A0A077Z5H6_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077Z5H6, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 144 aa.

						>A0A077Z5H6_TRITR|A0A077Z5H6
MLTLTGDDPPPTMDRIKQRRSLDVGSLYRVRGTHPVCLTGNRIRDGPFLARPGNCVCAYDGDRWTVHAYTCDLIAAPPPGAHLIATFSNGMTADGATAKQGRDQEIKRPNGSAFSFAKVTVEGAKSDRQLHSGKVILLGKEVKL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	24.3	Very low	29.2	Very low	227 Å²	227	113.4 Å²	113.4	100%	1.118	68%	0.68	S	S	*	*				0	107.8	0	-170.5	169.9	173.3	0	0	106.9
2	L	21.8	Very low	29.6	Very low	122 Å²	122	111.5 Å²	111.5	64%	0.639	67%	0.67	S	S	*	*			trans	-106.4	114.3	179.7	-100.2	142.8	0	0	0	107.3	L4	L2-L4 PolarHBondContact O-N 3.08Å
3	T	24.5	Very low	29.8	Very low	119 Å²	119	109.3 Å²	109.3	73%	0.73	65%	0.649	S	S	*	*			trans	-81.8	105.4	172.5	-43.7	0	0	0	0	106.8
4	L	25.8	Very low	30.1	Very low	87 Å²	87	109.2 Å²	109.2	46%	0.455	64%	0.644	S	S	.	*			trans	-87.9	117.6	166.8	-65.5	175.1	0	0	0	106.8	L2 D8 Y28	L2-L4 PolarHBondContact O-N 3.08Å; L4-D8 WeakPolarHBondContact CA-OD2 3.28Å; L4-D8 HydrophobicContact CB-CB 4.33Å; L4-D8 WeakPolarHBondContact CB-OD2 3.16Å; L4-D8 HydrophobicContact CD2-CB 4.16Å; L4-D8 WeakPolarHBondContact CD2-OD2 3.08Å; L4-Y28 HydrophobicContact CD1-CD1 3.73Å; L4-Y28 HydrophobicContact CD1-CE1 3.31Å; L4-Y28 HydrophobicContact CG-CD1 4.48Å; L4-Y28 HydrophobicContact CG-CE1 4.11Å
5	T	24.7	Very low	30.5	Very low	91 Å²	91	114 Å²	114	56%	0.558	65%	0.647	S	S	*	*			trans	-75.3	147.3	171.8	38.9	0	0	0	0	108.2	D7 D8	T5-D7 PolarHBondContact O-N 3.02Å; T5-D8 PolarHBondContact N-OD2 3.47Å; T5-D8 PolarHBondContact O-N 3.42Å
6	G	28.8	Very low	30.7	Very low	89 Å²	89	110.9 Å²	110.9	92%	0.918	63%	0.627	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.9	6.3	-170.3	0	0	0	0	0	117.4
7	D	30.3	Very low	30.7	Very low	155 Å²	155	112.7 Å²	112.7	83%	0.829	63%	0.626	S	S	*	*	T	Hydrogen-bonded Turn	trans	-102.7	-0.8	173.4	-66	-50.8	0	0	0	113.3	T5	T5-D7 PolarHBondContact O-N 3.02Å
8	D	32.6	Very low	30.7	Very low	78 Å²	78	115.5 Å²	115.5	42%	0.417	63%	0.634	S	S	.	*	S	Bend	trans	-70.3	125.7	178.2	-80.6	-52.3	0	0	0	110.7	L4 T5	L4-D8 WeakPolarHBondContact CA-OD2 3.28Å; L4-D8 HydrophobicContact CB-CB 4.33Å; L4-D8 WeakPolarHBondContact CB-OD2 3.16Å; L4-D8 HydrophobicContact CD2-CB 4.16Å; L4-D8 WeakPolarHBondContact CD2-OD2 3.08Å; T5-D8 PolarHBondContact N-OD2 3.47Å; T5-D8 PolarHBondContact O-N 3.42Å
9	P	36.9	Very low	30.7	Very low	99 Å²	99	116.2 Å²	116.2	64%	0.643	63%	0.626	S	S	*	*	P	Polyproline II helix	trans	-60.4	146.4	178.2	24.4	-32.6	0	0	0	110.1
10	P	35.7	Very low	30.5	Very low	115 Å²	115	123.1 Å²	123.1	75%	0.747	64%	0.643	S	S	*	*	P	Polyproline II helix	trans	-51.9	133.8	178.8	19.5	-30.6	0	0	0	109.6	T12	P10-T12 PolarHBondContact O-N 3.04Å; P10-T12 VanDerWaalsContact O-N 3.16Å
