A0A077Z5B8_TRITR Loading...

Splicing factor 3B subunit 5

AlphaFold DB , UniProt , Accession A0A077Z5B8, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 79 aa.

						>A0A077Z5B8_TRITR|A0A077Z5B8
MLKNKNTRVSGTGHPDTTCWEWLTNQHRDTYASFIGHPDVLSFMAVVENETRARMRFIFLQRMIQPCGPPPERPDETET
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	41.3	Very low	65.3	Low	245 Å²	245	146.7 Å²	146.7	100%	1.207	75%	0.754	S	S	*	*				0	96.6	0	-158.9	178.9	-159.3	0	0	108.1	K3	M1-K3 PolarHBondContact O-N 3.32Å; M1-K3 VanDerWaalsContact O-N 3.08Å
2	L	51.3	Low	67.2	Low	174 Å²	174	139.7 Å²	139.7	91%	0.911	72%	0.723	S	S	*	*			trans	-69.3	103.2	-178.7	-92	126.7	0	0	0	109.3	N4	L2-N4 PolarHBondContact O-N 2.85Å
3	K	56.7	Low	68.6	Low	193 Å²	193	132.8 Å²	132.8	84%	0.839	71%	0.707	S	S	*	*			trans	-74.1	113.2	174.9	-149.8	171.9	-172.8	175	0	107.4	M1 K5	M1-K3 PolarHBondContact O-N 3.32Å; M1-K3 VanDerWaalsContact O-N 3.08Å; K3-K5 PolarHBondContact O-N 3.09Å
4	N	61.7	Low	70	Confident	105 Å²	105	129.4 Å²	129.4	56%	0.561	68%	0.684	S	S	*	*			trans	-56.2	107.3	175.8	-74.6	-11.3	0	0	0	109.1	L2 N6 T7	L2-N4 PolarHBondContact O-N 2.85Å; N4-N6 PolarHBondContact O-N 3.39Å; N4-T7 HydrophobicContact CB-CG2 3.7Å; N4-T7 PolarHBondContact O-N 3.05Å; N4-T7 PolarHBondContact O-OG1 3.44Å
5	K	60.5	Low	71.3	Confident	191 Å²	191	129.3 Å²	129.3	83%	0.83	70%	0.695	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.6	-21.3	-174.7	-78.2	-177.5	176.1	175.7	0	113.3	K3	K3-K5 PolarHBondContact O-N 3.09Å
6	N	63.6	Low	72.4	Confident	110 Å²	110	129.3 Å²	129.3	59%	0.588	69%	0.694	S	S	*	*	T	Hydrogen-bonded Turn	trans	-97.2	-0.2	-168.1	-57	-16.5	0	0	0	113.4	N4 R8 V9 T12	N4-N6 PolarHBondContact O-N 3.39Å; N6-R8 PolarHBondContact O-N 3.16Å; N6-V9 PolarHBondContact O-N 3.11Å; N6-T12 HydrophobicContact CB-CG2 3.65Å; N6-T12 PolarHBondContact O-OG1 2.98Å; N6-T12 VanDerWaalsContact O-OG1 3.08Å
7	T	65.9	Low	73.4	Confident	105 Å²	105	123.9 Å²	123.9	64%	0.644	67%	0.667	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.3	-8.7	-179.7	54.3	0	0	0	0	114.6	N4 V9	N4-T7 HydrophobicContact CB-CG2 3.7Å; N4-T7 PolarHBondContact O-N 3.05Å; N4-T7 PolarHBondContact O-OG1 3.44Å; T7-V9 VanDerWaalsContact C-N 3.35Å
8	R	73.7	Confident	74.4	Confident	233 Å²	233	120.7 Å²	120.7	88%	0.879	65%	0.653	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.9	-28.6	177.8	-63.5	-174	-179.5	-155.3	0.2	113.1	N6	N6-R8 PolarHBondContact O-N 3.16Å
9	V	78.2	Confident	75.4	Confident	102 Å²	102	119.2 Å²	119.2	62%	0.618	65%	0.651	S	S	*	*	S	Bend	trans	-94.9	115.2	-177.7	-177	0	0	0	0	108.3	N6 T7 G11 T12	N6-V9 PolarHBondContact O-N 3.11Å; T7-V9 VanDerWaalsContact C-N 3.35Å; V9-G11 PolarHBondContact O-N 3.02Å; V9-T12 WeakPolarHBondContact O-CB 3.39Å; V9-T12 PolarHBondContact O-N 2.89Å; V9-T12 PolarHBondContact O-OG1 2.65Å
10	S	81.6	Confident	76.3	Confident	119 Å²	119	116.4 Å²	116.4	83%	0.832	63%	0.63	S	S	*	*	T	Hydrogen-bonded Turn	trans	-53.7	137.8	173.1	-57.4	0	0	0	0	110.2
11	G	84	Confident	77.1	Confident	37 Å²	37	114.2 Å²	114.2	38%	0.381	62%	0.616	S	S	.	*	T	Hydrogen-bonded Turn	trans	91.6	-7.8	-176.5	0	0	0	0	0	115.3	V9 G13	V9-G11 PolarHBondContact O-N 3.02Å; G11-G13 PolarHBondContact O-N 3.06Å
12	T	87.7	Confident	79.6	Confident	62 Å²	62	109.4 Å²	109.4	38%	0.38	58%	0.584	S	S	.	*			trans	-66.8	116.6	174.7	-55.4	0	0	0	0	110.8	N6 V9	N6-T12 HydrophobicContact CB-CG2 3.65Å; N6-T12 PolarHBondContact O-OG1 2.98Å; N6-T12 VanDerWaalsContact O-OG1 3.08Å; V9-T12 WeakPolarHBondContact O-CB 3.39Å; V9-T12 PolarHBondContact O-N 2.89Å; V9-T12 PolarHBondContact O-OG1 2.65Å
13	G	85.7	Confident	81.8	Confident	50 Å²	50	104.1 Å²	104.1	52%	0.515	56%	0.557	S	S	.	*			trans	-73.7	164.1	175	0	0	0	0	0	114.1	G11 T17	G11-G13 PolarHBondContact O-N 3.06Å; G13-T17 WeakPolarHBondContact CA-OG1 3.34Å
14	H	88.6	Confident	83.7	Confident	85 Å²	85	95 Å²	95	39%	0.394	52%	0.518	S	S	.	.			trans	-129.7	168.8	168.6	59.6	94.5	0	0	0	108.9	D16 T17	H14-D16 PolarHBondContact ND1-N 3.34Å; H14-D16 IonicContact ND1-OD2 3.26Å; H14-D16 PolarHBondContact ND1-OD2 3.34Å; H14-D16 PolarHBondContact O-N 3.47Å; H14-D16 VanDerWaalsContact O-N 3.11Å; H14-T17 PolarHBondContact CD2-OG1 3.21Å; H14-T17 PolarHBondContact CE1-N 2.97Å; H14-T17 PolarHBondContact N-OG1 3.06Å; H14-T17 PolarHBondContact ND1-N 3.25Å; H14-T17 PolarHBondContact NE2-OG1 3.44Å; H14-T17 VanDerWaalsContact O-CB 3.31Å; H14-T17 WeakPolarHBondContact O-CB 3.5Å; H14-T17 PolarHBondContact O-N 3Å; H14-T17 PolarHBondContact O-OG1 2.97Å; H14-T17 VanDerWaalsContact O-OG1 3.08Å
15	P	88.7	Confident	85.3	Confident	129 Å²	129	92 Å²	92	84%	0.838	50%	0.501	S	S	*	.	T	Hydrogen-bonded Turn	trans	-55.3	-30.7	-177.7	-28.9	37.6	0	0	0	114.4
16	D	89	Confident	87	Confident	129 Å²	129	86.8 Å²	86.8	69%	0.69	48%	0.48	S	S	*	.	T	Hydrogen-bonded Turn	trans	-93.6	11.6	179.6	-32.3	-69	0	0	0	113.6	H14 T18	H14-D16 PolarHBondContact ND1-N 3.34Å; H14-D16 IonicContact ND1-OD2 3.26Å; H14-D16 PolarHBondContact ND1-OD2 3.34Å; H14-D16 PolarHBondContact O-N 3.47Å; H14-D16 VanDerWaalsContact O-N 3.11Å; D16-T18 PolarHBondContact O-N 3.29Å
