A0A077Z543_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077Z543, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 109 aa.

						>A0A077Z543_TRITR|A0A077Z543
MLIDDDSSRTQPDEATVIFSFIYSTTRHALIIVEENKVLPAPTNVQNRLSIKALIIAEKAMAVLENPTCYMDRIDELRELADEWSADLLRIEFQQAVWLSQVEPLLEDY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.4	Very low	47.4	Very low	220 Å²	220	158.4 Å²	158.4	100%	1.084	83%	0.832	S	S	*	*				0	94.7	0	-170.2	170.3	173.3	0	0	106	I3	M1-I3 HydrophobicContact CE-CD1 3.69Å; M1-I3 HydrophobicContact CG-CD1 4.16Å; M1-I3 HydrophobicContact CG-CG1 4.25Å
2	L	46.6	Very low	49.4	Very low	181 Å²	181	152.3 Å²	152.3	95%	0.948	81%	0.808	S	S	*	*			trans	-100.4	107.4	174	-82.5	157.1	0	0	0	104.6
3	I	52.5	Low	52.1	Low	119 Å²	119	147.7 Å²	147.7	61%	0.61	78%	0.784	S	S	*	*			trans	-133.8	108.3	172.7	-58.5	-176.5	0	0	0	106.7	M1	M1-I3 HydrophobicContact CE-CD1 3.69Å; M1-I3 HydrophobicContact CG-CD1 4.16Å; M1-I3 HydrophobicContact CG-CG1 4.25Å
4	D	46.7	Very low	54.7	Low	148 Å²	148	144 Å²	144	79%	0.791	76%	0.76	S	S	*	*			trans	69.4	85.5	146.8	-52.6	-16.6	0	0	0	119.1
5	D	45.1	Very low	57.1	Low	156 Å²	156	135.2 Å²	135.2	83%	0.834	72%	0.716	S	S	*	*			trans	-65.7	143.6	137	-146.6	-2.5	0	0	0	109.2
6	D	40.6	Very low	59.2	Low	154 Å²	154	130.7 Å²	130.7	82%	0.824	70%	0.696	S	S	*	*			trans	76.2	99.7	151.1	-139.1	12.1	0	0	0	119.9
7	S	44.7	Very low	61.3	Low	112 Å²	112	127.3 Å²	127.3	78%	0.783	68%	0.681	S	S	*	*			trans	164.8	55.2	134.4	-168.1	0	0	0	0	112.2
8	S	44.5	Very low	63.2	Low	110 Å²	110	120.7 Å²	120.7	77%	0.769	65%	0.645	S	S	*	*			trans	-109.5	31.6	167.9	59.3	0	0	0	0	112.2	T10	S8-T10 PolarHBondContact O-N 3.49Å
9	R	47.5	Very low	64.9	Low	237 Å²	237	115.8 Å²	115.8	89%	0.894	62%	0.618	S	S	*	*			trans	-69	79.6	144.6	-92.6	-176.8	160.7	139.7	-4.3	106.5	Q11	R9-Q11 VanDerWaalsContact C-N 3.35Å; R9-Q11 PolarHBondContact O-N 3.41Å
10	T	47.9	Very low	66.4	Low	127 Å²	127	113.5 Å²	113.5	78%	0.779	61%	0.611	S	S	*	*			trans	-53.7	103.4	167.8	32.4	0	0	0	0	106.9	S8	S8-T10 PolarHBondContact O-N 3.49Å
11	Q	56.5	Low	67.9	Low	178 Å²	178	111.5 Å²	111.5	83%	0.832	60%	0.597	S	S	*	*	P	Polyproline II helix	trans	-53.4	134.1	168.8	-77.4	-174.2	-35.1	0	0	106.9	R9 D13	R9-Q11 VanDerWaalsContact C-N 3.35Å; R9-Q11 PolarHBondContact O-N 3.41Å; Q11-D13 PolarHBondContact O-N 2.93Å
12	P	71	Confident	70.1	Confident	85 Å²	85	101 Å²	101	55%	0.552	55%	0.545	S	S	*	.	P	Polyproline II helix	trans	-54.2	134	176.2	21.9	-30.5	0	0	0	108	T16 V17	P12-T16 HydrophobicContact CB-CG2 4.15Å; P12-V17 HydrophobicContact CB-CG2 4Å; P12-V17 HydrophobicContact CG-CG2 3.77Å
13	D	84.9	Confident	72.6	Confident	93 Å²	93	98.8 Å²	98.8	50%	0.497	53%	0.525	S	S	.	.	P	Polyproline II helix	trans	-58.3	152.5	177	67.3	50.4	0	0	0	109.9	Q11 A15 T16 V17	Q11-D13 PolarHBondContact O-N 2.93Å; D13-A15 PolarHBondContact O-N 3.1Å; D13-A15 WeakPolarHBondContact OD1-CB 3.24Å; D13-A15 PolarHBondContact OD1-N 3.09Å; D13-T16 WeakPolarHBondContact O-CA 3.17Å; D13-T16 VanDerWaalsContact O-CB 3.31Å; D13-T16 WeakPolarHBondContact O-CB 3.3Å; D13-T16 PolarHBondContact O-N 2.84Å; D13-T16 VanDerWaalsContact OD1-CB 3.26Å; D13-T16 WeakPolarHBondContact OD1-CB 3.4Å; D13-T16 PolarHBondContact OD1-N 3.33Å; D13-T16 PolarHBondContact OD1-OG1 3.16Å; D13-T16 PolarHBondContact OD2-OG1 2.76Å; D13-V17 PolarHBondContact O-N 3.39Å; D13-V17 VanDerWaalsContact O-N 3.08Å
14	E	87.9	Confident	74.7	Confident	96 Å²	96	96.4 Å²	96.4	45%	0.449	52%	0.519	S	S	.	.	H	α-helix	trans	-55.4	-38.3	-173.9	-179.5	167.9	-149.3	0	0	112.6	V17 I18 I74 R78	E14-V17 PolarHBondContact O-N 2.82Å; E14-I18 HydrophobicContact CG-CD1 3.94Å; E14-I18 WeakPolarHBondContact O-CG1 3.35Å; E14-I18 PolarHBondContact O-N 3.2Å; E14-I74 HydrophobicContact CG-CG2 4.05Å; E14-R78 VanDerWaalsContact CG-NH2 3.32Å; E14-R78 IonicContact OE1-CZ 3.07Å; E14-R78 IonicContact OE1-NH1 2.74Å; E14-R78 PolarHBondContact OE1-NH1 3.07Å; E14-R78 IonicContact OE1-NH2 2.63Å; E14-R78 PolarHBondContact OE1-NH2 3.17Å
15	A	90.7	Very high	77.1	Confident	12 Å²	12	89.7 Å²	89.7	10%	0.099	48%	0.483	C	S	.	.	H	α-helix	trans	-62.6	-44.8	176	0	0	0	0	0	111.3	D13 V17 I18 F19 M71 I74	D13-A15 PolarHBondContact O-N 3.1Å; D13-A15 WeakPolarHBondContact OD1-CB 3.24Å; D13-A15 PolarHBondContact OD1-N 3.09Å; A15-V17 VanDerWaalsContact C-N 3.29Å; A15-V17 PolarHBondContact O-N 3.32Å; A15-I18 PolarHBondContact O-N 3.47Å; A15-I18 VanDerWaalsContact O-N 3.15Å; A15-F19 HydrophobicContact CB-CD2 4.35Å; A15-F19 HydrophobicContact CB-CE2 4.34Å; A15-F19 WeakPolarHBondContact O-CD2 3.49Å; A15-F19 PolarHBondContact O-N 3.41Å; A15-M71 HydrophobicContact CB-CE 4.1Å; A15-M71 HydrophobicContact CB-SD 4Å; A15-I74 HydrophobicContact CB-CD1 3.66Å; A15-I74 HydrophobicContact CB-CG1 4.22Å
16	T	91.8	Very high	79.6	Confident	63 Å²	63	82.6 Å²	82.6	39%	0.387	45%	0.446	S	S	.	.	H	α-helix	trans	-59	-42.2	177.5	-62.5	0	0	0	0	110.8	P12 D13 S20	P12-T16 HydrophobicContact CB-CG2 4.15Å; D13-T16 WeakPolarHBondContact O-CA 3.17Å; D13-T16 VanDerWaalsContact O-CB 3.31Å; D13-T16 WeakPolarHBondContact O-CB 3.3Å; D13-T16 PolarHBondContact O-N 2.84Å; D13-T16 VanDerWaalsContact OD1-CB 3.26Å; D13-T16 WeakPolarHBondContact OD1-CB 3.4Å; D13-T16 PolarHBondContact OD1-N 3.33Å; D13-T16 PolarHBondContact OD1-OG1 3.16Å; D13-T16 PolarHBondContact OD2-OG1 2.76Å; T16-S20 WeakPolarHBondContact O-CB 3.22Å; T16-S20 PolarHBondContact O-N 2.95Å; T16-S20 PolarHBondContact O-OG 3.11Å
17	V	93.9	Very high	82.3	Confident	73 Å²	73	81.9 Å²	81.9	44%	0.442	43%	0.432	S	S	.	.	H	α-helix	trans	-62	-47.6	175.8	176.9	0	0	0	0	110.7	P12 D13 E14 A15 S20 F21	P12-V17 HydrophobicContact CB-CG2 4Å; P12-V17 HydrophobicContact CG-CG2 3.77Å; D13-V17 PolarHBondContact O-N 3.39Å; D13-V17 VanDerWaalsContact O-N 3.08Å; E14-V17 PolarHBondContact O-N 2.82Å; A15-V17 VanDerWaalsContact C-N 3.29Å; A15-V17 PolarHBondContact O-N 3.32Å; V17-S20 PolarHBondContact O-N 2.76Å; V17-F21 WeakPolarHBondContact O-CB 3.42Å; V17-F21 PolarHBondContact O-N 2.92Å
18	I	95.4	Very high	84.9	Confident	8 Å²	8	79.6 Å²	79.6	4%	0.041	41%	0.408	C	S	.	.	H	α-helix	trans	-68.2	-45.3	-176.8	-70.4	158.7	0	0	0	111.8	E14 A15 S20 F21 I22 I74 L77 R78	E14-I18 HydrophobicContact CG-CD1 3.94Å; E14-I18 WeakPolarHBondContact O-CG1 3.35Å; E14-I18 PolarHBondContact O-N 3.2Å; A15-I18 PolarHBondContact O-N 3.47Å; A15-I18 VanDerWaalsContact O-N 3.15Å; I18-S20 VanDerWaalsContact C-N 3.31Å; I18-S20 PolarHBondContact O-N 3.31Å; I18-F21 WeakPolarHBondContact O-CB 3.36Å; I18-F21 PolarHBondContact O-N 3.13Å; I18-F21 VanDerWaalsContact O-N 3.13Å; I18-I22 HydrophobicContact CG2-CD1 3.95Å; I18-I22 WeakPolarHBondContact O-CG1 3.38Å; I18-I22 PolarHBondContact O-N 2.66Å; I18-I74 HydrophobicContact CD1-CG2 3.35Å; I18-L77 HydrophobicContact CG2-CB 4.33Å; I18-L77 HydrophobicContact CG2-CD2 3.74Å; I18-L77 HydrophobicContact CG2-CG 3.97Å; I18-R78 HydrophobicContact CD1-CB 3.89Å; I18-R78 HydrophobicContact CG1-CB 4.28Å
19	F	95.7	Very high	87.5	Confident	29 Å²	29	74.4 Å²	74.4	13%	0.127	37%	0.372	C	S	.	.	H	α-helix	trans	-64.1	-36.8	175.7	-76.1	-66	0	0	0	112.3	A15 F21 I22 Y23 V63 L64 P67 M71 I74 L77	A15-F19 HydrophobicContact CB-CD2 4.35Å; A15-F19 HydrophobicContact CB-CE2 4.34Å; A15-F19 WeakPolarHBondContact O-CD2 3.49Å; A15-F19 PolarHBondContact O-N 3.41Å; F19-F21 VanDerWaalsContact C-N 3.29Å; F19-F21 PolarHBondContact O-N 2.93Å; F19-I22 PolarHBondContact O-N 3.11Å; F19-Y23 WeakPolarHBondContact O-CB 3.32Å; F19-Y23 PolarHBondContact O-N 3.39Å; F19-V63 HydrophobicContact CD1-CG1 4.31Å; F19-V63 HydrophobicContact CE1-CG1 3.78Å; F19-L64 HydrophobicContact CD1-CD2 4.24Å; F19-P67 HydrophobicContact CD1-CB 4.25Å; F19-P67 HydrophobicContact CE1-CB 3.64Å; F19-P67 HydrophobicContact CE2-CB 4.16Å; F19-P67 HydrophobicContact CZ-CB 3.6Å; F19-P67 WeakPolarHBondContact CZ-O 3.43Å; F19-M71 HydrophobicContact CE2-SD 3.72Å; F19-M71 HydrophobicContact CZ-SD 4.43Å; F19-I74 HydrophobicContact CE2-CD1 4.03Å; F19-L77 HydrophobicContact CD1-CD2 4.27Å; F19-L77 HydrophobicContact CE1-CD2 3.76Å; F19-L77 HydrophobicContact CE2-CD2 4.48Å; F19-L77 HydrophobicContact CZ-CD2 3.87Å
