.98Å; R66-A69 PolarHBondContact O-N 3.4Å; R66-A69 VanDerWaalsContact O-N 3.17Å; R66-W70 PolarHBondContact O-N 2.95Å
67	S	67.4	Low	64.2	Low	71 Å²	71	107.6 Å²	107.6	50%	0.497	55%	0.545	S	S	.	.	H	α-helix	trans	-59.1	-40.1	-178.9	-63	0	0	0	0	113	V63 A64 R71	V63-S67 PolarHBondContact O-N 3.34Å; V63-S67 PolarHBondContact O-OG 3Å; A64-S67 PolarHBondContact O-N 3.46Å; S67-R71 WeakPolarHBondContact O-CB 3.33Å; S67-R71 PolarHBondContact O-N 2.99Å; S67-R71 VanDerWaalsContact O-N 3.11Å
68	V	64.7	Low	64.4	Low	89 Å²	89	109.9 Å²	109.9	54%	0.539	55%	0.552	S	S	.	*	H	α-helix	trans	-65.4	-46.9	175.7	173.6	0	0	0	0	111	A64 R65 R66 W70 R71 D72	A64-V68 WeakPolarHBondContact O-CG2 3.31Å; A64-V68 PolarHBondContact O-N 3.35Å; R65-V68 PolarHBondContact O-N 2.9Å; R66-V68 VanDerWaalsContact C-N 3.31Å; R66-V68 PolarHBondContact O-N 2.98Å; V68-W70 VanDerWaalsContact C-N 3.35Å; V68-W70 PolarHBondContact O-N 3.22Å; V68-R71 PolarHBondContact O-N 3.4Å; V68-R71 VanDerWaalsContact O-N 3.14Å; V68-D72 PolarHBondContact O-N 2.95Å
69	A	66.1	Low	64.4	Low	54 Å²	54	109.3 Å²	109.3	45%	0.446	55%	0.548	S	S	.	.	H	α-helix	trans	-60	-42.5	179.4	0	0	0	0	0	112.6	R65 R66 R71 D72 V73	R65-A69 WeakPolarHBondContact O-CB 3.36Å; R65-A69 PolarHBondContact O-N 3.4Å; R66-A69 PolarHBondContact O-N 3.4Å; R66-A69 VanDerWaalsContact O-N 3.17Å; A69-R71 VanDerWaalsContact C-N 3.34Å; A69-R71 PolarHBondContact O-N 3.06Å; A69-D72 PolarHBondContact O-N 3.49Å; A69-V73 VanDerWaalsContact O-CG2 3.29Å; A69-V73 WeakPolarHBondContact O-CG2 3.36Å; A69-V73 PolarHBondContact O-N 3.11Å
70	W	63.9	Low	64.5	Low	184 Å²	184	113.9 Å²	113.9	70%	0.697	56%	0.555	S	S	*	*	H	α-helix	trans	-64.4	-39.2	176.2	-73.3	111.1	0	0	0	112.3	R66 V68 A74	R66-W70 PolarHBondContact O-N 2.95Å; V68-W70 VanDerWaalsContact C-N 3.35Å; V68-W70 PolarHBondContact O-N 3.22Å; W70-A74 WeakPolarHBondContact O-CB 3.42Å; W70-A74 PolarHBondContact O-N 3.38Å
71	R	70.6	Confident	65.1	Low	176 Å²	176	114.6 Å²	114.6	66%	0.664	56%	0.558	S	S	*	*	H	α-helix	trans	-65.6	-48.4	178.6	-165	165	169.9	176.6	-1.2	110.3	S67 V68 A69 V73 A74 W75	S67-R71 WeakPolarHBondContact O-CB 3.33Å; S67-R71 PolarHBondContact O-N 2.99Å; S67-R71 VanDerWaalsContact O-N 3.11Å; V68-R71 PolarHBondContact O-N 3.4Å; V68-R71 VanDerWaalsContact O-N 3.14Å; A69-R71 VanDerWaalsContact C-N 3.34Å; A69-R71 PolarHBondContact O-N 3.06Å; R71-V73 PolarHBondContact O-N 3.49Å; R71-A74 PolarHBondContact O-N 2.98Å; R71-W75 PolarHBondContact O-N 3.05Å