17	T	89.3	Confident	88.6	Confident	38 Å²	38	84.9 Å²	84.9	23%	0.233	47%	0.467	C	S	.	.			trans	-63.5	122	176.7	-67	0	0	0	0	110	G13 H14 E21 W22	G13-T17 WeakPolarHBondContact CA-OG1 3.34Å; H14-T17 PolarHBondContact CD2-OG1 3.21Å; H14-T17 PolarHBondContact CE1-N 2.97Å; H14-T17 PolarHBondContact N-OG1 3.06Å; H14-T17 PolarHBondContact ND1-N 3.25Å; H14-T17 PolarHBondContact NE2-OG1 3.44Å; H14-T17 VanDerWaalsContact O-CB 3.31Å; H14-T17 WeakPolarHBondContact O-CB 3.5Å; H14-T17 PolarHBondContact O-N 3Å; H14-T17 PolarHBondContact O-OG1 2.97Å; H14-T17 VanDerWaalsContact O-OG1 3.08Å; T17-E21 HydrophobicContact CG2-CB 3.84Å; T17-W22 HydrophobicContact CG2-CB 4.25Å
18	T	92	Very high	90.1	Very high	66 Å²	66	84 Å²	84	41%	0.405	45%	0.452	S	S	.	.			trans	-70.9	157.2	179.7	64.5	0	0	0	0	111.3	D16 W20 E21 W22	D16-T18 PolarHBondContact O-N 3.29Å; T18-W20 PolarHBondContact O-N 3.47Å; T18-E21 PolarHBondContact N-OE2 3.4Å; T18-E21 PolarHBondContact O-N 3.49Å; T18-E21 WeakPolarHBondContact OG1-CB 3.31Å; T18-E21 WeakPolarHBondContact OG1-CG 3.49Å; T18-E21 PolarHBondContact OG1-N 2.99Å; T18-E21 PolarHBondContact OG1-OE2 2.99Å; T18-W22 PolarHBondContact O-N 2.93Å
19	C	92.4	Very high	91.3	Very high	92 Å²	92	76.7 Å²	76.7	62%	0.622	43%	0.431	S	S	*	.	H	α-helix	trans	-56.2	-39.3	173.7	-176.2	0	0	0	0	111.7	W22 L23	C19-W22 PolarHBondContact O-N 3.32Å; C19-L23 WeakPolarHBondContact O-CB 3.29Å; C19-L23 WeakPolarHBondContact O-CG 3.25Å; C19-L23 PolarHBondContact O-N 3.17Å
20	W	94.6	Very high	92.2	Very high	62 Å²	62	74.6 Å²	74.6	24%	0.235	42%	0.418	C	S	.	.	H	α-helix	trans	-64.1	-43	178	179.1	91.8	0	0	0	112.4	T18 T24 G68 P69 P70 P71	T18-W20 PolarHBondContact O-N 3.47Å; W20-T24 WeakPolarHBondContact O-CB 3.5Å; W20-T24 PolarHBondContact O-N 3.25Å; W20-T24 PolarHBondContact O-OG1 3.43Å; W20-G68 PolarHBondContact NE1-O 3.03Å; W20-P69 PolarHBondContact NE1-O 3.44Å; W20-P70 HydrophobicContact CD2-CB 3.86Å; W20-P70 VanDerWaalsContact CE2-CA 3.48Å; W20-P70 HydrophobicContact CE3-CB 3.91Å; W20-P70 HydrophobicContact CH2-CB 3.97Å; W20-P70 HydrophobicContact CH2-CG 4.35Å; W20-P70 HydrophobicContact CZ2-CB 3.89Å; W20-P70 HydrophobicContact CZ2-CG 4.31Å; W20-P70 HydrophobicContact CZ3-CB 3.98Å; W20-P71 HydrophobicContact CB-CG 4.19Å
21	E	93.5	Very high	93	Very high	71 Å²	71	70.7 Å²	70.7	33%	0.332	39%	0.385	S	S	.	.	H	α-helix	trans	-64.2	-45.9	177	-74.6	166.4	140.7	0	0	111.4	T17 T18 T24 N25	T17-E21 HydrophobicContact CG2-CB 3.84Å; T18-E21 PolarHBondContact N-OE2 3.4Å; T18-E21 PolarHBondContact O-N 3.49Å; T18-E21 WeakPolarHBondContact OG1-CB 3.31Å; T18-E21 WeakPolarHBondContact OG1-CG 3.49Å; T18-E21 PolarHBondContact OG1-N 2.99Å; T18-E21 PolarHBondContact OG1-OE2 2.99Å; E21-T24 PolarHBondContact O-N 3.31Å; E21-N25 VanDerWaalsContact O-CG 3.3Å; E21-N25 PolarHBondContact O-N 2.86Å; E21-N25 PolarHBondContact O-ND2 3Å
22	W	93.7	Very high	93.6	Very high	144 Å²	144	71.1 Å²	71.1	55%	0.545	39%	0.386	S	S	.	.	H	α-helix	trans	-60.6	-50.6	177.8	179	73.3	0	0	0	111.5	T17 T18 C19 T24 N25 Q26	T17-W22 HydrophobicContact CG2-CB 4.25Å; T18-W22 PolarHBondContact O-N 2.93Å; C19-W22 PolarHBondContact O-N 3.32Å; W22-T24 PolarHBondContact O-N 3Å; W22-N25 PolarHBondContact O-N 3.21Å; W22-Q26 HydrophobicContact CD2-CG 4.19Å; W22-Q26 HydrophobicContact CH2-CG 4.47Å; W22-Q26 HydrophobicContact CZ2-CG 3.95Å; W22-Q26 WeakPolarHBondContact O-CG 3.49Å; W22-Q26 PolarHBondContact O-N 3.28Å
23	L	96.5	Very high	94.1	Very high	63 Å²	63	70.8 Å²	70.8	33%	0.33	39%	0.386	S	S	.	.	H	α-helix	trans	-60.4	-44.1	177.6	-75.1	173.2	0	0	0	111.6	C19 N25 Q26 H27	C19-L23 WeakPolarHBondContact O-CB 3.29Å; C19-L23 WeakPolarHBondContact O-CG 3.25Å; C19-L23 PolarHBondContact O-N 3.17Å; L23-N25 VanDerWaalsContact C-N 3.3Å; L23-N25 PolarHBondContact O-N 3.35Å; L23-Q26 PolarHBondContact O-N 3Å; L23-H27 PolarHBondContact O-N 3.29Å; L23-H27 PolarHBondContact O-ND1 3.45Å
24	T	96.2	Very high	94.7	Very high	3 Å²	3	70.8 Å²	70.8	2%	0.018	37%	0.372	C	S	.	.	H	α-helix	trans	-59.7	-42.3	178.9	-66.7	0	0	0	0	111.5	W20 E21 W22 R28 P66	W20-T24 WeakPolarHBondContact O-CB 3.5Å; W20-T24 PolarHBondContact O-N 3.25Å; W20-T24 PolarHBondContact O-OG1 3.43Å; E21-T24 PolarHBondContact O-N 3.31Å; W22-T24 PolarHBondContact O-N 3Å; T24-R28 WeakPolarHBondContact O-CG 3.44Å; T24-R28 PolarHBondContact O-N 3Å; T24-R28 VanDerWaalsContact O-N 3.1Å; T24-P66 HydrophobicContact CG2-CG 3.92Å
25	N	95.5	Very high	95.1	Very high	40 Å²	40	67.7 Å²	67.7	21%	0.214	36%	0.358	C	S	.	.	H	α-helix	trans	-64.9	-46.1	175.5	-69.8	-28.8	0	0	0	111.5	E21 W22 L23 H27 R28 D29	E21-N25 VanDerWaalsContact O-CG 3.3Å; E21-N25 PolarHBondContact O-N 2.86Å; E21-N25 PolarHBondContact O-ND2 3Å; W22-N25 PolarHBondContact O-N 3.21Å; L23-N25 VanDerWaalsContact C-N 3.3Å; L23-N25 PolarHBondContact O-N 3.35Å; N25-H27 VanDerWaalsContact C-N 3.32Å; N25-H27 PolarHBondContact O-N 2.91Å; N25-R28 PolarHBondContact O-N 3.48Å; N25-R28 VanDerWaalsContact O-N 3.14Å; N25-D29 PolarHBondContact O-N 3.19Å