20	S	95.6	Very high	89.9	Confident	68 Å²	68	66.5 Å²	66.5	48%	0.476	35%	0.347	S	S	.	.	H	α-helix	trans	-63	-39.5	173.6	-62.2	0	0	0	0	111.5	T16 V17 I18 Y23 S24	T16-S20 WeakPolarHBondContact O-CB 3.22Å; T16-S20 PolarHBondContact O-N 2.95Å; T16-S20 PolarHBondContact O-OG 3.11Å; V17-S20 PolarHBondContact O-N 2.76Å; I18-S20 VanDerWaalsContact C-N 3.31Å; I18-S20 PolarHBondContact O-N 3.31Å; S20-Y23 PolarHBondContact O-N 2.97Å; S20-S24 PolarHBondContact O-N 3.31Å
21	F	96.5	Very high	92.3	Very high	72 Å²	72	64.2 Å²	64.2	32%	0.316	33%	0.329	S	S	.	.	H	α-helix	trans	-65.6	-46.2	176	-175.6	-111.5	0	0	0	111.5	V17 I18 F19 Y23 S24 T25 A81	V17-F21 WeakPolarHBondContact O-CB 3.42Å; V17-F21 PolarHBondContact O-N 2.92Å; I18-F21 WeakPolarHBondContact O-CB 3.36Å; I18-F21 PolarHBondContact O-N 3.13Å; I18-F21 VanDerWaalsContact O-N 3.13Å; F19-F21 VanDerWaalsContact C-N 3.29Å; F19-F21 PolarHBondContact O-N 2.93Å; F21-Y23 VanDerWaalsContact C-N 3.31Å; F21-Y23 PolarHBondContact O-N 2.85Å; F21-S24 CarbonylContact O-C 3.6Å; F21-S24 WeakPolarHBondContact O-CA 3.4Å; F21-S24 WeakPolarHBondContact O-CB 3.38Å; F21-S24 PolarHBondContact O-N 3.48Å; F21-T25 PolarHBondContact O-N 3.27Å; F21-T25 PolarHBondContact O-OG1 2.8Å; F21-T25 VanDerWaalsContact O-OG1 3.1Å; F21-A81 HydrophobicContact CD1-CB 3.6Å; F21-A81 HydrophobicContact CE1-CB 3.79Å; F21-A81 WeakPolarHBondContact CE1-O 3.49Å
22	I	97.4	Very high	94.3	Very high	0 Å²	0	55.7 Å²	55.7	0%	0	29%	0.29	C	S	.	.	H	α-helix	trans	-59.6	-41.6	176	-68.6	168.9	0	0	0	111.7	I18 F19 S24 T25 T26 A60 V63 L64 L77 A81 W84	I18-I22 HydrophobicContact CG2-CD1 3.95Å; I18-I22 WeakPolarHBondContact O-CG1 3.38Å; I18-I22 PolarHBondContact O-N 2.66Å; F19-I22 PolarHBondContact O-N 3.11Å; I22-S24 VanDerWaalsContact C-N 3.35Å; I22-S24 PolarHBondContact O-N 2.68Å; I22-T25 PolarHBondContact O-N 3.44Å; I22-T26 WeakPolarHBondContact O-CB 3.35Å; I22-T26 PolarHBondContact O-N 3.13Å; I22-T26 PolarHBondContact O-OG1 3.21Å; I22-A60 HydrophobicContact CG2-CB 3.87Å; I22-V63 HydrophobicContact CD1-CG1 4.01Å; I22-L64 HydrophobicContact CB-CD2 4.41Å; I22-L64 HydrophobicContact CG2-CD1 4.12Å; I22-L64 HydrophobicContact CG2-CD2 4.03Å; I22-L64 HydrophobicContact CG2-CG 3.86Å; I22-L77 HydrophobicContact CD1-CD1 3.82Å; I22-L77 HydrophobicContact CD1-CD2 3.56Å; I22-L77 HydrophobicContact CD1-CG 3.52Å; I22-A81 HydrophobicContact CD1-CB 4.36Å; I22-A81 HydrophobicContact CG1-CB 3.76Å; I22-W84 HydrophobicContact CG1-CZ3 4.39Å; I22-W84 HydrophobicContact CG2-CZ3 4.06Å
23	Y	97.3	Very high	95.6	Very high	134 Å²	134	52.4 Å²	52.4	53%	0.525	27%	0.268	S	S	.	.	H	α-helix	trans	-59.7	-45.4	173.4	176.2	-101	0	0	0	111.8	F19 S20 F21 T26 R27 L64	F19-Y23 WeakPolarHBondContact O-CB 3.32Å; F19-Y23 PolarHBondContact O-N 3.39Å; S20-Y23 PolarHBondContact O-N 2.97Å; F21-Y23 VanDerWaalsContact C-N 3.31Å; F21-Y23 PolarHBondContact O-N 2.85Å; Y23-T26 WeakPolarHBondContact O-CB 3.46Å; Y23-T26 PolarHBondContact O-N 3.14Å; Y23-R27 HydrophobicContact CE1-CG 4.31Å; Y23-R27 HydrophobicContact CE2-CG 4.43Å; Y23-R27 WeakPolarHBondContact O-CG 3.18Å; Y23-R27 PolarHBondContact O-N 3.13Å; Y23-L64 HydrophobicContact CD2-CD1 4.34Å
24	S	97.4	Very high	96.2	Very high	69 Å²	69	53.3 Å²	53.3	48%	0.483	27%	0.269	S	S	.	.	H	α-helix	trans	-60.4	-46.7	175.5	-170.4	0	0	0	0	112	S20 F21 I22 T26 R27 H28	S20-S24 PolarHBondContact O-N 3.31Å; F21-S24 CarbonylContact O-C 3.6Å; F21-S24 WeakPolarHBondContact O-CA 3.4Å; F21-S24 WeakPolarHBondContact O-CB 3.38Å; F21-S24 PolarHBondContact O-N 3.48Å; I22-S24 VanDerWaalsContact C-N 3.35Å; I22-S24 PolarHBondContact O-N 2.68Å; S24-T26 VanDerWaalsContact C-N 3.34Å; S24-T26 PolarHBondContact O-N 3.45Å; S24-R27 PolarHBondContact O-N 3.08Å; S24-H28 WeakPolarHBondContact O-CB 3.4Å; S24-H28 PolarHBondContact O-N 3.26Å
25	T	96.8	Very high	96.6	Very high	7 Å²	7	52.9 Å²	52.9	4%	0.043	27%	0.267	C	S	.	.	H	α-helix	trans	-60.1	-42.2	176.8	-60.1	0	0	0	0	111.7	F21 I22 R27 H28 A29 I56 W84 L88	F21-T25 PolarHBondContact O-N 3.27Å; F21-T25 PolarHBondContact O-OG1 2.8Å; F21-T25 VanDerWaalsContact O-OG1 3.1Å; I22-T25 PolarHBondContact O-N 3.44Å; T25-R27 PolarHBondContact O-N 3.34Å; T25-H28 PolarHBondContact O-N 3.4Å; T25-A29 WeakPolarHBondContact O-CB 3.33Å; T25-A29 PolarHBondContact O-N 3.42Å; T25-I56 HydrophobicContact CG2-CG2 4.15Å; T25-W84 HydrophobicContact CG2-CB 3.87Å; T25-L88 HydrophobicContact CG2-CD1 3.77Å
26	T	98	Very high	96.9	Very high	7 Å²	7	52.3 Å²	52.3	4%	0.043	26%	0.262	C	S	.	.	H	α-helix	trans	-59.5	-48.5	175.6	-53	0	0	0	0	111	I22 Y23 S24 H28 A29 L30 A57 A60 M61	I22-T26 WeakPolarHBondContact O-CB 3.35Å; I22-T26 PolarHBondContact O-N 3.13Å; I22-T26 PolarHBondContact O-OG1 3.21Å; Y23-T26 WeakPolarHBondContact O-CB 3.46Å; Y23-T26 PolarHBondContact O-N 3.14Å; S24-T26 VanDerWaalsContact C-N 3.34Å; S24-T26 PolarHBondContact O-N 3.45Å; T26-H28 VanDerWaalsContact C-N 3.34Å; T26-H28 PolarHBondContact O-N 3.37Å; T26-A29 PolarHBondContact O-N 2.94Å; T26-L30 WeakPolarHBondContact O-CG 3.31Å; T26-L30 PolarHBondContact O-N 2.91Å; T26-L30 VanDerWaalsContact O-N 3.14Å; T26-A57 HydrophobicContact CG2-CB 4.4Å; T26-A60 HydrophobicContact CG2-CB 4.49Å; T26-A60 WeakPolarHBondContact OG1-CB 3.04Å; T26-M61 HydrophobicContact CG2-CG 3.63Å; T26-M61 HydrophobicContact CG2-SD 4.47Å
27	R	98.2	Very high	97.1	Very high	140 Å²	140	55 Å²	55	53%	0.528	27%	0.269	S	S	.	.	H	α-helix	trans	-63.2	-41.6	178.5	-72.7	-169.3	65.2	-135.1	-3.8	112	Y23 S24 T25 L30 I31	Y23-R27 HydrophobicContact CE1-CG 4.31Å; Y23-R27 HydrophobicContact CE2-CG 4.43Å; Y23-R27 WeakPolarHBondContact O-CG 3.18Å; Y23-R27 PolarHBondContact O-N 3.13Å; S24-R27 PolarHBondContact O-N 3.08Å; T25-R27 PolarHBondContact O-N 3.34Å; R27-L30 PolarHBondContact O-N 2.84Å; R27-I31 WeakPolarHBondContact O-CG1 3.37Å; R27-I31 PolarHBondContact O-N 3.31Å
28	H	98.2	Very high	97.2	Very high	64 Å²	64	57.5 Å²	57.5	30%	0.296	28%	0.284	S	S	.	.	H	α-helix	trans	-62.9	-45	178.6	-171	-164.8	0	0	0	111.4	S24 T25 T26 L30 I31 I32 L88 E92	S24-H28 WeakPolarHBondContact O-CB 3.4Å; S24-H28 PolarHBondContact O-N 3.26Å; T25-H28 PolarHBondContact O-N 3.4Å; T26-H28 VanDerWaalsContact C-N 3.34Å; T26-H28 PolarHBondContact O-N 3.37Å; H28-L30 VanDerWaalsContact C-N 3.3Å; H28-L30 PolarHBondContact O-N 3.43Å; H28-I31 WeakPolarHBondContact O-CB 3.42Å; H28-I31 PolarHBondContact O-N 3.17Å; H28-I31 VanDerWaalsContact O-N 3.1Å; H28-I32 PolarHBondContact O-N 2.9Å; H28-L88 HydrophobicContact CB-CD1 4.06Å; H28-E92 VanDerWaalsContact CE1-CD 3.46Å; H28-E92 IonicContact CE1-OE1 3.28Å; H28-E92 PolarHBondContact CE1-OE1 2.86Å; H28-E92 VanDerWaalsContact CE1-OE1 3.28Å; H28-E92 IonicContact CE1-OE2 3.47Å; H28-E92 PolarHBondContact CE1-OE2 3.37Å; H28-E92 IonicContact NE2-OE1 3.33Å; H28-E92 PolarHBondContact NE2-OE1 2.98Å
29	A	98.4	Very high	97.2	Very high	0 Å²	0	57.5 Å²	57.5	0%	0	28%	0.284	C	S	.	.	H	α-helix	trans	-56.3	-43.6	175.4	0	0	0	0	0	112.2	T25 T26 I32 V33 I56 A57 L88	T25-A29 WeakPolarHBondContact O-CB 3.33Å; T25-A29 PolarHBondContact O-N 3.42Å; T26-A29 PolarHBondContact O-N 2.94Å; A29-I32 PolarHBondContact O-N 3.3Å; A29-V33 WeakPolarHBondContact O-CG2 3.5Å; A29-V33 PolarHBondContact O-N 3.4Å; A29-V33 VanDerWaalsContact O-N 3.15Å; A29-I56 HydrophobicContact CB-CG2 4.36Å; A29-A57 HydrophobicContact CB-CB 3.98Å; A29-L88 HydrophobicContact CB-CD1 4.16Å; A29-L88 HydrophobicContact CB-CD2 3.77Å