11	P	35.6	Very low	30.4	Very low	65 Å²	65	121.7 Å²	121.7	42%	0.422	64%	0.644	S	S	.	*	P	Polyproline II helix	trans	-57.2	125.8	-176.9	21.2	-31.2	0	0	0	109.8	I16	P11-I16 HydrophobicContact CB-CG1 4.37Å; P11-I16 HydrophobicContact CG-CD1 4.44Å
12	T	34.7	Very low	30.6	Very low	91 Å²	91	113.9 Å²	113.9	56%	0.558	61%	0.606	S	S	*	*	P	Polyproline II helix	trans	-62.3	148.7	175.2	51	0	0	0	0	110.5	P10 D14 R15 I16	P10-T12 PolarHBondContact O-N 3.04Å; P10-T12 VanDerWaalsContact O-N 3.16Å; T12-D14 PolarHBondContact O-N 3.09Å; T12-R15 WeakPolarHBondContact O-CB 3.46Å; T12-R15 PolarHBondContact O-N 2.77Å; T12-I16 PolarHBondContact O-N 3.46Å
13	M	32.3	Very low	30.9	Very low	83 Å²	83	113.7 Å²	113.7	41%	0.409	61%	0.605	S	S	.	*	H	α-helix	trans	-50.7	-30.5	179.5	-83.3	-68	-76.1	0	0	113.5	I16 K17 T39	M13-I16 PolarHBondContact O-N 2.6Å; M13-K17 WeakPolarHBondContact O-CG 3.5Å; M13-K17 PolarHBondContact O-N 2.73Å; M13-T39 WeakPolarHBondContact CE-O 3.22Å
14	D	33.5	Very low	31.1	Very low	108 Å²	108	113.5 Å²	113.5	58%	0.578	60%	0.604	S	S	*	*	H	α-helix	trans	-71.9	-30.2	178.3	-69.9	-26.4	0	0	0	113.5	T12 K17	T12-D14 PolarHBondContact O-N 3.09Å; D14-K17 IonicContact OD1-NZ 3.84Å
15	R	35.4	Very low	31.1	Very low	181 Å²	181	113.2 Å²	113.2	68%	0.683	62%	0.622	S	S	*	*	H	α-helix	trans	-71.6	-30.3	173.3	-88.7	-176	161.1	-175.9	-3.4	112.6	T12	T12-R15 WeakPolarHBondContact O-CB 3.46Å; T12-R15 PolarHBondContact O-N 2.77Å
16	I	34.6	Very low	31.1	Very low	65 Å²	65	112.2 Å²	112.2	33%	0.333	62%	0.619	S	S	.	*	H	α-helix	trans	-75.1	-40.1	179.3	-60.1	174.1	0	0	0	110.5	P11 T12 M13 Q18 R19	P11-I16 HydrophobicContact CB-CG1 4.37Å; P11-I16 HydrophobicContact CG-CD1 4.44Å; T12-I16 PolarHBondContact O-N 3.46Å; M13-I16 PolarHBondContact O-N 2.6Å; I16-Q18 VanDerWaalsContact C-N 3.26Å; I16-Q18 PolarHBondContact O-N 3.33Å; I16-R19 PolarHBondContact O-N 2.91Å
17	K	30.4	Very low	31	Very low	141 Å²	141	110.8 Å²	110.8	61%	0.613	59%	0.59	S	S	*	*	H	α-helix	trans	-63.7	-25.1	179.4	-73	172.8	-174.1	169.5	0	114.4	M13 D14	M13-K17 WeakPolarHBondContact O-CG 3.5Å; M13-K17 PolarHBondContact O-N 2.73Å; D14-K17 IonicContact OD1-NZ 3.84Å
18	Q	30.3	Very low	30.9	Very low	163 Å²	163	107.2 Å²	107.2	76%	0.762	57%	0.565	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.2	-16.7	-179.9	-73.3	-176.3	-7.3	0	0	113.6	I16 R20	I16-Q18 VanDerWaalsContact C-N 3.26Å; I16-Q18 PolarHBondContact O-N 3.33Å; Q18-R20 PolarHBondContact O-N 2.83Å
19	R	30.8	Very low	30.5	Very low	128 Å²	128	114.7 Å²	114.7	48%	0.483	59%	0.588	S	S	.	*			trans	-91.2	94.2	177.5	-66.9	-164.9	-179.2	-157.3	3	110	I16 S21 L22	I16-R19 PolarHBondContact O-N 2.91Å; R19-S21 PolarHBondContact O-N 2.88Å; R19-S21 VanDerWaalsContact O-N 3.09Å; R19-L22 HydrophobicContact CB-CD1 3.77Å; R19-L22 HydrophobicContact CB-CG 4.44Å