26	Q	96.8	Very high	95.6	Very high	83 Å²	83	64.2 Å²	64.2	39%	0.388	35%	0.346	S	S	.	.	H	α-helix	trans	-57.8	-41.9	177	-70.7	-59.8	-64.7	0	0	112.9	W22 L23 D29 T30	W22-Q26 HydrophobicContact CD2-CG 4.19Å; W22-Q26 HydrophobicContact CH2-CG 4.47Å; W22-Q26 HydrophobicContact CZ2-CG 3.95Å; W22-Q26 WeakPolarHBondContact O-CG 3.49Å; W22-Q26 PolarHBondContact O-N 3.28Å; L23-Q26 PolarHBondContact O-N 3Å; Q26-D29 PolarHBondContact O-N 3.27Å; Q26-T30 WeakPolarHBondContact O-CB 3.29Å; Q26-T30 PolarHBondContact O-N 2.86Å; Q26-T30 PolarHBondContact O-OG1 3.39Å
27	H	97.7	Very high	96	Very high	69 Å²	69	62.9 Å²	62.9	32%	0.319	34%	0.335	S	S	.	.	H	α-helix	trans	-67.3	-39.1	177.7	-74	73.6	0	0	0	111.9	L23 N25 T30 Y31 P66 C67	L23-H27 PolarHBondContact O-N 3.29Å; L23-H27 PolarHBondContact O-ND1 3.45Å; N25-H27 VanDerWaalsContact C-N 3.32Å; N25-H27 PolarHBondContact O-N 2.91Å; H27-T30 WeakPolarHBondContact O-CB 3.48Å; H27-T30 PolarHBondContact O-N 3.42Å; H27-Y31 VanDerWaalsContact O-CD2 3.27Å; H27-Y31 WeakPolarHBondContact O-CD2 3.3Å; H27-Y31 PolarHBondContact O-N 3.48Å; H27-P66 HydrophobicContact CB-CB 3.47Å; H27-P66 VanDerWaalsContact CB-CB 3.47Å; H27-P66 HydrophobicContact CB-CG 3.72Å; H27-C67 PolarHBondContact ND1-SG 3.28Å; H27-C67 VanDerWaalsContact ND1-SG 3.45Å
28	R	97.6	Very high	96.4	Very high	86 Å²	86	64.9 Å²	64.9	33%	0.325	35%	0.348	S	S	.	.	H	α-helix	trans	-64.6	-42.5	175.8	-74.2	172.1	176.2	163.4	2.5	111.5	T24 N25 T30 Y31 A32 M63 I64 P66	T24-R28 WeakPolarHBondContact O-CG 3.44Å; T24-R28 PolarHBondContact O-N 3Å; T24-R28 VanDerWaalsContact O-N 3.1Å; N25-R28 PolarHBondContact O-N 3.48Å; N25-R28 VanDerWaalsContact O-N 3.14Å; R28-T30 VanDerWaalsContact C-N 3.31Å; R28-T30 PolarHBondContact O-N 3.32Å; R28-Y31 PolarHBondContact O-N 2.88Å; R28-A32 WeakPolarHBondContact O-CB 3.46Å; R28-A32 PolarHBondContact O-N 3.24Å; R28-M63 HydrophobicContact CB-CE 4.2Å; R28-M63 HydrophobicContact CG-CB 4.41Å; R28-M63 HydrophobicContact CG-CE 4.48Å; R28-M63 PolarHBondContact NE-O 3.44Å; R28-I64 PolarHBondContact NH2-O 2.95Å; R28-P66 HydrophobicContact CG-CG 4.35Å
29	D	97.3	Very high	96.7	Very high	80 Å²	80	67.1 Å²	67.1	43%	0.428	36%	0.358	S	S	.	.	H	α-helix	trans	-63.2	-38.9	175.8	-67.7	-16.7	0	0	0	111.6	N25 Q26 A32 S33	N25-D29 PolarHBondContact O-N 3.19Å; Q26-D29 PolarHBondContact O-N 3.27Å; D29-A32 PolarHBondContact O-N 3.25Å; D29-S33 WeakPolarHBondContact O-CB 3.36Å; D29-S33 PolarHBondContact O-N 3.24Å; D29-S33 PolarHBondContact O-OG 3.41Å
30	T	98	Very high	96.9	Very high	59 Å²	59	64.8 Å²	64.8	36%	0.362	34%	0.341	S	S	.	.	H	α-helix	trans	-63	-50	175.3	-58.8	0	0	0	0	111.3	Q26 H27 R28 A32 S33 F34	Q26-T30 WeakPolarHBondContact O-CB 3.29Å; Q26-T30 PolarHBondContact O-N 2.86Å; Q26-T30 PolarHBondContact O-OG1 3.39Å; H27-T30 WeakPolarHBondContact O-CB 3.48Å; H27-T30 PolarHBondContact O-N 3.42Å; R28-T30 VanDerWaalsContact C-N 3.31Å; R28-T30 PolarHBondContact O-N 3.32Å; T30-A32 PolarHBondContact O-N 2.95Å; T30-S33 WeakPolarHBondContact O-CB 3.37Å; T30-S33 PolarHBondContact O-N 3.27Å; T30-F34 HydrophobicContact CG2-CD1 4.43Å; T30-F34 HydrophobicContact CG2-CD2 4.35Å; T30-F34 HydrophobicContact CG2-CE1 3.78Å; T30-F34 HydrophobicContact CG2-CE2 3.68Å; T30-F34 HydrophobicContact CG2-CZ 3.35Å; T30-F34 WeakPolarHBondContact O-CD1 3.31Å; T30-F34 WeakPolarHBondContact O-CG 3.39Å; T30-F34 PolarHBondContact O-N 2.81Å
31	Y	98	Very high	97.1	Very high	36 Å²	36	62.3 Å²	62.3	14%	0.141	33%	0.332	C	S	.	.	H	α-helix	trans	-64.7	-39.2	177.5	-65.8	-38.8	0	0	0	112.7	H27 R28 S33 F34 I35 F59 R62 M63 P66	H27-Y31 VanDerWaalsContact O-CD2 3.27Å; H27-Y31 WeakPolarHBondContact O-CD2 3.3Å; H27-Y31 PolarHBondContact O-N 3.48Å; R28-Y31 PolarHBondContact O-N 2.88Å; Y31-S33 VanDerWaalsContact C-N 3.28Å; Y31-S33 PolarHBondContact O-N 3.24Å; Y31-F34 HydrophobicContact CD1-CD2 4.13Å; Y31-F34 HydrophobicContact CD1-CE2 4.43Å; Y31-F34 PolarHBondContact O-N 2.8Å; Y31-I35 VanDerWaalsContact O-CG1 3.29Å; Y31-I35 WeakPolarHBondContact O-CG1 3.22Å; Y31-I35 PolarHBondContact O-N 3.03Å; Y31-F59 AromaticContact CD1-CD1 3.76Å; Y31-F59 HydrophobicContact CD1-CD1 3.76Å; Y31-F59 HydrophobicContact CD1-CE1 4.39Å; Y31-F59 HydrophobicContact CD1-CG 4.41Å; Y31-F59 HydrophobicContact CE1-CD1 4.11Å; Y31-R62 HydrophobicContact CD2-CB 4.09Å; Y31-R62 HydrophobicContact CE1-CB 4.47Å; Y31-R62 HydrophobicContact CE2-CB 3.52Å; Y31-M63 HydrophobicContact CD2-CG 3.91Å; Y31-M63 HydrophobicContact CG-CG 4.33Å; Y31-P66 HydrophobicContact CE2-CB 4.03Å
32	A	97.7	Very high	97.3	Very high	47 Å²	47	60.7 Å²	60.7	39%	0.388	33%	0.329	S	S	.	.	H	α-helix	trans	-60.1	-41.6	173.4	0	0	0	0	0	111.1	R28 D29 T30 I35 G36 M63	R28-A32 WeakPolarHBondContact O-CB 3.46Å; R28-A32 PolarHBondContact O-N 3.24Å; D29-A32 PolarHBondContact O-N 3.25Å; T30-A32 PolarHBondContact O-N 2.95Å; A32-I35 PolarHBondContact O-N 3Å; A32-G36 PolarHBondContact O-N 3.1Å; A32-M63 HydrophobicContact CB-CE 4.45Å
33	S	97.9	Very high	97.5	Very high	55 Å²	55	60.3 Å²	60.3	39%	0.385	33%	0.331	S	S	.	.	H	α-helix	trans	-64	-44.2	175.7	-61.4	0	0	0	0	111.9	D29 T30 Y31 I35 G36 H37	D29-S33 WeakPolarHBondContact O-CB 3.36Å; D29-S33 PolarHBondContact O-N 3.24Å; D29-S33 PolarHBondContact O-OG 3.41Å; T30-S33 WeakPolarHBondContact O-CB 3.37Å; T30-S33 PolarHBondContact O-N 3.27Å; Y31-S33 VanDerWaalsContact C-N 3.28Å; Y31-S33 PolarHBondContact O-N 3.24Å; S33-I35 VanDerWaalsContact C-N 3.3Å; S33-I35 PolarHBondContact O-N 2.94Å; S33-G36 PolarHBondContact O-N 3.46Å; S33-H37 WeakPolarHBondContact O-CB 3.29Å; S33-H37 PolarHBondContact O-N 3.35Å; S33-H37 PolarHBondContact O-ND1 2.91Å