30	L	98.4	Very high	97.1	Very high	72 Å²	72	58.9 Å²	58.9	38%	0.377	30%	0.295	S	S	.	.	H	α-helix	trans	-66.1	-36	177	-66.5	174.4	0	0	0	112.9	T26 R27 H28 V33 E34 L54 A57	T26-L30 WeakPolarHBondContact O-CG 3.31Å; T26-L30 PolarHBondContact O-N 2.91Å; T26-L30 VanDerWaalsContact O-N 3.14Å; R27-L30 PolarHBondContact O-N 2.84Å; H28-L30 VanDerWaalsContact C-N 3.3Å; H28-L30 PolarHBondContact O-N 3.43Å; L30-V33 WeakPolarHBondContact O-CB 3.47Å; L30-V33 PolarHBondContact O-N 3.35Å; L30-E34 PolarHBondContact O-N 3.13Å; L30-L54 HydrophobicContact CD2-CD2 4.41Å; L30-A57 HydrophobicContact CD2-CB 3.95Å; L30-A57 HydrophobicContact CG-CB 4.19Å
31	I	98.3	Very high	97.1	Very high	78 Å²	78	56.2 Å²	56.2	40%	0.4	28%	0.278	S	S	.	.	H	α-helix	trans	-63.8	-46.6	174	-69.9	165.3	0	0	0	110.4	R27 H28 V33 E34 E35	R27-I31 WeakPolarHBondContact O-CG1 3.37Å; R27-I31 PolarHBondContact O-N 3.31Å; H28-I31 WeakPolarHBondContact O-CB 3.42Å; H28-I31 PolarHBondContact O-N 3.17Å; H28-I31 VanDerWaalsContact O-N 3.1Å; I31-V33 PolarHBondContact O-N 3.21Å; I31-E34 WeakPolarHBondContact O-CA 3.39Å; I31-E34 WeakPolarHBondContact O-CB 3.43Å; I31-E34 PolarHBondContact O-N 3.26Å; I31-E35 HydrophobicContact CG2-CG 4.21Å; I31-E35 WeakPolarHBondContact CG2-OE1 3.3Å; I31-E35 WeakPolarHBondContact O-CG 3.35Å; I31-E35 PolarHBondContact O-N 3.06Å
32	I	98.1	Very high	97	Very high	0 Å²	0	55.9 Å²	55.9	0%	0	28%	0.283	C	S	.	.	H	α-helix	trans	-56.8	-36.7	177.2	-76	164.8	0	0	0	111.5	H28 A29 E35 N36 A53 L88 I91 E92	H28-I32 PolarHBondContact O-N 2.9Å; A29-I32 PolarHBondContact O-N 3.3Å; I32-E35 PolarHBondContact O-N 3.41Å; I32-N36 WeakPolarHBondContact CG2-ND2 3.39Å; I32-N36 WeakPolarHBondContact O-CB 3.45Å; I32-N36 PolarHBondContact O-N 3.36Å; I32-N36 PolarHBondContact O-ND2 3.01Å; I32-A53 HydrophobicContact CB-CB 4.36Å; I32-A53 HydrophobicContact CG2-CB 3.83Å; I32-L88 HydrophobicContact CD1-CB 4.18Å; I32-L88 HydrophobicContact CD1-CD2 3.9Å; I32-L88 HydrophobicContact CD1-CG 4.43Å; I32-I91 HydrophobicContact CG2-CG2 3.55Å; I32-E92 HydrophobicContact CD1-CG 3.81Å; I32-E92 HydrophobicContact CG1-CG 4.36Å
33	V	98.2	Very high	97	Very high	16 Å²	16	60.1 Å²	60.1	10%	0.097	31%	0.309	C	S	.	.	H	α-helix	trans	-61.9	-42.4	174.6	173.7	0	0	0	0	111.6	A29 L30 I31 A53 L54	A29-V33 WeakPolarHBondContact O-CG2 3.5Å; A29-V33 PolarHBondContact O-N 3.4Å; A29-V33 VanDerWaalsContact O-N 3.15Å; L30-V33 WeakPolarHBondContact O-CB 3.47Å; L30-V33 PolarHBondContact O-N 3.35Å; I31-V33 PolarHBondContact O-N 3.21Å; V33-A53 HydrophobicContact CG2-CB 3.71Å; V33-L54 HydrophobicContact CG1-CD2 4.4Å; V33-L54 HydrophobicContact CG1-CG 4.41Å; V33-L54 HydrophobicContact CG2-CD2 3.9Å; V33-L54 HydrophobicContact CG2-CG 3.71Å
34	E	98	Very high	97	Very high	111 Å²	111	59.3 Å²	59.3	52%	0.519	31%	0.314	S	S	.	.	H	α-helix	trans	-66.7	-43.8	176.4	-67.3	-59.5	137.8	0	0	111.7	L30 I31 N36 K37	L30-E34 PolarHBondContact O-N 3.13Å; I31-E34 WeakPolarHBondContact O-CA 3.39Å; I31-E34 WeakPolarHBondContact O-CB 3.43Å; I31-E34 PolarHBondContact O-N 3.26Å; E34-N36 VanDerWaalsContact C-N 3.29Å; E34-N36 PolarHBondContact O-N 3.46Å; E34-K37 WeakPolarHBondContact O-CB 3.34Å; E34-K37 PolarHBondContact O-N 3.42Å; E34-K37 VanDerWaalsContact O-N 3.14Å; E34-K37 IonicContact OE1-NZ 2.68Å; E34-K37 PolarHBondContact OE1-NZ 2.85Å; E34-K37 WeakPolarHBondContact OE2-CE 3.46Å; E34-K37 IonicContact OE2-NZ 2.66Å; E34-K37 PolarHBondContact OE2-NZ 3.38Å
35	E	97.2	Very high	96.9	Very high	88 Å²	88	56.7 Å²	56.7	41%	0.411	30%	0.295	S	S	.	.	H	α-helix	trans	-62.2	-37.1	177.9	-68.8	174	166.3	0	0	112.2	I31 I32 K37 V38 L39	I31-E35 HydrophobicContact CG2-CG 4.21Å; I31-E35 WeakPolarHBondContact CG2-OE1 3.3Å; I31-E35 WeakPolarHBondContact O-CG 3.35Å; I31-E35 PolarHBondContact O-N 3.06Å; I32-E35 PolarHBondContact O-N 3.41Å; E35-K37 PolarHBondContact O-N 2.83Å; E35-K37 VanDerWaalsContact O-N 3.13Å; E35-V38 WeakPolarHBondContact O-CG2 3.43Å; E35-V38 PolarHBondContact O-N 2.94Å; E35-V38 VanDerWaalsContact O-N 3.13Å; E35-L39 PolarHBondContact O-N 3Å
36	N	97.2	Very high	96.9	Very high	0 Å²	0	58 Å²	58	0%	0	30%	0.3	C	S	.	.	H	α-helix	trans	-62.2	-20.8	177.7	-77.4	-38.4	0	0	0	113.7	I32 E34 V38 Q46 L49 S50 Q95	I32-N36 WeakPolarHBondContact CG2-ND2 3.39Å; I32-N36 WeakPolarHBondContact O-CB 3.45Å; I32-N36 PolarHBondContact O-N 3.36Å; I32-N36 PolarHBondContact O-ND2 3.01Å; E34-N36 VanDerWaalsContact C-N 3.29Å; E34-N36 PolarHBondContact O-N 3.46Å; N36-V38 VanDerWaalsContact C-N 3.28Å; N36-V38 PolarHBondContact O-N 3.36Å; N36-Q46 WeakPolarHBondContact O-CB 3.41Å; N36-Q46 VanDerWaalsContact O-CG 3.31Å; N36-Q46 WeakPolarHBondContact O-CG 3.42Å; N36-L49 WeakPolarHBondContact ND2-CB 3.47Å; N36-S50 WeakPolarHBondContact CB-OG 3.41Å; N36-S50 PolarHBondContact ND2-N 2.92Å; N36-Q95 WeakPolarHBondContact OD1-CG 3.44Å; N36-Q95 PolarHBondContact OD1-NE2 3.18Å
37	K	95.5	Very high	96.9	Very high	120 Å²	120	61.8 Å²	61.8	52%	0.522	32%	0.32	S	S	.	.	T	Hydrogen-bonded Turn	trans	-68.2	-28.9	176.9	-61.5	177.1	-174.6	170.4	0	112.7	E34 E35	E34-K37 WeakPolarHBondContact O-CB 3.34Å; E34-K37 PolarHBondContact O-N 3.42Å; E34-K37 VanDerWaalsContact O-N 3.14Å; E34-K37 IonicContact OE1-NZ 2.68Å; E34-K37 PolarHBondContact OE1-NZ 2.85Å; E34-K37 WeakPolarHBondContact OE2-CE 3.46Å; E34-K37 IonicContact OE2-NZ 2.66Å; E34-K37 PolarHBondContact OE2-NZ 3.38Å; E35-K37 PolarHBondContact O-N 2.83Å; E35-K37 VanDerWaalsContact O-N 3.13Å
38	V	94.9	Very high	96.9	Very high	124 Å²	124	61.2 Å²	61.2	75%	0.752	32%	0.318	S	S	*	.	T	Hydrogen-bonded Turn	trans	-109.4	2.2	-178.6	-60.2	0	0	0	0	112.8	E35 N36	E35-V38 WeakPolarHBondContact O-CG2 3.43Å; E35-V38 PolarHBondContact O-N 2.94Å; E35-V38 VanDerWaalsContact O-N 3.13Å; N36-V38 VanDerWaalsContact C-N 3.28Å; N36-V38 PolarHBondContact O-N 3.36Å
39	L	95.5	Very high	96.9	Very high	8 Å²	8	58.1 Å²	58.1	4%	0.042	30%	0.304	C	S	.	.			trans	-61.8	130.3	176.7	-173.6	75.6	0	0	0	109.9	E35 A41 Q46 L49 Q95 W98 L99	E35-L39 PolarHBondContact O-N 3Å; L39-A41 HydrophobicContact CD2-CB 3.83Å; L39-A41 HydrophobicContact CG-CB 4.07Å; L39-A41 PolarHBondContact O-N 3.28Å; L39-Q46 HydrophobicContact CB-CG 4.49Å; L39-Q46 PolarHBondContact O-NE2 2.96Å; L39-L49 HydrophobicContact CD2-CD1 3.67Å; L39-Q95 HydrophobicContact CD1-CB 3.83Å; L39-Q95 HydrophobicContact CD1-CG 4.08Å; L39-Q95 HydrophobicContact CD2-CG 4.12Å; L39-W98 HydrophobicContact CD1-CB 4.23Å; L39-W98 HydrophobicContact CD2-CB 4.26Å; L39-W98 HydrophobicContact CD2-CG 4.42Å; L39-W98 HydrophobicContact CG-CB 4.23Å; L39-L99 HydrophobicContact CD1-CD2 4.27Å; L39-L99 HydrophobicContact CD1-CG 4.03Å
40	P	95	Very high	96.9	Very high	58 Å²	58	58.9 Å²	58.9	38%	0.377	31%	0.309	S	S	.	.	S	Bend	trans	-76.6	62.9	180	33.2	-36.6	0	0	0	111.5	L99 V102	P40-L99 HydrophobicContact CG-CD2 3.98Å; P40-V102 HydrophobicContact CB-CG2 3.54Å; P40-V102 HydrophobicContact CG-CG2 3.39Å
41	A	94.3	Very high	96.9	Very high	13 Å²	13	60.1 Å²	60.1	11%	0.107	32%	0.315	C	S	.	.	S	Bend	trans	-131.2	157.6	-179.6	0	0	0	0	0	109.9	L39 V45 Q46 W98	L39-A41 HydrophobicContact CD2-CB 3.83Å; L39-A41 HydrophobicContact CG-CB 4.07Å; L39-A41 PolarHBondContact O-N 3.28Å; A41-V45 HydrophobicContact CB-CB 4.1Å; A41-V45 HydrophobicContact CB-CG1 4.01Å; A41-Q46 HydrophobicContact CB-CG 4.32Å; A41-Q46 PolarHBondContact O-NE2 3.32Å; A41-Q46 VanDerWaalsContact O-NE2 3.16Å; A41-W98 HydrophobicContact CB-CB 4.23Å; A41-W98 HydrophobicContact CB-CD2 3.54Å; A41-W98 HydrophobicContact CB-CE3 3.82Å; A41-W98 HydrophobicContact CB-CG 3.71Å; A41-W98 HydrophobicContact CB-CZ3 4.43Å