72	D	70.2	Confident	65	Low	85 Å²	85	113.6 Å²	113.6	46%	0.455	55%	0.554	S	S	.	*	H	α-helix	trans	-57.1	-44.7	176.2	-100.6	-72.2	0	0	0	113.1	V68 A69 W75 R76	V68-D72 PolarHBondContact O-N 2.95Å; A69-D72 PolarHBondContact O-N 3.49Å; D72-W75 PolarHBondContact O-N 3.14Å; D72-R76 WeakPolarHBondContact O-CG 3.49Å; D72-R76 PolarHBondContact O-N 3.17Å
73	V	66.8	Low	64.9	Low	97 Å²	97	116.6 Å²	116.6	59%	0.588	57%	0.565	S	S	*	*	H	α-helix	trans	-64.3	-42.8	177.9	172.3	0	0	0	0	111.1	A69 R71 R76 G77	A69-V73 VanDerWaalsContact O-CG2 3.29Å; A69-V73 WeakPolarHBondContact O-CG2 3.36Å; A69-V73 PolarHBondContact O-N 3.11Å; R71-V73 PolarHBondContact O-N 3.49Å; V73-R76 PolarHBondContact O-N 3.49Å; V73-G77 PolarHBondContact O-N 3.32Å
74	A	65.5	Low	64.9	Low	58 Å²	58	115.5 Å²	115.5	48%	0.479	57%	0.565	S	S	.	*	H	α-helix	trans	-63.1	-43.1	177.3	0	0	0	0	0	111.9	W70 R71 G77 V78	W70-A74 WeakPolarHBondContact O-CB 3.42Å; W70-A74 PolarHBondContact O-N 3.38Å; R71-A74 PolarHBondContact O-N 2.98Å; A74-G77 PolarHBondContact O-N 3.02Å; A74-V78 WeakPolarHBondContact O-CG2 3.36Å; A74-V78 PolarHBondContact O-N 3.14Å
75	W	62.8	Low	64.8	Low	172 Å²	172	118.4 Å²	118.4	65%	0.652	57%	0.569	S	S	*	*	H	α-helix	trans	-63.1	-43.8	176.9	-79	106.7	0	0	0	112.2	R71 D72 V78 A79	R71-W75 PolarHBondContact O-N 3.05Å; D72-W75 PolarHBondContact O-N 3.14Å; W75-V78 PolarHBondContact O-N 3.37Å; W75-A79 WeakPolarHBondContact O-CB 3.27Å; W75-A79 PolarHBondContact O-N 3.29Å
76	R	71.2	Confident	64.6	Low	161 Å²	161	116.6 Å²	116.6	61%	0.608	56%	0.563	S	S	*	*	H	α-helix	trans	-61.8	-48.7	175.1	-73.2	178.3	-178.3	-94.3	-0.5	110.7	D72 V73 V78 A79 W80	D72-R76 WeakPolarHBondContact O-CG 3.49Å; D72-R76 PolarHBondContact O-N 3.17Å; V73-R76 PolarHBondContact O-N 3.49Å; R76-V78 VanDerWaalsContact C-N 3.33Å; R76-V78 PolarHBondContact O-N 2.93Å; R76-A79 PolarHBondContact O-N 3.04Å; R76-A79 VanDerWaalsContact O-N 3.14Å; R76-W80 PolarHBondContact O-N 2.96Å
77	G	70.7	Confident	64.1	Low	40 Å²	40	109.9 Å²	109.9	41%	0.412	55%	0.551	S	S	.	*	H	α-helix	trans	-56.3	-43.5	179	0	0	0	0	0	113.4	V73 A74 R81	V73-G77 PolarHBondContact O-N 3.32Å; A74-G77 PolarHBondContact O-N 3.02Å; G77-R81 WeakPolarHBondContact O-CB 3.46Å; G77-R81 PolarHBondContact O-N 2.89Å; G77-R81 VanDerWaalsContact O-N 3.08Å
78	V	63.6	Low	63.4	Low	80 Å²	80	112 Å²	112	49%	0.485	56%	0.561	S	S	.	*	H	α-helix	trans	-66.9	-40.4	176.9	175	0	0	0	0	111.6	A74 W75 R76 R81 R82	A74-V78 WeakPolarHBondContact O-CG2 3.36Å; A74-V78 PolarHBondContact O-N 3.14Å; W75-V78 PolarHBondContact O-N 3.37Å; R76-V78 VanDerWaalsContact C-N 3.33Å; R76-V78 PolarHBondContact O-N 2.93Å; V78-R81 PolarHBondContact O-N 3.32Å; V78-R82 PolarHBondContact O-N 3.4Å