34	F	97.8	Very high	97.6	Very high	49 Å²	49	59.3 Å²	59.3	22%	0.215	33%	0.326	C	S	.	.	H	α-helix	trans	-61.1	-38.9	176.2	-64.9	-12.8	0	0	0	112.4	T30 Y31 V40 L41 M44 F59	T30-F34 HydrophobicContact CG2-CD1 4.43Å; T30-F34 HydrophobicContact CG2-CD2 4.35Å; T30-F34 HydrophobicContact CG2-CE1 3.78Å; T30-F34 HydrophobicContact CG2-CE2 3.68Å; T30-F34 HydrophobicContact CG2-CZ 3.35Å; T30-F34 WeakPolarHBondContact O-CD1 3.31Å; T30-F34 WeakPolarHBondContact O-CG 3.39Å; T30-F34 PolarHBondContact O-N 2.81Å; Y31-F34 HydrophobicContact CD1-CD2 4.13Å; Y31-F34 HydrophobicContact CD1-CE2 4.43Å; Y31-F34 PolarHBondContact O-N 2.8Å; F34-V40 HydrophobicContact CB-CG1 4.47Å; F34-V40 HydrophobicContact CD1-CG1 3.62Å; F34-V40 HydrophobicContact CE1-CG1 4.19Å; F34-V40 HydrophobicContact CG-CG1 4.27Å; F34-L41 WeakPolarHBondContact O-CB 3.43Å; F34-M44 HydrophobicContact CD1-CE 4.49Å; F34-M44 HydrophobicContact CD2-CE 4.21Å; F34-M44 HydrophobicContact CE1-CE 4.06Å; F34-M44 HydrophobicContact CE2-CE 3.76Å; F34-M44 HydrophobicContact CZ-CE 3.67Å; F34-F59 HydrophobicContact CB-CD2 4.13Å; F34-F59 HydrophobicContact CB-CE2 3.95Å; F34-F59 HydrophobicContact CB-CZ 4.35Å; F34-F59 HydrophobicContact CD2-CD1 4.38Å; F34-F59 AromaticContact CD2-CE1 3.93Å; F34-F59 HydrophobicContact CD2-CE1 3.93Å; F34-F59 HydrophobicContact CD2-CE2 4.33Å; F34-F59 AromaticContact CD2-CZ 3.89Å; F34-F59 HydrophobicContact CD2-CZ 3.89Å
35	I	97.7	Very high	97.7	Very high	21 Å²	21	59.5 Å²	59.5	11%	0.108	33%	0.327	C	S	.	.	H	α-helix	trans	-72.5	-35.3	177.3	-66.8	165.2	0	0	0	111.5	Y31 A32 S33 R56 F59 L60	Y31-I35 VanDerWaalsContact O-CG1 3.29Å; Y31-I35 WeakPolarHBondContact O-CG1 3.22Å; Y31-I35 PolarHBondContact O-N 3.03Å; A32-I35 PolarHBondContact O-N 3Å; S33-I35 VanDerWaalsContact C-N 3.3Å; S33-I35 PolarHBondContact O-N 2.94Å; I35-R56 HydrophobicContact CG1-CG 4.45Å; I35-R56 HydrophobicContact CG2-CG 4.1Å; I35-F59 HydrophobicContact CD1-CB 3.71Å; I35-F59 HydrophobicContact CG1-CB 3.81Å; I35-F59 HydrophobicContact CG1-CD2 4.14Å; I35-F59 HydrophobicContact CG1-CG 4.44Å; I35-L60 HydrophobicContact CD1-CD2 3.78Å; I35-L60 HydrophobicContact CD1-CG 3.85Å
36	G	97.5	Very high	97.8	Very high	56 Å²	56	63.2 Å²	63.2	58%	0.577	35%	0.351	S	S	*	.	H	α-helix	trans	-78	-26.8	-175.9	0	0	0	0	0	114.8	A32 S33 P38	A32-G36 PolarHBondContact O-N 3.1Å; S33-G36 PolarHBondContact O-N 3.46Å; G36-P38 WeakPolarHBondContact O-CD 3.4Å
37	H	98.1	Very high	97.9	Very high	101 Å²	101	63.6 Å²	63.6	47%	0.468	36%	0.359	S	S	.	.			trans	-100.7	104.9	-179.7	-65.4	89.2	0	0	0	110.2	S33 D39 V40 L41	S33-H37 WeakPolarHBondContact O-CB 3.29Å; S33-H37 PolarHBondContact O-N 3.35Å; S33-H37 PolarHBondContact O-ND1 2.91Å; H37-D39 VanDerWaalsContact C-N 3.28Å; H37-D39 WeakPolarHBondContact CB-OD1 3.39Å; H37-D39 PolarHBondContact O-N 2.97Å; H37-V40 HydrophobicContact CB-CB 4.02Å; H37-V40 HydrophobicContact CB-CG2 3.82Å; H37-V40 PolarHBondContact O-N 3.44Å; H37-L41 PolarHBondContact O-N 3.14Å
38	P	97.1	Very high	97.9	Very high	79 Å²	79	65.6 Å²	65.6	51%	0.513	37%	0.368	S	S	.	.	H	α-helix	trans	-63.8	-30.5	-170.7	-24.2	35.4	0	0	0	114.6	G36 S42	G36-P38 WeakPolarHBondContact O-CD 3.4Å; P38-S42 VanDerWaalsContact O-CB 3.31Å; P38-S42 WeakPolarHBondContact O-CB 3.5Å; P38-S42 PolarHBondContact O-N 3.18Å; P38-S42 PolarHBondContact O-OG 3.29Å
39	D	98	Very high	97.9	Very high	113 Å²	113	68.6 Å²	68.6	60%	0.604	39%	0.391	S	S	*	.	H	α-helix	trans	-65	-49.2	173.7	57.9	-37.2	0	0	0	111.1	H37 S42 F43	H37-D39 VanDerWaalsContact C-N 3.28Å; H37-D39 WeakPolarHBondContact CB-OD1 3.39Å; H37-D39 PolarHBondContact O-N 2.97Å; D39-S42 PolarHBondContact O-N 2.89Å; D39-F43 WeakPolarHBondContact O-CB 3.35Å; D39-F43 PolarHBondContact O-N 3.37Å
40	V	97.9	Very high	97.9	Very high	43 Å²	43	68.1 Å²	68.1	26%	0.261	39%	0.386	S	S	.	.	H	α-helix	trans	-64	-44.2	176.5	-178	0	0	0	0	111	F34 H37 S42 F43 M44	F34-V40 HydrophobicContact CB-CG1 4.47Å; F34-V40 HydrophobicContact CD1-CG1 3.62Å; F34-V40 HydrophobicContact CE1-CG1 4.19Å; F34-V40 HydrophobicContact CG-CG1 4.27Å; H37-V40 HydrophobicContact CB-CB 4.02Å; H37-V40 HydrophobicContact CB-CG2 3.82Å; H37-V40 PolarHBondContact O-N 3.44Å; V40-S42 VanDerWaalsContact C-N 3.26Å; V40-S42 PolarHBondContact O-N 3Å; V40-F43 PolarHBondContact O-N 3.2Å; V40-M44 HydrophobicContact CG1-CG 4.44Å; V40-M44 VanDerWaalsContact O-CG 3.3Å; V40-M44 WeakPolarHBondContact O-CG 3.49Å; V40-M44 PolarHBondContact O-N 3.08Å
41	L	98.2	Very high	97.9	Very high	10 Å²	10	69.5 Å²	69.5	5%	0.052	40%	0.395	C	S	.	.	H	α-helix	trans	-59	-40	175.5	-176.2	58.4	0	0	0	111.8	F34 H37 A45 M55 F59	F34-L41 WeakPolarHBondContact O-CB 3.43Å; H37-L41 PolarHBondContact O-N 3.14Å; L41-A45 VanDerWaalsContact O-CB 3.29Å; L41-A45 WeakPolarHBondContact O-CB 3.33Å; L41-A45 PolarHBondContact O-N 2.96Å; L41-M55 HydrophobicContact CD1-CB 3.88Å; L41-F59 HydrophobicContact CD1-CD2 4.06Å; L41-F59 HydrophobicContact CD1-CE2 3.88Å