42	P	95.5	Very high	96.9	Very high	64 Å²	64	60.2 Å²	60.2	42%	0.416	31%	0.313	S	S	.	.			trans	-52.6	143.4	170.8	-28.9	37.8	0	0	0	112.2	N44 V45 Q46 W98	P42-N44 WeakPolarHBondContact CB-OD1 3.47Å; P42-N44 PolarHBondContact O-N 3.36Å; P42-N44 VanDerWaalsContact O-N 3.1Å; P42-V45 HydrophobicContact CB-CG2 4.3Å; P42-V45 WeakPolarHBondContact O-CA 3.34Å; P42-V45 VanDerWaalsContact O-CB 3.3Å; P42-V45 WeakPolarHBondContact O-CB 3.28Å; P42-V45 PolarHBondContact O-N 3.22Å; P42-Q46 PolarHBondContact O-N 2.97Å; P42-Q46 VanDerWaalsContact O-N 3.09Å; P42-W98 VanDerWaalsContact CD-CH2 3.45Å; P42-W98 HydrophobicContact CG-CH2 4.06Å; P42-W98 HydrophobicContact CG-CZ3 4.39Å
43	T	96.2	Very high	97	Very high	90 Å²	90	60.2 Å²	60.2	55%	0.552	31%	0.313	S	S	*	.	H	α-helix	trans	-55.6	-34.3	-175.3	-51.9	0	0	0	0	113.5	V45 Q46 N47	T43-V45 VanDerWaalsContact C-N 3.27Å; T43-V45 PolarHBondContact O-N 2.94Å; T43-Q46 PolarHBondContact O-N 3.42Å; T43-N47 WeakPolarHBondContact O-CB 3.32Å; T43-N47 PolarHBondContact O-N 3.2Å; T43-N47 PolarHBondContact O-ND2 2.94Å
44	N	97	Very high	97	Very high	117 Å²	117	63.3 Å²	63.3	63%	0.626	33%	0.328	S	S	*	.	H	α-helix	trans	-64.5	-32.4	175.4	66.4	-29.8	0	0	0	112.5	P42 R48	P42-N44 WeakPolarHBondContact CB-OD1 3.47Å; P42-N44 PolarHBondContact O-N 3.36Å; P42-N44 VanDerWaalsContact O-N 3.1Å; N44-R48 VanDerWaalsContact O-CB 3.24Å; N44-R48 WeakPolarHBondContact O-CB 3.38Å; N44-R48 PolarHBondContact O-N 3.15Å; N44-R48 VanDerWaalsContact O-N 3.07Å
45	V	96.4	Very high	97	Very high	13 Å²	13	61.6 Å²	61.6	8%	0.079	32%	0.322	C	S	.	.	H	α-helix	trans	-72.8	-50	174.7	178	0	0	0	0	110.1	A41 P42 T43 N47 R48 L49 W98	A41-V45 HydrophobicContact CB-CB 4.1Å; A41-V45 HydrophobicContact CB-CG1 4.01Å; P42-V45 HydrophobicContact CB-CG2 4.3Å; P42-V45 WeakPolarHBondContact O-CA 3.34Å; P42-V45 VanDerWaalsContact O-CB 3.3Å; P42-V45 WeakPolarHBondContact O-CB 3.28Å; P42-V45 PolarHBondContact O-N 3.22Å; T43-V45 VanDerWaalsContact C-N 3.27Å; T43-V45 PolarHBondContact O-N 2.94Å; V45-N47 VanDerWaalsContact C-N 3.29Å; V45-N47 PolarHBondContact O-N 3.31Å; V45-R48 PolarHBondContact O-N 2.96Å; V45-R48 VanDerWaalsContact O-N 3.11Å; V45-L49 HydrophobicContact CG1-CD1 4.15Å; V45-L49 HydrophobicContact CG1-CG 4.3Å; V45-L49 WeakPolarHBondContact O-CG 3.45Å; V45-L49 PolarHBondContact O-N 3.2Å; V45-W98 HydrophobicContact CB-CZ2 4.5Å; V45-W98 HydrophobicContact CG1-CZ2 4.22Å; V45-W98 HydrophobicContact CG2-CZ2 3.89Å
46	Q	97.5	Very high	97	Very high	35 Å²	35	57.8 Å²	57.8	16%	0.164	30%	0.304	C	S	.	.	H	α-helix	trans	-51.4	-49.5	176.1	-64.8	174.7	-15.1	0	0	111.2	N36 L39 A41 P42 T43 L49 S50	N36-Q46 WeakPolarHBondContact O-CB 3.41Å; N36-Q46 VanDerWaalsContact O-CG 3.31Å; N36-Q46 WeakPolarHBondContact O-CG 3.42Å; L39-Q46 HydrophobicContact CB-CG 4.49Å; L39-Q46 PolarHBondContact O-NE2 2.96Å; A41-Q46 HydrophobicContact CB-CG 4.32Å; A41-Q46 PolarHBondContact O-NE2 3.32Å; A41-Q46 VanDerWaalsContact O-NE2 3.16Å; P42-Q46 PolarHBondContact O-N 2.97Å; P42-Q46 VanDerWaalsContact O-N 3.09Å; T43-Q46 PolarHBondContact O-N 3.42Å; Q46-L49 PolarHBondContact O-N 3.4Å; Q46-S50 WeakPolarHBondContact O-CB 3.39Å; Q46-S50 PolarHBondContact O-N 3.35Å; Q46-S50 PolarHBondContact O-OG 3.24Å
47	N	97.9	Very high	97.1	Very high	87 Å²	87	57.8 Å²	57.8	47%	0.465	30%	0.304	S	S	.	.	H	α-helix	trans	-63.7	-43.5	178.7	-71.9	-10.8	0	0	0	111.9	T43 V45 L49 S50 I51	T43-N47 WeakPolarHBondContact O-CB 3.32Å; T43-N47 PolarHBondContact O-N 3.2Å; T43-N47 PolarHBondContact O-ND2 2.94Å; V45-N47 VanDerWaalsContact C-N 3.29Å; V45-N47 PolarHBondContact O-N 3.31Å; N47-L49 PolarHBondContact O-N 3.33Å; N47-S50 PolarHBondContact O-N 3.14Å; N47-I51 WeakPolarHBondContact O-CB 3.43Å; N47-I51 WeakPolarHBondContact O-CD1 3.5Å; N47-I51 VanDerWaalsContact O-CG1 3.22Å; N47-I51 WeakPolarHBondContact O-CG1 3.44Å; N47-I51 PolarHBondContact O-N 3.41Å
48	R	98.1	Very high	97.2	Very high	127 Å²	127	58.4 Å²	58.4	48%	0.479	31%	0.309	S	S	.	.	H	α-helix	trans	-62.9	-42.2	179.2	-175.9	-178.4	68	179.5	0.8	111.9	N44 V45 K52	N44-R48 VanDerWaalsContact O-CB 3.24Å; N44-R48 WeakPolarHBondContact O-CB 3.38Å; N44-R48 PolarHBondContact O-N 3.15Å; N44-R48 VanDerWaalsContact O-N 3.07Å; V45-R48 PolarHBondContact O-N 2.96Å; V45-R48 VanDerWaalsContact O-N 3.11Å; R48-K52 WeakPolarHBondContact O-CG 3.42Å; R48-K52 PolarHBondContact O-N 2.93Å
49	L	98.2	Very high	97.3	Very high	0 Å²	0	57.9 Å²	57.9	0%	0	30%	0.297	C	S	.	.	H	α-helix	trans	-65.7	-43.9	176.5	-63.8	-177.9	0	0	0	110.8	N36 L39 V45 Q46 N47 I51 K52 A53 I91 Q94 Q95	N36-L49 WeakPolarHBondContact ND2-CB 3.47Å; L39-L49 HydrophobicContact CD2-CD1 3.67Å; V45-L49 HydrophobicContact CG1-CD1 4.15Å; V45-L49 HydrophobicContact CG1-CG 4.3Å; V45-L49 WeakPolarHBondContact O-CG 3.45Å; V45-L49 PolarHBondContact O-N 3.2Å; Q46-L49 PolarHBondContact O-N 3.4Å; N47-L49 PolarHBondContact O-N 3.33Å; L49-I51 PolarHBondContact O-N 3.1Å; L49-K52 PolarHBondContact O-N 3.46Å; L49-A53 PolarHBondContact O-N 2.92Å; L49-A53 VanDerWaalsContact O-N 3.08Å; L49-I91 HydrophobicContact CB-CG2 4.14Å; L49-I91 HydrophobicContact CD2-CG2 4.24Å; L49-Q94 HydrophobicContact CD1-CB 4.4Å; L49-Q94 HydrophobicContact CD2-CB 3.97Å; L49-Q95 HydrophobicContact CD1-CG 4.05Å
50	S	98.4	Very high	97.3	Very high	16 Å²	16	57.5 Å²	57.5	11%	0.112	30%	0.295	C	S	.	.	H	α-helix	trans	-61	-44.9	177.2	-57.3	0	0	0	0	112.3	N36 Q46 N47 K52 A53 L54	N36-S50 WeakPolarHBondContact CB-OG 3.41Å; N36-S50 PolarHBondContact ND2-N 2.92Å; Q46-S50 WeakPolarHBondContact O-CB 3.39Å; Q46-S50 PolarHBondContact O-N 3.35Å; Q46-S50 PolarHBondContact O-OG 3.24Å; N47-S50 PolarHBondContact O-N 3.14Å; S50-K52 VanDerWaalsContact C-N 3.32Å; S50-K52 PolarHBondContact O-N 3.35Å; S50-A53 PolarHBondContact O-N 2.96Å; S50-L54 WeakPolarHBondContact O-CB 3.4Å; S50-L54 WeakPolarHBondContact O-CG 3.36Å; S50-L54 PolarHBondContact O-N 2.91Å
51	I	98.4	Very high	97.4	Very high	98 Å²	98	58.5 Å²	58.5	50%	0.503	30%	0.295	S	S	.	.	H	α-helix	trans	-61.4	-41.9	178	-71.8	164.3	0	0	0	110.9	N47 L49 L54 I55	N47-I51 WeakPolarHBondContact O-CB 3.43Å; N47-I51 WeakPolarHBondContact O-CD1 3.5Å; N47-I51 VanDerWaalsContact O-CG1 3.22Å; N47-I51 WeakPolarHBondContact O-CG1 3.44Å; N47-I51 PolarHBondContact O-N 3.41Å; L49-I51 PolarHBondContact O-N 3.1Å; I51-L54 PolarHBondContact O-N 3.02Å; I51-I55 HydrophobicContact CG2-CD1 3.92Å; I51-I55 HydrophobicContact CG2-CG1 4.49Å; I51-I55 VanDerWaalsContact O-CG1 3.3Å; I51-I55 WeakPolarHBondContact O-CG1 3.39Å; I51-I55 PolarHBondContact O-N 3.2Å
52	K	98.3	Very high	97.5	Very high	79 Å²	79	59.9 Å²	59.9	34%	0.343	31%	0.307	S	S	.	.	H	α-helix	trans	-61.3	-45.8	176.7	-72.8	176.5	174.2	-169	0	111.9	R48 L49 S50 I55 I56 I91	R48-K52 WeakPolarHBondContact O-CG 3.42Å; R48-K52 PolarHBondContact O-N 2.93Å; L49-K52 PolarHBondContact O-N 3.46Å; S50-K52 VanDerWaalsContact C-N 3.32Å; S50-K52 PolarHBondContact O-N 3.35Å; K52-I55 PolarHBondContact O-N 3.35Å; K52-I56 PolarHBondContact O-N 3.34Å; K52-I91 HydrophobicContact CB-CD1 3.68Å; K52-I91 HydrophobicContact CB-CG1 4.26Å
53	A	98.4	Very high	97.5	Very high	0 Å²	0	57.2 Å²	57.2	0%	0	29%	0.289	C	S	.	.	H	α-helix	trans	-64.1	-40.7	176.6	0	0	0	0	0	111.7	I32 V33 L49 S50 I55 I56 A57 L88 I91	I32-A53 HydrophobicContact CB-CB 4.36Å; I32-A53 HydrophobicContact CG2-CB 3.83Å; V33-A53 HydrophobicContact CG2-CB 3.71Å; L49-A53 PolarHBondContact O-N 2.92Å; L49-A53 VanDerWaalsContact O-N 3.08Å; S50-A53 PolarHBondContact O-N 2.96Å; A53-I55 PolarHBondContact O-N 3.01Å; A53-I56 PolarHBondContact O-N 3.42Å; A53-A57 PolarHBondContact O-N 2.86Å; A53-L88 HydrophobicContact CB-CD2 4.5Å; A53-I91 HydrophobicContact CB-CD1 4.03Å
54	L	98.4	Very high	97.5	Very high	82 Å²	82	55.4 Å²	55.4	43%	0.429	28%	0.276	S	S	.	.	H	α-helix	trans	-62.6	-38.8	176.3	-75.8	172	0	0	0	113	L30 V33 S50 I51 I56 A57 E58	L30-L54 HydrophobicContact CD2-CD2 4.41Å; V33-L54 HydrophobicContact CG1-CD2 4.4Å; V33-L54 HydrophobicContact CG1-CG 4.41Å; V33-L54 HydrophobicContact CG2-CD2 3.9Å; V33-L54 HydrophobicContact CG2-CG 3.71Å; S50-L54 WeakPolarHBondContact O-CB 3.4Å; S50-L54 WeakPolarHBondContact O-CG 3.36Å; S50-L54 PolarHBondContact O-N 2.91Å; I51-L54 PolarHBondContact O-N 3.02Å; L54-I56 VanDerWaalsContact C-N 3.28Å; L54-I56 PolarHBondContact O-N 3.39Å; L54-A57 PolarHBondContact O-N 3.05Å; L54-E58 WeakPolarHBondContact O-CB 3.29Å; L54-E58 PolarHBondContact O-N 3.21Å