79	A	60.4	Low	62.8	Low	52 Å²	52	113.2 Å²	113.2	43%	0.43	57%	0.569	S	S	.	*	H	α-helix	trans	-62.1	-46.9	177.2	0	0	0	0	0	111.6	W75 R76 R81 R82 V83	W75-A79 WeakPolarHBondContact O-CB 3.27Å; W75-A79 PolarHBondContact O-N 3.29Å; R76-A79 PolarHBondContact O-N 3.04Å; R76-A79 VanDerWaalsContact O-N 3.14Å; A79-R81 VanDerWaalsContact C-N 3.32Å; A79-R81 PolarHBondContact O-N 3.43Å; A79-R82 PolarHBondContact O-N 3.04Å; A79-V83 WeakPolarHBondContact O-CG2 3.43Å; A79-V83 PolarHBondContact O-N 3Å
80	W	58.9	Low	61.7	Low	182 Å²	182	120.9 Å²	120.9	69%	0.689	59%	0.586	S	S	*	*	H	α-helix	trans	-60.2	-41.5	176.2	-68.9	113.1	0	0	0	112.1	R76 R82 V83 A84	R76-W80 PolarHBondContact O-N 2.96Å; W80-R82 VanDerWaalsContact C-N 3.34Å; W80-R82 PolarHBondContact O-N 3Å; W80-V83 PolarHBondContact O-N 3.46Å; W80-A84 WeakPolarHBondContact O-CB 3.48Å; W80-A84 PolarHBondContact O-N 3.4Å
81	R	65.3	Low	60.7	Low	184 Å²	184	117 Å²	117	69%	0.694	59%	0.586	S	S	*	*	H	α-helix	trans	-66.8	-35.9	-180	-140.5	169.9	-171.8	-116.6	1	112.3	G77 V78 A79 Q85	G77-R81 WeakPolarHBondContact O-CB 3.46Å; G77-R81 PolarHBondContact O-N 2.89Å; G77-R81 VanDerWaalsContact O-N 3.08Å; V78-R81 PolarHBondContact O-N 3.32Å; A79-R81 VanDerWaalsContact C-N 3.32Å; A79-R81 PolarHBondContact O-N 3.43Å; R81-Q85 VanDerWaalsContact O-CG 3.28Å; R81-Q85 WeakPolarHBondContact O-CG 3.46Å; R81-Q85 PolarHBondContact O-N 3.3Å; R81-Q85 VanDerWaalsContact O-N 3.16Å; R81-Q85 PolarHBondContact O-NE2 2.87Å
82	R	62.3	Low	59.6	Low	158 Å²	158	113.3 Å²	113.3	60%	0.596	59%	0.585	S	S	*	*	H	α-helix	trans	-66.9	-50.4	172.4	-77.4	-171.3	-179.3	-169.7	0.6	111.3	V78 A79 W80 A84 Q85 Y86	V78-R82 PolarHBondContact O-N 3.4Å; A79-R82 PolarHBondContact O-N 3.04Å; W80-R82 VanDerWaalsContact C-N 3.34Å; W80-R82 PolarHBondContact O-N 3Å; R82-A84 VanDerWaalsContact C-N 3.28Å; R82-A84 PolarHBondContact O-N 3.09Å; R82-Q85 PolarHBondContact O-N 3.18Å; R82-Q85 VanDerWaalsContact O-N 3.07Å; R82-Y86 HydrophobicContact CB-CD2 4.32Å; R82-Y86 HydrophobicContact CB-CE2 4.11Å; R82-Y86 WeakPolarHBondContact O-CD2 3.01Å; R82-Y86 PolarHBondContact O-N 3.48Å
83	V	60.6	Low	58.6	Low	98 Å²	98	121.7 Å²	121.7	59%	0.594	61%	0.61	S	S	*	*	H	α-helix	trans	-59.1	-41.1	-179.9	174.6	0	0	0	0	111.1	A79 W80 Q85 Y86 G87	A79-V83 WeakPolarHBondContact O-CG2 3.43Å; A79-V83 PolarHBondContact O-N 3Å; W80-V83 PolarHBondContact O-N 3.46Å; V83-Q85 PolarHBondContact O-N 3.32Å; V83-Y86 PolarHBondContact O-N 2.81Å; V83-G87 PolarHBondContact O-N 3.36Å