42	S	98.1	Very high	97.9	Very high	38 Å²	38	74.2 Å²	74.2	27%	0.266	41%	0.412	S	S	.	.	H	α-helix	trans	-71.3	-40.1	179.4	-57.6	0	0	0	0	111.5	P38 D39 V40 A45 V46 R52	P38-S42 VanDerWaalsContact O-CB 3.31Å; P38-S42 WeakPolarHBondContact O-CB 3.5Å; P38-S42 PolarHBondContact O-N 3.18Å; P38-S42 PolarHBondContact O-OG 3.29Å; D39-S42 PolarHBondContact O-N 2.89Å; V40-S42 VanDerWaalsContact C-N 3.26Å; V40-S42 PolarHBondContact O-N 3Å; S42-A45 PolarHBondContact O-N 2.77Å; S42-V46 WeakPolarHBondContact O-CG2 3.43Å; S42-V46 PolarHBondContact O-N 3.37Å; S42-R52 PolarHBondContact OG-NE 3.39Å
43	F	98.4	Very high	97.9	Very high	135 Å²	135	75.6 Å²	75.6	59%	0.592	42%	0.424	S	S	*	.	H	α-helix	trans	-57.7	-50.1	173.1	175.6	-100.2	0	0	0	111.2	D39 V40 A45 V46 V47	D39-F43 WeakPolarHBondContact O-CB 3.35Å; D39-F43 PolarHBondContact O-N 3.37Å; V40-F43 PolarHBondContact O-N 3.2Å; F43-A45 VanDerWaalsContact C-N 3.33Å; F43-A45 PolarHBondContact O-N 3.21Å; F43-V46 PolarHBondContact O-N 3.01Å; F43-V47 HydrophobicContact CD1-CG2 4.42Å; F43-V47 HydrophobicContact CD2-CG2 4.48Å; F43-V47 HydrophobicContact CE1-CG2 4.03Å; F43-V47 HydrophobicContact CE2-CG2 4.11Å; F43-V47 HydrophobicContact CZ-CG2 3.87Å; F43-V47 WeakPolarHBondContact O-CG2 3.39Å; F43-V47 PolarHBondContact O-N 3.4Å
44	M	98	Very high	97.9	Very high	43 Å²	43	78.6 Å²	78.6	21%	0.212	43%	0.426	C	S	.	.	H	α-helix	trans	-62.1	-39.3	177.9	-66.7	-67.2	-169.2	0	0	112.4	F34 V40 V47 E48 M55 F59	F34-M44 HydrophobicContact CD1-CE 4.49Å; F34-M44 HydrophobicContact CD2-CE 4.21Å; F34-M44 HydrophobicContact CE1-CE 4.06Å; F34-M44 HydrophobicContact CE2-CE 3.76Å; F34-M44 HydrophobicContact CZ-CE 3.67Å; V40-M44 HydrophobicContact CG1-CG 4.44Å; V40-M44 VanDerWaalsContact O-CG 3.3Å; V40-M44 WeakPolarHBondContact O-CG 3.49Å; V40-M44 PolarHBondContact O-N 3.08Å; M44-V47 PolarHBondContact O-N 3.29Å; M44-E48 WeakPolarHBondContact O-CB 3.49Å; M44-E48 WeakPolarHBondContact O-CG 3.3Å; M44-E48 PolarHBondContact O-N 3.49Å; M44-M55 HydrophobicContact CB-CE 4.06Å; M44-F59 HydrophobicContact CB-CE2 4.25Å; M44-F59 HydrophobicContact CB-CZ 3.97Å; M44-F59 HydrophobicContact CG-CE2 4.45Å; M44-F59 HydrophobicContact CG-CZ 4.01Å
45	A	98.2	Very high	97.9	Very high	6 Å²	6	76.5 Å²	76.5	5%	0.05	42%	0.417	C	S	.	.	H	α-helix	trans	-63.4	-39.6	176.2	0	0	0	0	0	113	L41 S42 F43 N49 E50 R52 M55	L41-A45 VanDerWaalsContact O-CB 3.29Å; L41-A45 WeakPolarHBondContact O-CB 3.33Å; L41-A45 PolarHBondContact O-N 2.96Å; S42-A45 PolarHBondContact O-N 2.77Å; F43-A45 VanDerWaalsContact C-N 3.33Å; F43-A45 PolarHBondContact O-N 3.21Å; A45-N49 PolarHBondContact O-N 3.2Å; A45-E50 CarbonylContact C-O 3.59Å; A45-E50 WeakPolarHBondContact CB-O 3.39Å; A45-E50 PolarHBondContact O-N 3Å; A45-E50 VanDerWaalsContact O-O 3.08Å; A45-R52 HydrophobicContact CB-CG 3.95Å; A45-M55 HydrophobicContact CB-CB 4.48Å; A45-M55 HydrophobicContact CB-CG 3.84Å
46	V	98.1	Very high	97.9	Very high	119 Å²	119	81.4 Å²	81.4	72%	0.721	43%	0.434	S	S	*	.	H	α-helix	trans	-67.5	-45.5	175.3	171.8	0	0	0	0	111	S42 F43 N49	S42-V46 WeakPolarHBondContact O-CG2 3.43Å; S42-V46 PolarHBondContact O-N 3.37Å; F43-V46 PolarHBondContact O-N 3.01Å; V46-N49 PolarHBondContact O-N 3.22Å
47	V	98	Very high	97.9	Very high	91 Å²	91	83.9 Å²	83.9	55%	0.552	43%	0.43	S	S	*	.	H	α-helix	trans	-63.2	-43.7	-178.3	170.8	0	0	0	0	111.9	F43 M44 N49	F43-V47 HydrophobicContact CD1-CG2 4.42Å; F43-V47 HydrophobicContact CD2-CG2 4.48Å; F43-V47 HydrophobicContact CE1-CG2 4.03Å; F43-V47 HydrophobicContact CE2-CG2 4.11Å; F43-V47 HydrophobicContact CZ-CG2 3.87Å; F43-V47 WeakPolarHBondContact O-CG2 3.39Å; F43-V47 PolarHBondContact O-N 3.4Å; M44-V47 PolarHBondContact O-N 3.29Å; V47-N49 VanDerWaalsContact C-N 3.27Å; V47-N49 PolarHBondContact O-N 3.27Å
48	E	97.2	Very high	97.9	Very high	110 Å²	110	80.7 Å²	80.7	51%	0.514	42%	0.416	S	S	.	.	T	Hydrogen-bonded Turn	trans	-83.9	-0.9	-179.1	-66.1	-71.3	173.3	0	0	113.3	M44 E50 M55	M44-E48 WeakPolarHBondContact O-CB 3.49Å; M44-E48 WeakPolarHBondContact O-CG 3.3Å; M44-E48 PolarHBondContact O-N 3.49Å; E48-E50 VanDerWaalsContact C-N 3.25Å; E48-E50 HydrophobicContact CB-CB 4.48Å; E48-E50 PolarHBondContact O-N 3.38Å; E48-M55 HydrophobicContact CB-CE 4.16Å; E48-M55 HydrophobicContact CB-SD 3.83Å; E48-M55 HydrophobicContact CG-CE 3.77Å; E48-M55 HydrophobicContact CG-SD 4.11Å
49	N	97.9	Very high	97.9	Very high	149 Å²	149	77.2 Å²	77.2	80%	0.797	39%	0.392	S	S	*	.	T	Hydrogen-bonded Turn	trans	51.9	43.9	-175.2	-171.2	46.5	0	0	0	112.9	A45 V46 V47	A45-N49 PolarHBondContact O-N 3.2Å; V46-N49 PolarHBondContact O-N 3.22Å; V47-N49 VanDerWaalsContact C-N 3.27Å; V47-N49 PolarHBondContact O-N 3.27Å
50	E	97.8	Very high	97.9	Very high	71 Å²	71	75.7 Å²	75.7	33%	0.332	38%	0.384	S	S	.	.			trans	-125.2	157	-177.7	-84.7	-77.1	-156	0	0	110.5	A45 E48 R54 M55	A45-E50 CarbonylContact C-O 3.59Å; A45-E50 WeakPolarHBondContact CB-O 3.39Å; A45-E50 PolarHBondContact O-N 3Å; A45-E50 VanDerWaalsContact O-O 3.08Å; E48-E50 VanDerWaalsContact C-N 3.25Å; E48-E50 HydrophobicContact CB-CB 4.48Å; E48-E50 PolarHBondContact O-N 3.38Å; E50-R54 HydrophobicContact CB-CB 4.47Å; E50-R54 HydrophobicContact CB-CG 4.5Å; E50-R54 HydrophobicContact CG-CG 4.37Å; E50-R54 WeakPolarHBondContact OE1-CD 3.36Å; E50-R54 IonicContact OE1-NE 3.06Å; E50-R54 PolarHBondContact OE1-NE 2.88Å; E50-R54 WeakPolarHBondContact OE2-CB 3.27Å; E50-R54 VanDerWaalsContact OE2-CD 3.29Å; E50-R54 WeakPolarHBondContact OE2-CD 3.36Å; E50-R54 VanDerWaalsContact OE2-CG 3.25Å; E50-R54 WeakPolarHBondContact OE2-CG 3.41Å; E50-R54 IonicContact OE2-NE 3.79Å; E50-M55 HydrophobicContact CB-CG 3.96Å; E50-M55 HydrophobicContact CB-SD 3.79Å; E50-M55 HydrophobicContact CG-SD 4.42Å