55	I	98.3	Very high	97.4	Very high	75 Å²	75	56.7 Å²	56.7	39%	0.385	28%	0.278	S	S	.	.	H	α-helix	trans	-61.4	-39.7	175.9	-71	164.2	0	0	0	110.9	I51 K52 A53 K59	I51-I55 HydrophobicContact CG2-CD1 3.92Å; I51-I55 HydrophobicContact CG2-CG1 4.49Å; I51-I55 VanDerWaalsContact O-CG1 3.3Å; I51-I55 WeakPolarHBondContact O-CG1 3.39Å; I51-I55 PolarHBondContact O-N 3.2Å; K52-I55 PolarHBondContact O-N 3.35Å; A53-I55 PolarHBondContact O-N 3.01Å; I55-K59 HydrophobicContact CG2-CD 4.29Å; I55-K59 VanDerWaalsContact O-CG 3.32Å; I55-K59 WeakPolarHBondContact O-CG 3.26Å; I55-K59 PolarHBondContact O-N 3.23Å
56	I	98	Very high	97.3	Very high	8 Å²	8	60 Å²	60	4%	0.041	30%	0.295	C	S	.	.	H	α-helix	trans	-66.1	-48.5	176.1	-65.3	163.3	0	0	0	109.9	T25 A29 K52 A53 L54 E58 K59 A60 W84 D87 L88 I91	T25-I56 HydrophobicContact CG2-CG2 4.15Å; A29-I56 HydrophobicContact CB-CG2 4.36Å; K52-I56 PolarHBondContact O-N 3.34Å; A53-I56 PolarHBondContact O-N 3.42Å; L54-I56 VanDerWaalsContact C-N 3.28Å; L54-I56 PolarHBondContact O-N 3.39Å; I56-E58 PolarHBondContact O-N 3.34Å; I56-K59 PolarHBondContact O-N 3.48Å; I56-A60 VanDerWaalsContact O-CB 3.28Å; I56-A60 WeakPolarHBondContact O-CB 3.5Å; I56-A60 PolarHBondContact O-N 2.88Å; I56-W84 HydrophobicContact CG2-CB 3.77Å; I56-W84 HydrophobicContact CG2-CD2 4.37Å; I56-W84 HydrophobicContact CG2-CG 3.9Å; I56-D87 HydrophobicContact CD1-CB 3.7Å; I56-L88 HydrophobicContact CD1-CD2 3.61Å; I56-L88 HydrophobicContact CD1-CG 4.01Å; I56-L88 HydrophobicContact CG2-CD2 4.44Å; I56-L88 HydrophobicContact CG2-CG 4.48Å; I56-I91 HydrophobicContact CD1-CD1 4.39Å
57	A	98.1	Very high	96.9	Very high	0 Å²	0	60.7 Å²	60.7	0%	0	30%	0.303	C	S	.	.	H	α-helix	trans	-59.1	-44.6	178.9	0	0	0	0	0	112.1	T26 A29 L30 A53 L54 A60 M61	T26-A57 HydrophobicContact CG2-CB 4.4Å; A29-A57 HydrophobicContact CB-CB 3.98Å; L30-A57 HydrophobicContact CD2-CB 3.95Å; L30-A57 HydrophobicContact CG-CB 4.19Å; A53-A57 PolarHBondContact O-N 2.86Å; L54-A57 PolarHBondContact O-N 3.05Å; A57-A60 PolarHBondContact O-N 3.29Å; A57-M61 HydrophobicContact CB-CE 4.43Å; A57-M61 WeakPolarHBondContact O-CB 3.48Å; A57-M61 WeakPolarHBondContact O-CE 3.39Å; A57-M61 VanDerWaalsContact O-CG 3.26Å; A57-M61 WeakPolarHBondContact O-CG 3.47Å; A57-M61 PolarHBondContact O-N 3.28Å
58	E	98	Very high	96.6	Very high	132 Å²	132	62 Å²	62	62%	0.617	32%	0.315	S	S	*	.	H	α-helix	trans	-59.4	-50.2	178.3	-177.8	-176.6	-162.8	0	0	111.6	L54 I56 A60 M61 A62	L54-E58 WeakPolarHBondContact O-CB 3.29Å; L54-E58 PolarHBondContact O-N 3.21Å; I56-E58 PolarHBondContact O-N 3.34Å; E58-A60 VanDerWaalsContact C-N 3.34Å; E58-A60 PolarHBondContact O-N 3.03Å; E58-M61 PolarHBondContact O-N 2.73Å; E58-A62 PolarHBondContact O-N 3.04Å
59	K	96.7	Very high	96.2	Very high	113 Å²	113	59.5 Å²	59.5	49%	0.491	32%	0.316	S	S	.	.	H	α-helix	trans	-62.7	-42	178.5	-71.1	176.2	178.2	-176.4	0	112.1	I55 I56 A62 V63 W84	I55-K59 HydrophobicContact CG2-CD 4.29Å; I55-K59 VanDerWaalsContact O-CG 3.32Å; I55-K59 WeakPolarHBondContact O-CG 3.26Å; I55-K59 PolarHBondContact O-N 3.23Å; I56-K59 PolarHBondContact O-N 3.48Å; K59-A62 PolarHBondContact O-N 2.85Å; K59-V63 PolarHBondContact O-N 3.05Å; K59-W84 HydrophobicContact CB-CH2 4.13Å; K59-W84 HydrophobicContact CB-CZ2 3.64Å; K59-W84 HydrophobicContact CD-CZ2 4.41Å
60	A	96.8	Very high	95.8	Very high	0 Å²	0	62.3 Å²	62.3	0%	0	33%	0.326	C	S	.	.	H	α-helix	trans	-67.7	-39.5	179.4	0	0	0	0	0	111.8	I22 T26 I56 A57 E58 V63 L64 W84	I22-A60 HydrophobicContact CG2-CB 3.87Å; T26-A60 HydrophobicContact CG2-CB 4.49Å; T26-A60 WeakPolarHBondContact OG1-CB 3.04Å; I56-A60 VanDerWaalsContact O-CB 3.28Å; I56-A60 WeakPolarHBondContact O-CB 3.5Å; I56-A60 PolarHBondContact O-N 2.88Å; A57-A60 PolarHBondContact O-N 3.29Å; E58-A60 VanDerWaalsContact C-N 3.34Å; E58-A60 PolarHBondContact O-N 3.03Å; A60-V63 WeakPolarHBondContact O-CB 3.48Å; A60-V63 PolarHBondContact O-N 3.1Å; A60-L64 VanDerWaalsContact O-CG 3.29Å; A60-L64 WeakPolarHBondContact O-CG 3.42Å; A60-L64 PolarHBondContact O-N 3.39Å; A60-W84 HydrophobicContact CB-CE3 3.91Å; A60-W84 HydrophobicContact CB-CH2 4.2Å; A60-W84 HydrophobicContact CB-CZ3 3.56Å
61	M	97.2	Very high	95.3	Very high	79 Å²	79	66.6 Å²	66.6	39%	0.389	35%	0.346	S	S	.	.	H	α-helix	trans	-61.3	-43	172.1	-74.5	-175.4	-65.4	0	0	111.7	T26 A57 E58 V63 L64 E65	T26-M61 HydrophobicContact CG2-CG 3.63Å; T26-M61 HydrophobicContact CG2-SD 4.47Å; A57-M61 HydrophobicContact CB-CE 4.43Å; A57-M61 WeakPolarHBondContact O-CB 3.48Å; A57-M61 WeakPolarHBondContact O-CE 3.39Å; A57-M61 VanDerWaalsContact O-CG 3.26Å; A57-M61 WeakPolarHBondContact O-CG 3.47Å; A57-M61 PolarHBondContact O-N 3.28Å; E58-M61 PolarHBondContact O-N 2.73Å; M61-V63 VanDerWaalsContact C-N 3.26Å; M61-V63 PolarHBondContact O-N 3.47Å; M61-L64 CarbonylContact O-C 3.6Å; M61-L64 PolarHBondContact O-N 3.34Å; M61-E65 WeakPolarHBondContact O-CG 3.44Å; M61-E65 PolarHBondContact O-N 3.44Å
62	A	95.5	Very high	95	Very high	43 Å²	43	68.4 Å²	68.4	36%	0.355	36%	0.357	S	S	.	.	H	α-helix	trans	-59.4	-36.8	177.6	0	0	0	0	0	112.8	E58 K59	E58-A62 PolarHBondContact O-N 3.04Å; K59-A62 PolarHBondContact O-N 2.85Å
63	V	95.8	Very high	94.7	Very high	7 Å²	7	70 Å²	70	4%	0.042	36%	0.361	C	S	.	.	H	α-helix	trans	-65.3	-48	172	169.7	0	0	0	0	111.2	F19 I22 K59 A60 M61 E65 N66 Y70 L77 W84	F19-V63 HydrophobicContact CD1-CG1 4.31Å; F19-V63 HydrophobicContact CE1-CG1 3.78Å; I22-V63 HydrophobicContact CD1-CG1 4.01Å; K59-V63 PolarHBondContact O-N 3.05Å; A60-V63 WeakPolarHBondContact O-CB 3.48Å; A60-V63 PolarHBondContact O-N 3.1Å; M61-V63 VanDerWaalsContact C-N 3.26Å; M61-V63 PolarHBondContact O-N 3.47Å; V63-E65 VanDerWaalsContact C-N 3.29Å; V63-E65 PolarHBondContact O-N 2.89Å; V63-N66 CarbonylContact O-C 3.36Å; V63-N66 PolarHBondContact O-N 3.3Å; V63-Y70 HydrophobicContact CB-CE2 4.26Å; V63-Y70 HydrophobicContact CG1-CD2 4.07Å; V63-Y70 HydrophobicContact CG1-CE2 4.28Å; V63-Y70 HydrophobicContact CG1-CG 4.37Å; V63-Y70 HydrophobicContact CG2-CE1 4.16Å; V63-Y70 HydrophobicContact CG2-CE2 4.14Å; V63-L77 HydrophobicContact CB-CD1 4.4Å; V63-L77 HydrophobicContact CG1-CD1 3.57Å; V63-L77 HydrophobicContact CG1-CD2 4.08Å; V63-L77 HydrophobicContact CG1-CG 4.41Å; V63-L77 HydrophobicContact CG2-CD1 3.91Å; V63-W84 HydrophobicContact CG2-CH2 3.99Å
64	L	95.6	Very high	94.4	Very high	52 Å²	52	71 Å²	71	27%	0.272	37%	0.366	S	S	.	.	H	α-helix	trans	-67.6	-27.3	-176.9	-68.1	168.3	0	0	0	113.3	F19 I22 Y23 A60 M61 N66 P67	F19-L64 HydrophobicContact CD1-CD2 4.24Å; I22-L64 HydrophobicContact CB-CD2 4.41Å; I22-L64 HydrophobicContact CG2-CD1 4.12Å; I22-L64 HydrophobicContact CG2-CD2 4.03Å; I22-L64 HydrophobicContact CG2-CG 3.86Å; Y23-L64 HydrophobicContact CD2-CD1 4.34Å; A60-L64 VanDerWaalsContact O-CG 3.29Å; A60-L64 WeakPolarHBondContact O-CG 3.42Å; A60-L64 PolarHBondContact O-N 3.39Å; M61-L64 CarbonylContact O-C 3.6Å; M61-L64 PolarHBondContact O-N 3.34Å; L64-N66 VanDerWaalsContact C-N 3.31Å; L64-P67 WeakPolarHBondContact O-CD 3.47Å
65	E	96.3	Very high	94.1	Very high	144 Å²	144	72.1 Å²	72.1	67%	0.673	37%	0.372	S	S	*	.	H	α-helix	trans	-70.4	-27.7	175.1	-76.6	176.9	174.1	0	0	112.4	M61 V63	M61-E65 WeakPolarHBondContact O-CG 3.44Å; M61-E65 PolarHBondContact O-N 3.44Å; V63-E65 VanDerWaalsContact C-N 3.29Å; V63-E65 PolarHBondContact O-N 2.89Å