84	A	60.5	Low	57.6	Low	58 Å²	58	119.4 Å²	119.4	48%	0.479	61%	0.606	S	S	.	*	H	α-helix	trans	-62.1	-43.1	174.9	0	0	0	0	0	112.2	W80 R82 G87 V88	W80-A84 WeakPolarHBondContact O-CB 3.48Å; W80-A84 PolarHBondContact O-N 3.4Å; R82-A84 VanDerWaalsContact C-N 3.28Å; R82-A84 PolarHBondContact O-N 3.09Å; A84-G87 PolarHBondContact O-N 3.33Å; A84-V88 WeakPolarHBondContact O-CG2 3.45Å; A84-V88 PolarHBondContact O-N 3.5Å; A84-V88 VanDerWaalsContact O-N 3.07Å
85	Q	58	Low	56.7	Low	115 Å²	115	120.6 Å²	120.6	54%	0.537	62%	0.616	S	S	.	*	H	α-helix	trans	-64	-42.4	177.7	-74	172.2	37	0	0	112.5	R81 R82 V83	R81-Q85 VanDerWaalsContact O-CG 3.28Å; R81-Q85 WeakPolarHBondContact O-CG 3.46Å; R81-Q85 PolarHBondContact O-N 3.3Å; R81-Q85 VanDerWaalsContact O-N 3.16Å; R81-Q85 PolarHBondContact O-NE2 2.87Å; R82-Q85 PolarHBondContact O-N 3.18Å; R82-Q85 VanDerWaalsContact O-N 3.07Å; V83-Q85 PolarHBondContact O-N 3.32Å
86	Y	59.2	Low	55.9	Low	149 Å²	149	118.5 Å²	118.5	58%	0.584	62%	0.622	S	S	*	*	H	α-helix	trans	-72.3	-39.3	176.8	-66.2	-68.9	0	0	0	111.8	R82 V83 V88 V89 W90	R82-Y86 HydrophobicContact CB-CD2 4.32Å; R82-Y86 HydrophobicContact CB-CE2 4.11Å; R82-Y86 WeakPolarHBondContact O-CD2 3.01Å; R82-Y86 PolarHBondContact O-N 3.48Å; V83-Y86 PolarHBondContact O-N 2.81Å; Y86-V88 VanDerWaalsContact C-N 3.31Å; Y86-V88 PolarHBondContact O-N 3.15Å; Y86-V89 WeakPolarHBondContact O-CB 3.41Å; Y86-V89 PolarHBondContact O-N 2.93Å; Y86-V89 VanDerWaalsContact O-N 3.08Å; Y86-W90 VanDerWaalsContact O-CD1 3.29Å; Y86-W90 PolarHBondContact O-N 3.44Å
87	G	56.4	Low	54.8	Low	44 Å²	44	118.1 Å²	118.1	45%	0.454	63%	0.631	S	S	.	*	H	α-helix	trans	-61.9	-35.6	178.5	0	0	0	0	0	113.3	V83 A84 V89 W90	V83-G87 PolarHBondContact O-N 3.36Å; A84-G87 PolarHBondContact O-N 3.33Å; G87-V89 VanDerWaalsContact C-N 3.31Å; G87-V89 PolarHBondContact O-N 2.86Å; G87-W90 PolarHBondContact O-N 3.37Å; G87-W90 VanDerWaalsContact O-N 3.17Å
88	V	53.5	Low	53.8	Low	115 Å²	115	125 Å²	125	70%	0.697	67%	0.672	S	S	*	*	H	α-helix	trans	-71.9	-27	176.1	-175.1	0	0	0	0	111.5	A84 Y86 W90	A84-V88 WeakPolarHBondContact O-CG2 3.45Å; A84-V88 PolarHBondContact O-N 3.5Å; A84-V88 VanDerWaalsContact O-N 3.07Å; Y86-V88 VanDerWaalsContact C-N 3.31Å; Y86-V88 PolarHBondContact O-N 3.15Å; V88-W90 VanDerWaalsContact C-N 3.28Å