51	T	97.8	Very high	97.9	Very high	88 Å²	88	78.4 Å²	78.4	54%	0.54	39%	0.394	S	S	.	.			trans	-67.9	150.1	175.1	66.9	0	0	0	0	110.7	A53 R54 M55	T51-A53 PolarHBondContact O-N 3.33Å; T51-A53 VanDerWaalsContact O-N 3.16Å; T51-R54 WeakPolarHBondContact O-CA 3.32Å; T51-R54 WeakPolarHBondContact O-CB 3.35Å; T51-R54 PolarHBondContact O-N 3.21Å; T51-R54 VanDerWaalsContact OG1-CB 3.31Å; T51-R54 WeakPolarHBondContact OG1-CB 3.48Å; T51-R54 PolarHBondContact OG1-N 2.6Å; T51-R54 VanDerWaalsContact OG1-N 3.11Å; T51-M55 PolarHBondContact O-N 3.44Å
52	R	97.5	Very high	97.9	Very high	135 Å²	135	83.7 Å²	83.7	51%	0.509	41%	0.413	S	S	.	.	H	α-helix	trans	-53.5	-37.2	173.8	-69.2	173	64	-160.9	1.4	112.5	S42 A45 R56	S42-R52 PolarHBondContact OG-NE 3.39Å; A45-R52 HydrophobicContact CB-CG 3.95Å; R52-R56 WeakPolarHBondContact O-CB 3.02Å; R52-R56 PolarHBondContact O-N 2.97Å
53	A	97.9	Very high	97.8	Very high	76 Å²	76	84.4 Å²	84.4	63%	0.628	41%	0.412	S	S	*	.	H	α-helix	trans	-65.1	-43.7	176.4	0	0	0	0	0	111.7	T51 R56 F57	T51-A53 PolarHBondContact O-N 3.33Å; T51-A53 VanDerWaalsContact O-N 3.16Å; A53-R56 PolarHBondContact O-N 2.94Å; A53-F57 PolarHBondContact O-N 2.81Å
54	R	98.1	Very high	97.7	Very high	118 Å²	118	83.5 Å²	83.5	45%	0.445	41%	0.413	S	S	.	.	H	α-helix	trans	-65.5	-44.7	176	-175.1	123	173.9	96.8	-0.5	112	E50 T51 R56 F57 I58	E50-R54 HydrophobicContact CB-CB 4.47Å; E50-R54 HydrophobicContact CB-CG 4.5Å; E50-R54 HydrophobicContact CG-CG 4.37Å; E50-R54 WeakPolarHBondContact OE1-CD 3.36Å; E50-R54 IonicContact OE1-NE 3.06Å; E50-R54 PolarHBondContact OE1-NE 2.88Å; E50-R54 WeakPolarHBondContact OE2-CB 3.27Å; E50-R54 VanDerWaalsContact OE2-CD 3.29Å; E50-R54 WeakPolarHBondContact OE2-CD 3.36Å; E50-R54 VanDerWaalsContact OE2-CG 3.25Å; E50-R54 WeakPolarHBondContact OE2-CG 3.41Å; E50-R54 IonicContact OE2-NE 3.79Å; T51-R54 WeakPolarHBondContact O-CA 3.32Å; T51-R54 WeakPolarHBondContact O-CB 3.35Å; T51-R54 PolarHBondContact O-N 3.21Å; T51-R54 VanDerWaalsContact OG1-CB 3.31Å; T51-R54 WeakPolarHBondContact OG1-CB 3.48Å; T51-R54 PolarHBondContact OG1-N 2.6Å; T51-R54 VanDerWaalsContact OG1-N 3.11Å; R54-R56 VanDerWaalsContact C-N 3.32Å; R54-R56 PolarHBondContact O-N 3.35Å; R54-F57 WeakPolarHBondContact O-CA 3.4Å; R54-F57 WeakPolarHBondContact O-CB 3.2Å; R54-F57 PolarHBondContact O-N 3.18Å; R54-F57 VanDerWaalsContact O-N 3.09Å; R54-I58 HydrophobicContact CG-CD1 3.81Å; R54-I58 HydrophobicContact CG-CG1 4.34Å; R54-I58 WeakPolarHBondContact O-CG1 3.49Å; R54-I58 PolarHBondContact O-N 2.8Å
55	M	98.1	Very high	97.6	Very high	4 Å²	4	86.3 Å²	86.3	2%	0.02	43%	0.425	C	S	.	.	H	α-helix	trans	-59.9	-42.1	176.1	-73.2	-50.9	-69.2	0	0	112.5	L41 M44 A45 E48 E50 T51 F57 I58 F59	L41-M55 HydrophobicContact CD1-CB 3.88Å; M44-M55 HydrophobicContact CB-CE 4.06Å; A45-M55 HydrophobicContact CB-CB 4.48Å; A45-M55 HydrophobicContact CB-CG 3.84Å; E48-M55 HydrophobicContact CB-CE 4.16Å; E48-M55 HydrophobicContact CB-SD 3.83Å; E48-M55 HydrophobicContact CG-CE 3.77Å; E48-M55 HydrophobicContact CG-SD 4.11Å; E50-M55 HydrophobicContact CB-CG 3.96Å; E50-M55 HydrophobicContact CB-SD 3.79Å; E50-M55 HydrophobicContact CG-SD 4.42Å; T51-M55 PolarHBondContact O-N 3.44Å; M55-F57 VanDerWaalsContact C-N 3.32Å; M55-F57 PolarHBondContact O-N 3.45Å; M55-I58 PolarHBondContact O-N 3.41Å; M55-I58 HydrophobicContact SD-CD1 3.98Å; M55-F59 HydrophobicContact CB-CE2 4.31Å; M55-F59 HydrophobicContact CE-CE1 4.04Å; M55-F59 HydrophobicContact CE-CE2 3.96Å; M55-F59 HydrophobicContact CE-CZ 3.5Å; M55-F59 WeakPolarHBondContact O-CD2 3.44Å; M55-F59 WeakPolarHBondContact O-CG 3.47Å; M55-F59 PolarHBondContact O-N 3.08Å
56	R	97.8	Very high	97.5	Very high	125 Å²	125	87.4 Å²	87.4	47%	0.472	43%	0.432	S	S	.	.	H	α-helix	trans	-58.7	-44.7	173.3	-176.3	179.6	177.7	104.7	1.1	111.5	I35 R52 A53 R54 F59 L60	I35-R56 HydrophobicContact CG1-CG 4.45Å; I35-R56 HydrophobicContact CG2-CG 4.1Å; R52-R56 WeakPolarHBondContact O-CB 3.02Å; R52-R56 PolarHBondContact O-N 2.97Å; A53-R56 PolarHBondContact O-N 2.94Å; R54-R56 VanDerWaalsContact C-N 3.32Å; R54-R56 PolarHBondContact O-N 3.35Å; R56-F59 PolarHBondContact O-N 3.34Å; R56-L60 HydrophobicContact CG-CD1 4.25Å; R56-L60 VanDerWaalsContact O-CG 3.3Å; R56-L60 WeakPolarHBondContact O-CG 3.39Å; R56-L60 PolarHBondContact O-N 3.05Å
57	F	98	Very high	97.4	Very high	108 Å²	108	83.7 Å²	83.7	47%	0.474	41%	0.411	S	S	.	.	H	α-helix	trans	-61.4	-46	176	178	-96.2	0	0	0	111.9	A53 R54 M55 F59 L60 Q61	A53-F57 PolarHBondContact O-N 2.81Å; R54-F57 WeakPolarHBondContact O-CA 3.4Å; R54-F57 WeakPolarHBondContact O-CB 3.2Å; R54-F57 PolarHBondContact O-N 3.18Å; R54-F57 VanDerWaalsContact O-N 3.09Å; M55-F57 VanDerWaalsContact C-N 3.32Å; M55-F57 PolarHBondContact O-N 3.45Å; F57-F59 PolarHBondContact O-N 2.75Å; F57-L60 PolarHBondContact O-N 2.96Å; F57-Q61 HydrophobicContact CD1-CG 4.13Å; F57-Q61 HydrophobicContact CE1-CG 3.69Å; F57-Q61 HydrophobicContact CE2-CG 4.17Å; F57-Q61 HydrophobicContact CZ-CG 3.71Å; F57-Q61 WeakPolarHBondContact O-CG 3.2Å; F57-Q61 PolarHBondContact O-N 3.49Å