66	N	93.1	Very high	93.9	Very high	82 Å²	82	73.1 Å²	73.1	44%	0.439	38%	0.375	S	S	.	.			trans	-132	56.6	-175.2	-62.6	-76.1	0	0	0	112.6	V63 L64 T68 C69 Y70	V63-N66 CarbonylContact O-C 3.36Å; V63-N66 PolarHBondContact O-N 3.3Å; L64-N66 VanDerWaalsContact C-N 3.31Å; N66-T68 PolarHBondContact O-N 2.67Å; N66-T68 VanDerWaalsContact O-N 3.16Å; N66-C69 HydrophobicContact CB-CB 4.45Å; N66-C69 WeakPolarHBondContact O-CB 3.42Å; N66-C69 PolarHBondContact O-N 2.78Å; N66-Y70 VanDerWaalsContact O-CD2 3.28Å; N66-Y70 WeakPolarHBondContact O-CD2 3.49Å
67	P	90	Very high	93.8	Very high	51 Å²	51	72.8 Å²	72.8	33%	0.331	37%	0.374	S	S	.	.	G	3₁₀ helix	trans	-62.1	-32.8	-170.7	25.1	-34.1	0	0	0	112.6	F19 L64 C69 Y70 M71	F19-P67 HydrophobicContact CD1-CB 4.25Å; F19-P67 HydrophobicContact CE1-CB 3.64Å; F19-P67 HydrophobicContact CE2-CB 4.16Å; F19-P67 HydrophobicContact CZ-CB 3.6Å; F19-P67 WeakPolarHBondContact CZ-O 3.43Å; L64-P67 WeakPolarHBondContact O-CD 3.47Å; P67-C69 PolarHBondContact O-N 2.91Å; P67-C69 VanDerWaalsContact O-N 3.17Å; P67-Y70 PolarHBondContact O-N 3.33Å; P67-M71 PolarHBondContact O-N 3.47Å
68	T	90.1	Very high	93.6	Very high	115 Å²	115	77.1 Å²	77.1	71%	0.706	39%	0.39	S	S	*	.	G	3₁₀ helix	trans	-59.8	-26.8	177.9	60	0	0	0	0	113.7	N66 Y70	N66-T68 PolarHBondContact O-N 2.67Å; N66-T68 VanDerWaalsContact O-N 3.16Å; T68-Y70 PolarHBondContact O-N 3.47Å
69	C	90.4	Very high	93.6	Very high	74 Å²	74	77.5 Å²	77.5	50%	0.5	39%	0.392	S	S	.	.	G	3₁₀ helix	trans	-75.5	-7.4	178	-63.7	0	0	0	0	113.8	N66 P67	N66-C69 HydrophobicContact CB-CB 4.45Å; N66-C69 WeakPolarHBondContact O-CB 3.42Å; N66-C69 PolarHBondContact O-N 2.78Å; P67-C69 PolarHBondContact O-N 2.91Å; P67-C69 VanDerWaalsContact O-N 3.17Å
70	Y	90.1	Very high	93.5	Very high	58 Å²	58	75 Å²	75	23%	0.227	38%	0.383	C	S	.	.	G	3₁₀ helix	trans	-120.9	-0	-176.2	-59.9	-85.6	0	0	0	112.9	V63 N66 P67 T68 D72 R73 I74 L77	V63-Y70 HydrophobicContact CB-CE2 4.26Å; V63-Y70 HydrophobicContact CG1-CD2 4.07Å; V63-Y70 HydrophobicContact CG1-CE2 4.28Å; V63-Y70 HydrophobicContact CG1-CG 4.37Å; V63-Y70 HydrophobicContact CG2-CE1 4.16Å; V63-Y70 HydrophobicContact CG2-CE2 4.14Å; N66-Y70 VanDerWaalsContact O-CD2 3.28Å; N66-Y70 WeakPolarHBondContact O-CD2 3.49Å; P67-Y70 PolarHBondContact O-N 3.33Å; T68-Y70 PolarHBondContact O-N 3.47Å; Y70-D72 PolarHBondContact O-N 3.12Å; Y70-R73 CarbonylContact O-C 3.36Å; Y70-R73 PolarHBondContact O-N 2.98Å; Y70-I74 WeakPolarHBondContact O-CD1 3.44Å; Y70-I74 PolarHBondContact O-N 3.28Å; Y70-L77 HydrophobicContact CD1-CD1 4.02Å; Y70-L77 HydrophobicContact CG-CD1 4.3Å
71	M	88.8	Confident	93.5	Very high	107 Å²	107	75 Å²	75	53%	0.527	38%	0.384	S	S	.	.	T	Hydrogen-bonded Turn	trans	-65.5	-25.7	-178.2	-67.6	-65	-84.1	0	0	113.3	A15 F19 P67 I74	A15-M71 HydrophobicContact CB-CE 4.1Å; A15-M71 HydrophobicContact CB-SD 4Å; F19-M71 HydrophobicContact CE2-SD 3.72Å; F19-M71 HydrophobicContact CZ-SD 4.43Å; P67-M71 PolarHBondContact O-N 3.47Å; M71-I74 VanDerWaalsContact O-CG1 3.3Å; M71-I74 WeakPolarHBondContact O-CG1 3.48Å; M71-I74 HydrophobicContact SD-CD1 4.49Å
72	D	91	Very high	93.5	Very high	136 Å²	136	75.7 Å²	75.7	73%	0.727	39%	0.389	S	S	*	.	T	Hydrogen-bonded Turn	trans	-90.4	-6	173.7	62.7	-27.9	0	0	0	113.2	Y70	Y70-D72 PolarHBondContact O-N 3.12Å
73	R	91.5	Very high	93.6	Very high	113 Å²	113	79 Å²	79	43%	0.426	40%	0.397	S	S	.	.			trans	-121.7	32.1	-176.6	-62.6	176	66.4	-165.2	-0.7	111.8	Y70 D75 E76 L77	Y70-R73 CarbonylContact O-C 3.36Å; Y70-R73 PolarHBondContact O-N 2.98Å; R73-D75 VanDerWaalsContact C-N 3.33Å; R73-D75 PolarHBondContact O-N 3.39Å; R73-E76 IonicContact CZ-OE2 3.14Å; R73-E76 IonicContact NE-OE2 2.78Å; R73-E76 PolarHBondContact NE-OE2 3.01Å; R73-E76 IonicContact NH2-OE2 2.67Å; R73-E76 PolarHBondContact NH2-OE2 3.35Å; R73-E76 PolarHBondContact O-N 2.96Å; R73-L77 WeakPolarHBondContact O-CB 3.4Å; R73-L77 PolarHBondContact O-N 2.99Å
74	I	92.8	Very high	93.7	Very high	21 Å²	21	79.3 Å²	79.3	11%	0.108	40%	0.397	C	S	.	.	H	α-helix	trans	-62.2	-37.5	-172.9	-72.7	-62.2	0	0	0	112.6	E14 A15 I18 F19 Y70 M71 L77 R78	E14-I74 HydrophobicContact CG-CG2 4.05Å; A15-I74 HydrophobicContact CB-CD1 3.66Å; A15-I74 HydrophobicContact CB-CG1 4.22Å; I18-I74 HydrophobicContact CD1-CG2 3.35Å; F19-I74 HydrophobicContact CE2-CD1 4.03Å; Y70-I74 WeakPolarHBondContact O-CD1 3.44Å; Y70-I74 PolarHBondContact O-N 3.28Å; M71-I74 VanDerWaalsContact O-CG1 3.3Å; M71-I74 WeakPolarHBondContact O-CG1 3.48Å; M71-I74 HydrophobicContact SD-CD1 4.49Å; I74-L77 HydrophobicContact CD1-CD2 4.42Å; I74-L77 WeakPolarHBondContact O-CB 3.28Å; I74-L77 PolarHBondContact O-N 3Å; I74-R78 PolarHBondContact O-N 3.19Å
75	D	92.2	Very high	93.8	Very high	105 Å²	105	79.2 Å²	79.2	56%	0.561	40%	0.401	S	S	*	.	H	α-helix	trans	-67	-44.1	176.9	-70.8	-36.9	0	0	0	112.3	R73 L77 R78 E79	R73-D75 VanDerWaalsContact C-N 3.33Å; R73-D75 PolarHBondContact O-N 3.39Å; D75-L77 PolarHBondContact O-N 3.31Å; D75-R78 WeakPolarHBondContact O-CB 3.45Å; D75-R78 PolarHBondContact O-N 2.96Å; D75-R78 IonicContact OD1-NH1 3.84Å; D75-E79 PolarHBondContact O-N 3.43Å; D75-E79 VanDerWaalsContact O-N 3.09Å
76	E	94.2	Very high	93.9	Very high	95 Å²	95	75.1 Å²	75.1	44%	0.444	39%	0.392	S	S	.	.	H	α-helix	trans	-62.6	-36.3	174.5	-62.3	177.9	-167.6	0	0	111.2	R73 E79 L80	R73-E76 IonicContact CZ-OE2 3.14Å; R73-E76 IonicContact NE-OE2 2.78Å; R73-E76 PolarHBondContact NE-OE2 3.01Å; R73-E76 IonicContact NH2-OE2 2.67Å; R73-E76 PolarHBondContact NH2-OE2 3.35Å; R73-E76 PolarHBondContact O-N 2.96Å; E76-E79 PolarHBondContact O-N 3.36Å; E76-L80 WeakPolarHBondContact O-CG 3.5Å; E76-L80 PolarHBondContact O-N 3.34Å
77	L	94.7	Very high	94.1	Very high	2 Å²	2	74.5 Å²	74.5	1%	0.01	39%	0.389	C	S	.	.	H	α-helix	trans	-68.7	-36.2	178.3	-165.8	72.8	0	0	0	111.9	I18 F19 I22 V63 Y70 R73 I74 D75 A81	I18-L77 HydrophobicContact CG2-CB 4.33Å; I18-L77 HydrophobicContact CG2-CD2 3.74Å; I18-L77 HydrophobicContact CG2-CG 3.97Å; F19-L77 HydrophobicContact CD1-CD2 4.27Å; F19-L77 HydrophobicContact CE1-CD2 3.76Å; F19-L77 HydrophobicContact CE2-CD2 4.48Å; F19-L77 HydrophobicContact CZ-CD2 3.87Å; I22-L77 HydrophobicContact CD1-CD1 3.82Å; I22-L77 HydrophobicContact CD1-CD2 3.56Å; I22-L77 HydrophobicContact CD1-CG 3.52Å; V63-L77 HydrophobicContact CB-CD1 4.4Å; V63-L77 HydrophobicContact CG1-CD1 3.57Å; V63-L77 HydrophobicContact CG1-CD2 4.08Å; V63-L77 HydrophobicContact CG1-CG 4.41Å; V63-L77 HydrophobicContact CG2-CD1 3.91Å; Y70-L77 HydrophobicContact CD1-CD1 4.02Å; Y70-L77 HydrophobicContact CG-CD1 4.3Å; R73-L77 WeakPolarHBondContact O-CB 3.4Å; R73-L77 PolarHBondContact O-N 2.99Å; I74-L77 HydrophobicContact CD1-CD2 4.42Å; I74-L77 WeakPolarHBondContact O-CB 3.28Å; I74-L77 PolarHBondContact O-N 3Å; D75-L77 PolarHBondContact O-N 3.31Å; L77-A81 WeakPolarHBondContact O-CB 3.43Å; L77-A81 PolarHBondContact O-N 2.92Å
78	R	95.7	Very high	94.5	Very high	91 Å²	91	72.2 Å²	72.2	34%	0.343	37%	0.373	S	S	.	.	H	α-helix	trans	-60.4	-50.6	171	172.9	-179.6	-75.1	150.6	-4	111	E14 I18 I74 D75 L80 A81 D82	E14-R78 VanDerWaalsContact CG-NH2 3.32Å; E14-R78 IonicContact OE1-CZ 3.07Å; E14-R78 IonicContact OE1-NH1 2.74Å; E14-R78 PolarHBondContact OE1-NH1 3.07Å; E14-R78 IonicContact OE1-NH2 2.63Å; E14-R78 PolarHBondContact OE1-NH2 3.17Å; I18-R78 HydrophobicContact CD1-CB 3.89Å; I18-R78 HydrophobicContact CG1-CB 4.28Å; I74-R78 PolarHBondContact O-N 3.19Å; D75-R78 WeakPolarHBondContact O-CB 3.45Å; D75-R78 PolarHBondContact O-N 2.96Å; D75-R78 IonicContact OD1-NH1 3.84Å; R78-L80 VanDerWaalsContact C-N 3.32Å; R78-L80 PolarHBondContact O-N 3.16Å; R78-A81 PolarHBondContact O-N 3.47Å; R78-A81 VanDerWaalsContact O-N 3.12Å; R78-D82 PolarHBondContact O-N 3.39Å
79	E	96.2	Very high	94.8	Very high	140 Å²	140	72.2 Å²	72.2	65%	0.654	37%	0.369	S	S	*	.	H	α-helix	trans	-58.8	-43.8	179.7	-69.9	-177.5	176.4	0	0	111.9	D75 E76 A81 D82 E83	D75-E79 PolarHBondContact O-N 3.43Å; D75-E79 VanDerWaalsContact O-N 3.09Å; E76-E79 PolarHBondContact O-N 3.36Å; E79-A81 VanDerWaalsContact C-N 3.34Å; E79-A81 PolarHBondContact O-N 3.36Å; E79-D82 PolarHBondContact O-N 3.03Å; E79-E83 PolarHBondContact O-N 3.02Å