89	V	51.6	Low	53.3	Low	116 Å²	116	127.3 Å²	127.3	70%	0.703	68%	0.682	S	S	*	*	H	α-helix	trans	-73	-23.4	171.9	172.5	0	0	0	0	111.8	Y86 G87 C91	Y86-V89 WeakPolarHBondContact O-CB 3.41Å; Y86-V89 PolarHBondContact O-N 2.93Å; Y86-V89 VanDerWaalsContact O-N 3.08Å; G87-V89 VanDerWaalsContact C-N 3.31Å; G87-V89 PolarHBondContact O-N 2.86Å; V89-C91 VanDerWaalsContact C-N 3.31Å; V89-C91 PolarHBondContact O-N 3.02Å
90	W	44.5	Very low	52.9	Low	215 Å²	215	131.3 Å²	131.3	81%	0.814	70%	0.695	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.2	11	178.1	-84	91.2	0	0	0	114.9	Y86 G87 V88 P92	Y86-W90 VanDerWaalsContact O-CD1 3.29Å; Y86-W90 PolarHBondContact O-N 3.44Å; G87-W90 PolarHBondContact O-N 3.37Å; G87-W90 VanDerWaalsContact O-N 3.17Å; V88-W90 VanDerWaalsContact C-N 3.28Å; W90-P92 WeakPolarHBondContact O-CD 3.36Å
91	C	42.7	Very low	52.6	Low	101 Å²	101	128.4 Å²	128.4	68%	0.682	70%	0.695	S	S	*	*	S	Bend	trans	-81.8	97.6	154.2	-79.5	0	0	0	0	107.5	V89 R93	V89-C91 VanDerWaalsContact C-N 3.31Å; V89-C91 PolarHBondContact O-N 3.02Å; C91-R93 PolarHBondContact O-N 3.43Å; C91-R93 VanDerWaalsContact O-N 3.11Å
92	P	46	Very low	51.9	Low	99 Å²	99	125.2 Å²	125.2	64%	0.643	70%	0.696	S	S	*	*			trans	-58	123.3	-179.6	25.7	-34.2	0	0	0	108.6	W90 G94	W90-P92 WeakPolarHBondContact O-CD 3.36Å; P92-G94 PolarHBondContact O-N 3.03Å
93	R	50.4	Low	51.2	Low	261 Å²	261	123.1 Å²	123.1	99%	0.985	70%	0.702	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58.8	84.9	150.5	-77.4	-171.2	-166.9	102.1	1.2	106.4	C91	C91-R93 PolarHBondContact O-N 3.43Å; C91-R93 VanDerWaalsContact O-N 3.11Å
94	G	45.8	Very low	50.6	Low	50 Å²	50	124.8 Å²	124.8	52%	0.515	71%	0.709	S	S	.	*	T	Hydrogen-bonded Turn	trans	166.2	16.3	-167.9	0	0	0	0	0	114.7	P92 V96	P92-G94 PolarHBondContact O-N 3.03Å; G94-V96 PolarHBondContact O-N 3.28Å
95	A	46.3	Very low	49.9	Very low	83 Å²	83	129.6 Å²	129.6	69%	0.686	73%	0.725	S	S	*	*			trans	-60.8	83.4	149.4	0	0	0	0	0	107.2	I97	A95-I97 VanDerWaalsContact C-N 3.34Å; A95-I97 PolarHBondContact O-N 2.95Å; A95-I97 VanDerWaalsContact O-N 3.1Å
96	V	45.1	Very low	49.2	Very low	127 Å²	127	130.7 Å²	130.7	77%	0.77	74%	0.74	S	S	*	*			trans	-63.3	102.6	160.2	168.1	0	0	0	0	105	G94	G94-V96 PolarHBondContact O-N 3.28Å
97	I	48	Very low	48.4	Very low	154 Å²	154	129.2 Å²	129.2	79%	0.79	75%	0.753	S	S	*	*			trans	-121.1	76	163.3	39.6	161.6	0	0	0	106.9	A95	A95-I97 VanDerWaalsContact C-N 3.34Å; A95-I97 PolarHBondContact O-N 2.95Å; A95-I97 VanDerWaalsContact O-N 3.1Å
98	S	50.8	Low	47.7	Very low	185 Å²	185	136.9 Å²	136.9	100%	1.294	78%	0.78	S	S	*	*			trans	179.4	0	150.4	-79.7	0	0	0	0	109.4

Retrieved 98 of 98 residues in 48.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).