58	I	97.7	Very high	97.3	Very high	34 Å²	34	80.6 Å²	80.6	17%	0.174	40%	0.397	C	S	.	.	H	α-helix	trans	-58.5	-48.6	178.2	-69.9	164	0	0	0	110.8	R54 M55 L60 Q61 R62	R54-I58 HydrophobicContact CG-CD1 3.81Å; R54-I58 HydrophobicContact CG-CG1 4.34Å; R54-I58 WeakPolarHBondContact O-CG1 3.49Å; R54-I58 PolarHBondContact O-N 2.8Å; M55-I58 PolarHBondContact O-N 3.41Å; M55-I58 HydrophobicContact SD-CD1 3.98Å; I58-L60 PolarHBondContact O-N 3.32Å; I58-Q61 PolarHBondContact O-N 3.27Å; I58-R62 HydrophobicContact CG2-CG 4.47Å; I58-R62 WeakPolarHBondContact O-CG 3.45Å; I58-R62 PolarHBondContact O-N 3.34Å
59	F	97.9	Very high	97.2	Very high	5 Å²	5	79.9 Å²	79.9	2%	0.022	40%	0.402	C	S	.	.	H	α-helix	trans	-62.7	-41.8	179	-66.7	-40.4	0	0	0	112.2	Y31 F34 I35 L41 M44 M55 R56 F57 Q61 R62 M63	Y31-F59 AromaticContact CD1-CD1 3.76Å; Y31-F59 HydrophobicContact CD1-CD1 3.76Å; Y31-F59 HydrophobicContact CD1-CE1 4.39Å; Y31-F59 HydrophobicContact CD1-CG 4.41Å; Y31-F59 HydrophobicContact CE1-CD1 4.11Å; F34-F59 HydrophobicContact CB-CD2 4.13Å; F34-F59 HydrophobicContact CB-CE2 3.95Å; F34-F59 HydrophobicContact CB-CZ 4.35Å; F34-F59 HydrophobicContact CD2-CD1 4.38Å; F34-F59 AromaticContact CD2-CE1 3.93Å; F34-F59 HydrophobicContact CD2-CE1 3.93Å; F34-F59 HydrophobicContact CD2-CE2 4.33Å; F34-F59 AromaticContact CD2-CZ 3.89Å; F34-F59 HydrophobicContact CD2-CZ 3.89Å; I35-F59 HydrophobicContact CD1-CB 3.71Å; I35-F59 HydrophobicContact CG1-CB 3.81Å; I35-F59 HydrophobicContact CG1-CD2 4.14Å; I35-F59 HydrophobicContact CG1-CG 4.44Å; L41-F59 HydrophobicContact CD1-CD2 4.06Å; L41-F59 HydrophobicContact CD1-CE2 3.88Å; M44-F59 HydrophobicContact CB-CE2 4.25Å; M44-F59 HydrophobicContact CB-CZ 3.97Å; M44-F59 HydrophobicContact CG-CE2 4.45Å; M44-F59 HydrophobicContact CG-CZ 4.01Å; M55-F59 HydrophobicContact CB-CE2 4.31Å; M55-F59 HydrophobicContact CE-CE1 4.04Å; M55-F59 HydrophobicContact CE-CE2 3.96Å; M55-F59 HydrophobicContact CE-CZ 3.5Å; M55-F59 WeakPolarHBondContact O-CD2 3.44Å; M55-F59 WeakPolarHBondContact O-CG 3.47Å; M55-F59 PolarHBondContact O-N 3.08Å; R56-F59 PolarHBondContact O-N 3.34Å; F57-F59 PolarHBondContact O-N 2.75Å; F59-Q61 VanDerWaalsContact C-N 3.34Å; F59-Q61 PolarHBondContact O-N 3.48Å; F59-R62 PolarHBondContact O-N 3.09Å; F59-M63 WeakPolarHBondContact O-CG 3.42Å; F59-M63 PolarHBondContact O-N 2.85Å
60	L	97.9	Very high	96.9	Very high	81 Å²	81	76.3 Å²	76.3	42%	0.424	39%	0.387	S	S	.	.	H	α-helix	trans	-61.2	-40.8	174.9	-71.7	170.7	0	0	0	112.4	I35 R56 F57 I58 M63	I35-L60 HydrophobicContact CD1-CD2 3.78Å; I35-L60 HydrophobicContact CD1-CG 3.85Å; R56-L60 HydrophobicContact CG-CD1 4.25Å; R56-L60 VanDerWaalsContact O-CG 3.3Å; R56-L60 WeakPolarHBondContact O-CG 3.39Å; R56-L60 PolarHBondContact O-N 3.05Å; F57-L60 PolarHBondContact O-N 2.96Å; I58-L60 PolarHBondContact O-N 3.32Å; L60-M63 HydrophobicContact CD2-SD 4.2Å; L60-M63 WeakPolarHBondContact O-CB 3.37Å; L60-M63 PolarHBondContact O-N 3.36Å
61	Q	97.8	Very high	96.5	Very high	101 Å²	101	77 Å²	77	47%	0.472	40%	0.398	S	S	.	.	H	α-helix	trans	-65.7	-40	176.3	-69.2	-60.4	-58.1	0	0	111.9	F57 I58 F59 M63 I64	F57-Q61 HydrophobicContact CD1-CG 4.13Å; F57-Q61 HydrophobicContact CE1-CG 3.69Å; F57-Q61 HydrophobicContact CE2-CG 4.17Å; F57-Q61 HydrophobicContact CZ-CG 3.71Å; F57-Q61 WeakPolarHBondContact O-CG 3.2Å; F57-Q61 PolarHBondContact O-N 3.49Å; I58-Q61 PolarHBondContact O-N 3.27Å; F59-Q61 VanDerWaalsContact C-N 3.34Å; F59-Q61 PolarHBondContact O-N 3.48Å; Q61-M63 PolarHBondContact O-N 3.08Å; Q61-I64 WeakPolarHBondContact O-CG1 3.34Å; Q61-I64 PolarHBondContact O-N 2.91Å
62	R	97.3	Very high	95.9	Very high	121 Å²	121	80.6 Å²	80.6	46%	0.457	41%	0.408	S	S	.	.	H	α-helix	trans	-66.5	-17.6	178.1	-71	178.8	177.4	174.6	0.8	113.6	Y31 I58 F59 I64	Y31-R62 HydrophobicContact CD2-CB 4.09Å; Y31-R62 HydrophobicContact CE1-CB 4.47Å; Y31-R62 HydrophobicContact CE2-CB 3.52Å; I58-R62 HydrophobicContact CG2-CG 4.47Å; I58-R62 WeakPolarHBondContact O-CG 3.45Å; I58-R62 PolarHBondContact O-N 3.34Å; F59-R62 PolarHBondContact O-N 3.09Å; R62-I64 VanDerWaalsContact C-N 3.29Å; R62-I64 PolarHBondContact O-N 2.79Å
63	M	97.1	Very high	94.9	Very high	52 Å²	52	81.4 Å²	81.4	26%	0.256	41%	0.411	S	S	.	.	T	Hydrogen-bonded Turn	trans	-71.2	-19.6	177.2	-69.3	177.8	80.2	0	0	114.2	R28 Y31 A32 F59 L60 Q61	R28-M63 HydrophobicContact CB-CE 4.2Å; R28-M63 HydrophobicContact CG-CB 4.41Å; R28-M63 HydrophobicContact CG-CE 4.48Å; R28-M63 PolarHBondContact NE-O 3.44Å; Y31-M63 HydrophobicContact CD2-CG 3.91Å; Y31-M63 HydrophobicContact CG-CG 4.33Å; A32-M63 HydrophobicContact CB-CE 4.45Å; F59-M63 WeakPolarHBondContact O-CG 3.42Å; F59-M63 PolarHBondContact O-N 2.85Å; L60-M63 HydrophobicContact CD2-SD 4.2Å; L60-M63 WeakPolarHBondContact O-CB 3.37Å; L60-M63 PolarHBondContact O-N 3.36Å; Q61-M63 PolarHBondContact O-N 3.08Å