80	L	95.9	Very high	95.2	Very high	60 Å²	60	76.4 Å²	76.4	31%	0.314	37%	0.374	S	S	.	.	H	α-helix	trans	-61.7	-41.3	175.2	-78.2	169.1	0	0	0	112.5	E76 R78 D82 E83 W84	E76-L80 WeakPolarHBondContact O-CG 3.5Å; E76-L80 PolarHBondContact O-N 3.34Å; R78-L80 VanDerWaalsContact C-N 3.32Å; R78-L80 PolarHBondContact O-N 3.16Å; L80-D82 VanDerWaalsContact C-N 3.35Å; L80-E83 PolarHBondContact O-N 3.5Å; L80-W84 HydrophobicContact CB-CZ2 4.47Å; L80-W84 VanDerWaalsContact O-CG 3.23Å; L80-W84 PolarHBondContact O-N 2.89Å
81	A	96.4	Very high	95.6	Very high	1 Å²	1	73.8 Å²	73.8	1%	0.008	36%	0.364	C	S	.	.	H	α-helix	trans	-67.8	-37.7	179.8	0	0	0	0	0	111.7	F21 I22 L77 R78 E79 W84 S85	F21-A81 HydrophobicContact CD1-CB 3.6Å; F21-A81 HydrophobicContact CE1-CB 3.79Å; F21-A81 WeakPolarHBondContact CE1-O 3.49Å; I22-A81 HydrophobicContact CD1-CB 4.36Å; I22-A81 HydrophobicContact CG1-CB 3.76Å; L77-A81 WeakPolarHBondContact O-CB 3.43Å; L77-A81 PolarHBondContact O-N 2.92Å; R78-A81 PolarHBondContact O-N 3.47Å; R78-A81 VanDerWaalsContact O-N 3.12Å; E79-A81 VanDerWaalsContact C-N 3.34Å; E79-A81 PolarHBondContact O-N 3.36Å; A81-W84 PolarHBondContact O-N 3.1Å; A81-S85 WeakPolarHBondContact O-CB 3.36Å; A81-S85 PolarHBondContact O-N 3.34Å
82	D	97.2	Very high	96	Very high	93 Å²	93	71.8 Å²	71.8	50%	0.497	35%	0.353	S	S	.	.	H	α-helix	trans	-64.5	-41.7	173.3	-73.4	-21	0	0	0	111.5	R78 E79 L80 S85 A86	R78-D82 PolarHBondContact O-N 3.39Å; E79-D82 PolarHBondContact O-N 3.03Å; L80-D82 VanDerWaalsContact C-N 3.35Å; D82-S85 WeakPolarHBondContact O-CB 3.36Å; D82-S85 PolarHBondContact O-N 2.84Å; D82-A86 PolarHBondContact O-N 3.36Å
83	E	97.6	Very high	96.3	Very high	111 Å²	111	72.1 Å²	72.1	52%	0.519	35%	0.348	S	S	.	.	H	α-helix	trans	-59.9	-47.3	174.2	-174.1	-178	-179.5	0	0	111.4	E79 L80 S85 A86 D87	E79-E83 PolarHBondContact O-N 3.02Å; L80-E83 PolarHBondContact O-N 3.5Å; E83-S85 VanDerWaalsContact C-N 3.31Å; E83-S85 PolarHBondContact O-N 3.01Å; E83-A86 PolarHBondContact O-N 3.06Å; E83-D87 PolarHBondContact O-N 2.99Å
84	W	98	Very high	96.6	Very high	14 Å²	14	68.7 Å²	68.7	5%	0.053	34%	0.337	C	S	.	.	H	α-helix	trans	-62	-39.1	177.2	-66.5	-13	0	0	0	112.7	I22 T25 I56 K59 A60 V63 L80 A81 D87 L88	I22-W84 HydrophobicContact CG1-CZ3 4.39Å; I22-W84 HydrophobicContact CG2-CZ3 4.06Å; T25-W84 HydrophobicContact CG2-CB 3.87Å; I56-W84 HydrophobicContact CG2-CB 3.77Å; I56-W84 HydrophobicContact CG2-CD2 4.37Å; I56-W84 HydrophobicContact CG2-CG 3.9Å; K59-W84 HydrophobicContact CB-CH2 4.13Å; K59-W84 HydrophobicContact CB-CZ2 3.64Å; K59-W84 HydrophobicContact CD-CZ2 4.41Å; A60-W84 HydrophobicContact CB-CE3 3.91Å; A60-W84 HydrophobicContact CB-CH2 4.2Å; A60-W84 HydrophobicContact CB-CZ3 3.56Å; V63-W84 HydrophobicContact CG2-CH2 3.99Å; L80-W84 HydrophobicContact CB-CZ2 4.47Å; L80-W84 VanDerWaalsContact O-CG 3.23Å; L80-W84 PolarHBondContact O-N 2.89Å; A81-W84 PolarHBondContact O-N 3.1Å; W84-D87 PolarHBondContact O-N 3.31Å; W84-L88 WeakPolarHBondContact O-CG 3.47Å; W84-L88 PolarHBondContact O-N 3.21Å
85	S	97.3	Very high	96.8	Very high	50 Å²	50	68.3 Å²	68.3	35%	0.35	34%	0.335	S	S	.	.	H	α-helix	trans	-60.9	-45.6	174.6	-174.6	0	0	0	0	111.5	A81 D82 E83 D87 L88 L89	A81-S85 WeakPolarHBondContact O-CB 3.36Å; A81-S85 PolarHBondContact O-N 3.34Å; D82-S85 WeakPolarHBondContact O-CB 3.36Å; D82-S85 PolarHBondContact O-N 2.84Å; E83-S85 VanDerWaalsContact C-N 3.31Å; E83-S85 PolarHBondContact O-N 3.01Å; S85-D87 VanDerWaalsContact C-N 3.34Å; S85-D87 PolarHBondContact O-N 3.4Å; S85-L88 PolarHBondContact O-N 3.37Å; S85-L89 PolarHBondContact O-N 2.91Å
86	A	98.1	Very high	96.9	Very high	58 Å²	58	65.8 Å²	65.8	48%	0.479	33%	0.329	S	S	.	.	H	α-helix	trans	-64.2	-37.7	176.6	0	0	0	0	0	112.7	D82 E83 L89 R90	D82-A86 PolarHBondContact O-N 3.36Å; E83-A86 PolarHBondContact O-N 3.06Å; A86-L89 PolarHBondContact O-N 3.45Å; A86-R90 PolarHBondContact O-N 2.94Å
87	D	98	Very high	97	Very high	70 Å²	70	64 Å²	64	37%	0.374	33%	0.325	S	S	.	.	H	α-helix	trans	-67.2	-40	176.1	-87.4	-17.6	0	0	0	112.6	I56 E83 W84 S85 R90 I91	I56-D87 HydrophobicContact CD1-CB 3.7Å; E83-D87 PolarHBondContact O-N 2.99Å; W84-D87 PolarHBondContact O-N 3.31Å; S85-D87 VanDerWaalsContact C-N 3.34Å; S85-D87 PolarHBondContact O-N 3.4Å; D87-R90 WeakPolarHBondContact O-CB 3.34Å; D87-R90 PolarHBondContact O-N 3.28Å; D87-I91 WeakPolarHBondContact O-CG1 3.3Å; D87-I91 PolarHBondContact O-N 3.09Å; D87-I91 VanDerWaalsContact O-N 3.1Å
88	L	98	Very high	96.9	Very high	2 Å²	2	66.8 Å²	66.8	1%	0.01	34%	0.335	C	S	.	.	H	α-helix	trans	-61.2	-45.8	172.2	-70.2	-176	0	0	0	111	T25 H28 A29 I32 A53 I56 W84 S85 R90 I91 E92	T25-L88 HydrophobicContact CG2-CD1 3.77Å; H28-L88 HydrophobicContact CB-CD1 4.06Å; A29-L88 HydrophobicContact CB-CD1 4.16Å; A29-L88 HydrophobicContact CB-CD2 3.77Å; I32-L88 HydrophobicContact CD1-CB 4.18Å; I32-L88 HydrophobicContact CD1-CD2 3.9Å; I32-L88 HydrophobicContact CD1-CG 4.43Å; A53-L88 HydrophobicContact CB-CD2 4.5Å; I56-L88 HydrophobicContact CD1-CD2 3.61Å; I56-L88 HydrophobicContact CD1-CG 4.01Å; I56-L88 HydrophobicContact CG2-CD2 4.44Å; I56-L88 HydrophobicContact CG2-CG 4.48Å; W84-L88 WeakPolarHBondContact O-CG 3.47Å; W84-L88 PolarHBondContact O-N 3.21Å; S85-L88 PolarHBondContact O-N 3.37Å; L88-R90 PolarHBondContact O-N 2.95Å; L88-I91 HydrophobicContact CD2-CD1 4.24Å; L88-I91 WeakPolarHBondContact O-CA 3.37Å; L88-I91 WeakPolarHBondContact O-CB 3.47Å; L88-I91 PolarHBondContact O-N 3.29Å; L88-E92 PolarHBondContact O-N 3.15Å
89	L	97.7	Very high	96.8	Very high	116 Å²	116	67 Å²	67	61%	0.607	34%	0.342	S	S	*	.	H	α-helix	trans	-57.8	-36.4	176.4	-172.9	69	0	0	0	112	S85 A86 I91 E92 F93	S85-L89 PolarHBondContact O-N 2.91Å; A86-L89 PolarHBondContact O-N 3.45Å; L89-I91 VanDerWaalsContact C-N 3.34Å; L89-E92 WeakPolarHBondContact CA-OE2 3.4Å; L89-E92 PolarHBondContact O-N 3.13Å; L89-F93 WeakPolarHBondContact O-CB 3.41Å; L89-F93 PolarHBondContact O-N 3.47Å
90	R	98	Very high	96.6	Very high	161 Å²	161	64 Å²	64	61%	0.608	34%	0.336	S	S	*	.	H	α-helix	trans	-67.5	-33.9	175.2	-174	176.8	-178.4	147.7	4	112.5	A86 D87 L88 Q94	A86-R90 PolarHBondContact O-N 2.94Å; D87-R90 WeakPolarHBondContact O-CB 3.34Å; D87-R90 PolarHBondContact O-N 3.28Å; L88-R90 PolarHBondContact O-N 2.95Å; R90-Q94 WeakPolarHBondContact O-CG 3.21Å; R90-Q94 PolarHBondContact O-N 3.37Å
91	I	98.2	Very high	96	Very high	4 Å²	4	66.4 Å²	66.4	2%	0.021	35%	0.346	C	S	.	.	H	α-helix	trans	-68	-48	173.6	-64.6	167.5	0	0	0	109.6	I32 L49 K52 A53 I56 D87 L88 L89 F93 Q94 Q95	I32-I91 HydrophobicContact CG2-CG2 3.55Å; L49-I91 HydrophobicContact CB-CG2 4.14Å; L49-I91 HydrophobicContact CD2-CG2 4.24Å; K52-I91 HydrophobicContact CB-CD1 3.68Å; K52-I91 HydrophobicContact CB-CG1 4.26Å; A53-I91 HydrophobicContact CB-CD1 4.03Å; I56-I91 HydrophobicContact CD1-CD1 4.39Å; D87-I91 WeakPolarHBondContact O-CG1 3.3Å; D87-I91 PolarHBondContact O-N 3.09Å; D87-I91 VanDerWaalsContact O-N 3.1Å; L88-I91 HydrophobicContact CD2-CD1 4.24Å; L88-I91 WeakPolarHBondContact O-CA 3.37Å; L88-I91 WeakPolarHBondContact O-CB 3.47Å; L88-I91 PolarHBondContact O-N 3.29Å; L89-I91 VanDerWaalsContact C-N 3.34Å; I91-F93 VanDerWaalsContact C-N 3.3Å; I91-F93 PolarHBondContact O-N 3.35Å; I91-Q94 CarbonylContact O-C 3.6Å; I91-Q94 WeakPolarHBondContact O-CA 3.15Å; I91-Q94 WeakPolarHBondContact O-CB 3.46Å; I91-Q94 PolarHBondContact O-N 2.85Å; I91-Q95 PolarHBondContact O-N 3.37Å
92	E	97.9	Very high	94.9	Very high	64 Å²	64	70.2 Å²	70.2	30%	0.299	37%	0.369	S	S	.	.	H	α-helix	trans	-59	-41.3	177.6	-67.8	175.3	101.7	0	0	111.8	H28 I32 L88 L89 Q94 Q95 A96	H28-E92 VanDerWaalsContact CE1-CD 3.46Å; H28-E92 IonicContact CE1-OE1 3.28Å; H28-E92 PolarHBondContact CE1-OE1 2.86Å; H28-E92 VanDerWaalsContact CE1-OE1 3.28Å; H28-E92 IonicContact CE1-OE2 3.47Å; H28-E92 PolarHBondContact CE1-OE2 3.37Å; H28-E92 IonicContact NE2-OE1 3.33Å; H28-E92 PolarHBondContact NE2-OE1 2.98Å; I32-E92 HydrophobicContact CD1-CG 3.81Å; I32-E92 HydrophobicContact CG1-CG 4.36Å; L88-E92 PolarHBondContact O-N 3.15Å; L89-E92 WeakPolarHBondContact CA-OE2 3.4Å; L89-E92 PolarHBondContact O-N 3.13Å; E92-Q94 VanDerWaalsContact C-N 3.28Å; E92-Q94 PolarHBondContact O-N 2.94Å; E92-Q95 WeakPolarHBondContact O-CB 3.26Å; E92-Q95 PolarHBondContact O-N 2.99Å; E92-Q95 VanDerWaalsContact O-N 3.13Å; E92-A96 WeakPolarHBondContact O-CB 3.46Å; E92-A96 PolarHBondContact O-N 2.63Å
93	F	97.7	Very high	92.8	Very high	143 Å²	143	73.9 Å²	73.9	63%	0.627	38%	0.383	S	S	*	.	H	α-helix	trans	-59.8	-40.1	173.8	-174.8	-95.8	0	0	0	112	L89 I91 A96 V97	L89-F93 WeakPolarHBondContact O-CB 3.41Å; L89-F93 PolarHBondContact O-N 3.47Å; I91-F93 VanDerWaalsContact C-N 3.3Å; I91-F93 PolarHBondContact O-N 3.35Å; F93-A96 PolarHBondContact O-N 3.22Å; F93-V97 HydrophobicContact CD1-CG2 4.27Å; F93-V97 HydrophobicContact CE1-CG2 3.89Å; F93-V97 HydrophobicContact CZ-CG2 4.23Å; F93-V97 WeakPolarHBondContact O-CG2 3.31Å; F93-V97 PolarHBondContact O-N 2.73Å
94	Q	96.7	Very high	90.6	Very high	42 Å²	42	73.2 Å²	73.2	20%	0.196	39%	0.389	C	S	.	.	H	α-helix	trans	-67	-40.2	174.9	-70.5	-179.6	28.7	0	0	111.7	L49 R90 I91 E92 V97 W98	L49-Q94 HydrophobicContact CD1-CB 4.4Å; L49-Q94 HydrophobicContact CD2-CB 3.97Å; R90-Q94 WeakPolarHBondContact O-CG 3.21Å; R90-Q94 PolarHBondContact O-N 3.37Å; I91-Q94 CarbonylContact O-C 3.6Å; I91-Q94 WeakPolarHBondContact O-CA 3.15Å; I91-Q94 WeakPolarHBondContact O-CB 3.46Å; I91-Q94 PolarHBondContact O-N 2.85Å; E92-Q94 VanDerWaalsContact C-N 3.28Å; E92-Q94 PolarHBondContact O-N 2.94Å; Q94-V97 PolarHBondContact O-N 3.41Å; Q94-W98 PolarHBondContact O-N 3.37Å; Q94-W98 VanDerWaalsContact O-N 3.17Å
95	Q	96.3	Very high	88.2	Confident	12 Å²	12	79.5 Å²	79.5	6%	0.056	42%	0.422	C	S	.	.	H	α-helix	trans	-59	-47.2	173.9	-67.4	173.4	-53.4	0	0	110.9	N36 L39 L49 I91 E92 V97 W98 L99	N36-Q95 WeakPolarHBondContact OD1-CG 3.44Å; N36-Q95 PolarHBondContact OD1-NE2 3.18Å; L39-Q95 HydrophobicContact CD1-CB 3.83Å; L39-Q95 HydrophobicContact CD1-CG 4.08Å; L39-Q95 HydrophobicContact CD2-CG 4.12Å; L49-Q95 HydrophobicContact CD1-CG 4.05Å; I91-Q95 PolarHBondContact O-N 3.37Å; E92-Q95 WeakPolarHBondContact O-CB 3.26Å; E92-Q95 PolarHBondContact O-N 2.99Å; E92-Q95 VanDerWaalsContact O-N 3.13Å; Q95-V97 VanDerWaalsContact C-N 3.31Å; Q95-V97 PolarHBondContact O-N 3.05Å; Q95-W98 PolarHBondContact O-N 2.7Å; Q95-L99 WeakPolarHBondContact O-CG 3.49Å; Q95-L99 PolarHBondContact O-N 3.2Å
96	A	95.9	Very high	86	Confident	52 Å²	52	85.1 Å²	85.1	43%	0.43	45%	0.448	S	S	.	.	H	α-helix	trans	-58.2	-40.7	177.3	0	0	0	0	0	112.6	E92 F93 W98 L99 S100	E92-A96 WeakPolarHBondContact O-CB 3.46Å; E92-A96 PolarHBondContact O-N 2.63Å; F93-A96 PolarHBondContact O-N 3.22Å; A96-W98 VanDerWaalsContact C-N 3.29Å; A96-W98 PolarHBondContact O-N 2.99Å; A96-L99 PolarHBondContact O-N 3.32Å; A96-S100 PolarHBondContact O-N 2.74Å; A96-S100 PolarHBondContact O-OG 3.27Å
97	V	95.1	Very high	83.9	Confident	59 Å²	59	91.2 Å²	91.2	36%	0.358	47%	0.466	S	S	.	.	H	α-helix	trans	-63.5	-33.1	175	168.8	0	0	0	0	112.5	F93 Q94 Q95 S100 Q101	F93-V97 HydrophobicContact CD1-CG2 4.27Å; F93-V97 HydrophobicContact CE1-CG2 3.89Å; F93-V97 HydrophobicContact CZ-CG2 4.23Å; F93-V97 WeakPolarHBondContact O-CG2 3.31Å; F93-V97 PolarHBondContact O-N 2.73Å; Q94-V97 PolarHBondContact O-N 3.41Å; Q95-V97 VanDerWaalsContact C-N 3.31Å; Q95-V97 PolarHBondContact O-N 3.05Å; V97-S100 PolarHBondContact O-OG 2.69Å; V97-S100 VanDerWaalsContact O-OG 3.13Å; V97-Q101 WeakPolarHBondContact O-CG 3.5Å; V97-Q101 PolarHBondContact O-NE2 2.87Å
98	W	94	Very high	81.6	Confident	59 Å²	59	95.4 Å²	95.4	22%	0.223	49%	0.489	C	S	.	.	H	α-helix	trans	-76.6	-38.5	174.9	-78.1	104.8	0	0	0	112.1	L39 A41 P42 V45 Q94 Q95 A96 Q101	L39-W98 HydrophobicContact CD1-CB 4.23Å; L39-W98 HydrophobicContact CD2-CB 4.26Å; L39-W98 HydrophobicContact CD2-CG 4.42Å; L39-W98 HydrophobicContact CG-CB 4.23Å; A41-W98 HydrophobicContact CB-CB 4.23Å; A41-W98 HydrophobicContact CB-CD2 3.54Å; A41-W98 HydrophobicContact CB-CE3 3.82Å; A41-W98 HydrophobicContact CB-CG 3.71Å; A41-W98 HydrophobicContact CB-CZ3 4.43Å; P42-W98 VanDerWaalsContact CD-CH2 3.45Å; P42-W98 HydrophobicContact CG-CH2 4.06Å; P42-W98 HydrophobicContact CG-CZ3 4.39Å; V45-W98 HydrophobicContact CB-CZ2 4.5Å; V45-W98 HydrophobicContact CG1-CZ2 4.22Å; V45-W98 HydrophobicContact CG2-CZ2 3.89Å; Q94-W98 PolarHBondContact O-N 3.37Å; Q94-W98 VanDerWaalsContact O-N 3.17Å; Q95-W98 PolarHBondContact O-N 2.7Å; A96-W98 VanDerWaalsContact C-N 3.29Å; A96-W98 PolarHBondContact O-N 2.99Å; W98-Q101 PolarHBondContact O-N 3.32Å
99	L	92.7	Very high	79	Confident	97 Å²	97	109.2 Å²	109.2	51%	0.508	54%	0.543	S	S	.	.	H	α-helix	trans	-63.7	-41.2	177	-69.9	167.7	0	0	0	111.7	L39 P40 Q95 A96 Q101 V102	L39-L99 HydrophobicContact CD1-CD2 4.27Å; L39-L99 HydrophobicContact CD1-CG 4.03Å; P40-L99 HydrophobicContact CG-CD2 3.98Å; Q95-L99 WeakPolarHBondContact O-CG 3.49Å; Q95-L99 PolarHBondContact O-N 3.2Å; A96-L99 PolarHBondContact O-N 3.32Å; L99-Q101 PolarHBondContact O-N 3.08Å; L99-V102 PolarHBondContact O-N 2.91Å; L99-V102 VanDerWaalsContact O-N 3.11Å
100	S	91.3	Very high	78	Confident	75 Å²	75	108.9 Å²	108.9	52%	0.524	54%	0.539	S	S	.	.	T	Hydrogen-bonded Turn	trans	-67	-18.4	179.3	68.6	0	0	0	0	114.1	A96 V97 V102	A96-S100 PolarHBondContact O-N 2.74Å; A96-S100 PolarHBondContact O-OG 3.27Å; V97-S100 PolarHBondContact O-OG 2.69Å; V97-S100 VanDerWaalsContact O-OG 3.13Å; S100-V102 VanDerWaalsContact C-N 3.29Å
101	Q	84.2	Confident	77	Confident	111 Å²	111	106.1 Å²	106.1	52%	0.519	54%	0.536	S	S	.	.	T	Hydrogen-bonded Turn	trans	-77.5	-15.5	175.7	-71.8	170.5	51.5	0	0	113.1	V97 W98 L99	V97-Q101 WeakPolarHBondContact O-CG 3.5Å; V97-Q101 PolarHBondContact O-NE2 2.87Å; W98-Q101 PolarHBondContact O-N 3.32Å; L99-Q101 PolarHBondContact O-N 3.08Å
102	V	72	Confident	75.8	Confident	82 Å²	82	111.8 Å²	111.8	50%	0.497	56%	0.564	S	S	.	*	S	Bend	trans	-88.4	-11	179.5	-171.3	0	0	0	0	111.9	P40 L99 S100 P104	P40-V102 HydrophobicContact CB-CG2 3.54Å; P40-V102 HydrophobicContact CG-CG2 3.39Å; L99-V102 PolarHBondContact O-N 2.91Å; L99-V102 VanDerWaalsContact O-N 3.11Å; S100-V102 VanDerWaalsContact C-N 3.29Å; V102-P104 WeakPolarHBondContact O-CD 3.46Å
103	E	53.4	Low	74.5	Confident	169 Å²	169	114.6 Å²	114.6	79%	0.79	58%	0.58	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.1	42.5	-168.2	-135.5	163.2	-149.1	0	0	116.8
104	P	51.8	Low	73.1	Confident	97 Å²	97	112.8 Å²	112.8	63%	0.63	58%	0.577	S	S	*	*	T	Hydrogen-bonded Turn	trans	-122.8	9.8	155.8	27.7	-11.4	0	0	0	115.9	V102	V102-P104 WeakPolarHBondContact O-CD 3.46Å
105	L	47.4	Very low	71.5	Confident	146 Å²	146	117.5 Å²	117.5	76%	0.764	60%	0.603	S	S	*	*	S	Bend	trans	-101.2	5.2	-174.4	-69.8	174.4	0	0	0	116.2
106	L	52.4	Low	69.7	Low	169 Å²	169	125.1 Å²	125.1	89%	0.885	64%	0.642	S	S	*	*	S	Bend	trans	-115.7	2.4	-176.8	-73	169.9	0	0	0	115.2
107	E	53.9	Low	67.7	Low	186 Å²	186	130.7 Å²	130.7	87%	0.869	66%	0.658	S	S	*	*	S	Bend	trans	-95.5	-0.8	179.6	-71.7	-168.9	157.5	0	0	115.1
108	D	48.2	Very low	65.4	Low	157 Å²	157	136.7 Å²	136.7	84%	0.84	68%	0.683	S	S	*	*			trans	-112.5	25.6	-175.3	-83.7	-19.8	0	0	0	115.4
109	Y	43.7	Very low	62.8	Low	292 Å²	292	143.7 Å²	143.7	100%	1.145	73%	0.725	S	S	*	*			trans	-119.1	0	174.4	-90.9	-76.6	0	0	0	114.5

Retrieved 109 of 109 residues in 63.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).