64	I	95.9	Very high	93.3	Very high	117 Å²	117	82.8 Å²	82.8	60%	0.6	41%	0.414	S	S	*	.	S	Bend	trans	-59.6	-53.9	-176.5	-63.7	172.6	0	0	0	109.9	R28 Q61 R62	R28-I64 PolarHBondContact NH2-O 2.95Å; Q61-I64 WeakPolarHBondContact O-CG1 3.34Å; Q61-I64 PolarHBondContact O-N 2.91Å; R62-I64 VanDerWaalsContact C-N 3.29Å; R62-I64 PolarHBondContact O-N 2.79Å
65	Q	95	Very high	91.6	Very high	101 Å²	101	84.2 Å²	84.2	47%	0.472	43%	0.43	S	S	.	.	S	Bend	trans	-148	71.8	-177.1	-167.5	175.6	74.6	0	0	110.7	C67 G68 P69	Q65-C67 VanDerWaalsContact C-N 3.26Å; Q65-C67 PolarHBondContact O-N 3.22Å; Q65-G68 WeakPolarHBondContact CG-O 3.31Å; Q65-G68 PolarHBondContact O-N 3.19Å; Q65-P69 VanDerWaalsContact CD-N 3.33Å
66	P	97	Very high	89.7	Confident	29 Å²	29	89.2 Å²	89.2	19%	0.188	45%	0.454	C	S	.	.	T	Hydrogen-bonded Turn	trans	-65.8	-28	-172.1	27.1	-36.8	0	0	0	113.7	T24 H27 R28 Y31	T24-P66 HydrophobicContact CG2-CG 3.92Å; H27-P66 HydrophobicContact CB-CB 3.47Å; H27-P66 VanDerWaalsContact CB-CB 3.47Å; H27-P66 HydrophobicContact CB-CG 3.72Å; R28-P66 HydrophobicContact CG-CG 4.35Å; Y31-P66 HydrophobicContact CE2-CB 4.03Å
67	C	96.2	Very high	87.9	Confident	42 Å²	42	87.6 Å²	87.6	28%	0.284	46%	0.458	S	S	.	.	T	Hydrogen-bonded Turn	trans	-107.9	16.6	-176.5	-57.3	0	0	0	0	112.9	H27 Q65	H27-C67 PolarHBondContact ND1-SG 3.28Å; H27-C67 VanDerWaalsContact ND1-SG 3.45Å; Q65-C67 VanDerWaalsContact C-N 3.26Å; Q65-C67 PolarHBondContact O-N 3.22Å
68	G	95.3	Very high	85.5	Confident	25 Å²	25	91.3 Å²	91.3	26%	0.258	48%	0.477	S	S	.	.			trans	72	-176.4	-172.4	0	0	0	0	0	113.2	W20 Q65	W20-G68 PolarHBondContact NE1-O 3.03Å; Q65-G68 WeakPolarHBondContact CG-O 3.31Å; Q65-G68 PolarHBondContact O-N 3.19Å
69	P	94.3	Very high	83	Confident	96 Å²	96	99.2 Å²	99.2	62%	0.623	53%	0.527	S	S	*	.	S	Bend	trans	-59.5	148.4	-179.7	25	-33.3	0	0	0	111.6	W20 Q65	W20-P69 PolarHBondContact NE1-O 3.44Å; Q65-P69 VanDerWaalsContact CD-N 3.33Å
70	P	92	Very high	82.2	Confident	74 Å²	74	103.9 Å²	103.9	48%	0.481	55%	0.552	S	S	.	*	P	Polyproline II helix	trans	-60.6	145.4	174.7	26.7	-33.3	0	0	0	110.1	W20	W20-P70 HydrophobicContact CD2-CB 3.86Å; W20-P70 VanDerWaalsContact CE2-CA 3.48Å; W20-P70 HydrophobicContact CE3-CB 3.91Å; W20-P70 HydrophobicContact CH2-CB 3.97Å; W20-P70 HydrophobicContact CH2-CG 4.35Å; W20-P70 HydrophobicContact CZ2-CB 3.89Å; W20-P70 HydrophobicContact CZ2-CG 4.31Å; W20-P70 HydrophobicContact CZ3-CB 3.98Å
71	P	90.4	Very high	81.4	Confident	85 Å²	85	105.1 Å²	105.1	55%	0.552	56%	0.559	S	S	*	*	P	Polyproline II helix	trans	-61.5	151.5	172	28.5	-34.4	0	0	0	110.1	W20 R73	W20-P71 HydrophobicContact CB-CG 4.19Å; P71-R73 PolarHBondContact O-N 2.98Å
72	E	85.3	Confident	80.5	Confident	163 Å²	163	105.3 Å²	105.3	76%	0.762	56%	0.563	S	S	*	*	P	Polyproline II helix	trans	-57.6	133.5	172	-67.1	174.9	-178.5	0	0	109.3
73	R	75	Confident	79.5	Confident	152 Å²	152	104.4 Å²	104.4	57%	0.574	57%	0.57	S	S	*	*	P	Polyproline II helix	trans	-72.3	138	176.8	-73.6	179.2	-72.6	174.6	-7.6	108.3	P71 D75 E76	P71-R73 PolarHBondContact O-N 2.98Å; R73-D75 PolarHBondContact O-N 2.93Å; R73-E76 HydrophobicContact CB-CG 4.33Å; R73-E76 IonicContact CZ-OE1 2.6Å; R73-E76 VanDerWaalsContact CZ-OE1 3.26Å; R73-E76 IonicContact CZ-OE2 3.61Å; R73-E76 IonicContact NE-OE1 3.86Å; R73-E76 IonicContact NE-OE2 3.49Å; R73-E76 PolarHBondContact NE-OE2 3.11Å; R73-E76 IonicContact NH2-OE1 3.52Å; R73-E76 PolarHBondContact NH2-OE1 3.04Å; R73-E76 IonicContact NH2-OE2 3.35Å; R73-E76 PolarHBondContact O-N 3.17Å
74	P	66	Low	78.4	Confident	106 Å²	106	107.7 Å²	107.7	69%	0.688	59%	0.589	S	S	*	*	G	3₁₀ helix	trans	-52.9	-27.2	177.7	-25.5	33.4	0	0	0	113.6	E76 T77	P74-E76 VanDerWaalsContact C-N 3.3Å; P74-E76 PolarHBondContact O-N 3.41Å; P74-T77 PolarHBondContact O-OG1 2.97Å
75	D	62.3	Low	77.2	Confident	147 Å²	147	107.1 Å²	107.1	79%	0.786	59%	0.589	S	S	*	*	G	3₁₀ helix	trans	-80.5	-5.5	-175.9	-49.4	-31.1	0	0	0	114	R73	R73-D75 PolarHBondContact O-N 2.93Å
76	E	58.6	Low	75.9	Confident	109 Å²	109	107.5 Å²	107.5	51%	0.509	60%	0.597	S	S	.	*	G	3₁₀ helix	trans	-102.8	-2.7	-176.3	-66	-179	147.1	0	0	113.3	R73 P74	R73-E76 HydrophobicContact CB-CG 4.33Å; R73-E76 IonicContact CZ-OE1 2.6Å; R73-E76 VanDerWaalsContact CZ-OE1 3.26Å; R73-E76 IonicContact CZ-OE2 3.61Å; R73-E76 IonicContact NE-OE1 3.86Å; R73-E76 IonicContact NE-OE2 3.49Å; R73-E76 PolarHBondContact NE-OE2 3.11Å; R73-E76 IonicContact NH2-OE1 3.52Å; R73-E76 PolarHBondContact NH2-OE1 3.04Å; R73-E76 IonicContact NH2-OE2 3.35Å; R73-E76 PolarHBondContact O-N 3.17Å; P74-E76 VanDerWaalsContact C-N 3.3Å; P74-E76 PolarHBondContact O-N 3.41Å
77	T	58.7	Low	74.3	Confident	91 Å²	91	113.5 Å²	113.5	56%	0.558	63%	0.628	S	S	*	*	S	Bend	trans	-99.1	10.1	-177.8	47.7	0	0	0	0	115	P74	P74-T77 PolarHBondContact O-OG1 2.97Å
78	E	47.3	Very low	72.5	Confident	187 Å²	187	119.5 Å²	119.5	87%	0.874	66%	0.657	S	S	*	*			trans	-105.7	44.6	176.8	-72.1	-168.8	164.3	0	0	114.1
79	T	44.9	Very low	70.4	Confident	199 Å²	199	128.1 Å²	128.1	100%	1.221	69%	0.693	S	S	*	*			trans	-129.5	0	164.3	20.7	0	0	0	0	110.4

Retrieved 79 of 79 residues in 45 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).