20	R	27.1	Very low	30	Very low	255 Å²	255	113.7 Å²	113.7	96%	0.962	58%	0.579	S	S	*	*	S	Bend	trans	-64.5	-5.8	-177.5	-75.6	-174.1	173.5	-164.7	-0.5	115.6	Q18	Q18-R20 PolarHBondContact O-N 2.83Å
21	S	28.7	Very low	29.5	Very low	94 Å²	94	120.1 Å²	120.1	66%	0.657	59%	0.589	S	S	*	*			trans	-158.3	112.4	177.2	162.7	0	0	0	0	105.6	R19	R19-S21 PolarHBondContact O-N 2.88Å; R19-S21 VanDerWaalsContact O-N 3.09Å
22	L	27.4	Very low	29.1	Very low	63 Å²	63	118.7 Å²	118.7	33%	0.33	59%	0.586	S	S	.	*			trans	-102.6	100	167.3	-102.7	120.6	0	0	0	106	R19 V24 L27	R19-L22 HydrophobicContact CB-CD1 3.77Å; R19-L22 HydrophobicContact CB-CG 4.44Å; L22-V24 PolarHBondContact O-N 2.94Å; L22-L27 HydrophobicContact CD2-CD1 4.11Å; L22-L27 HydrophobicContact CD2-CG 4.09Å
23	D	28.5	Very low	28.9	Very low	117 Å²	117	120.8 Å²	120.8	63%	0.626	60%	0.599	S	S	*	*			trans	-53.1	122.2	166.5	-151.2	-23.1	0	0	0	107.8	G25 S26	D23-G25 PolarHBondContact O-N 3.46Å; D23-S26 WeakPolarHBondContact O-CA 3.27Å; D23-S26 WeakPolarHBondContact O-CB 3.12Å; D23-S26 PolarHBondContact O-N 3.27Å
24	V	28.2	Very low	28.7	Very low	116 Å²	116	123.7 Å²	123.7	70%	0.703	61%	0.611	S	S	*	*	G	3₁₀ helix	trans	-60.7	-22.4	-169.5	-176.8	0	0	0	0	111.1	L22 S26	L22-V24 PolarHBondContact O-N 2.94Å; V24-S26 VanDerWaalsContact C-N 3.28Å; V24-S26 PolarHBondContact O-N 3.43Å
25	G	26	Very low	28.6	Very low	80 Å²	80	120.8 Å²	120.8	83%	0.825	60%	0.598	S	S	*	*	G	3₁₀ helix	trans	-75.2	-5.1	171.5	0	0	0	0	0	115.9	D23	D23-G25 PolarHBondContact O-N 3.46Å
26	S	25.8	Very low	28.3	Very low	71 Å²	71	115.8 Å²	115.8	50%	0.497	59%	0.588	S	S	.	*	G	3₁₀ helix	trans	-106	0.7	-178.1	-60.6	0	0	0	0	114	D23 V24 Y28	D23-S26 WeakPolarHBondContact O-CA 3.27Å; D23-S26 WeakPolarHBondContact O-CB 3.12Å; D23-S26 PolarHBondContact O-N 3.27Å; V24-S26 VanDerWaalsContact C-N 3.28Å; V24-S26 PolarHBondContact O-N 3.43Å; S26-Y28 PolarHBondContact O-N 2.95Å
27	L	26.1	Very low	28.1	Very low	58 Å²	58	115 Å²	115	30%	0.304	59%	0.587	S	S	.	*	S	Bend	trans	-75.3	75.4	170.9	-108.5	138.7	0	0	0	109.3	L22 L38	L22-L27 HydrophobicContact CD2-CD1 4.11Å; L22-L27 HydrophobicContact CD2-CG 4.09Å; L27-L38 HydrophobicContact CD1-CD1 4.29Å; L27-L38 HydrophobicContact CD2-CD1 4.37Å; L27-L38 HydrophobicContact CD2-CD2 4.34Å
28	Y	27.9	Very low	28.1	Very low	81 Å²	81	110.6 Å²	110.6	32%	0.318	57%	0.57	S	S	.	*			trans	36	103.6	161	-56.2	-84.8	0	0	0	116.4	L4 S26 V30	L4-Y28 HydrophobicContact CD1-CD1 3.73Å; L4-Y28 HydrophobicContact CD1-CE1 3.31Å; L4-Y28 HydrophobicContact CG-CD1 4.48Å; L4-Y28 HydrophobicContact CG-CE1 4.11Å; S26-Y28 PolarHBondContact O-N 2.95Å; Y28-V30 PolarHBondContact O-N 3.17Å
29	R	25.2	Very low	28.1	Very low	235 Å²	235	108 Å²	108	89%	0.887	57%	0.565	S	S	*	*			trans	-59.6	71.3	151.3	-151.3	-177.6	-154.2	179.7	6.2	108.8	R31	R29-R31 PolarHBondContact O-N 2.93Å
30	V	26.9	Very low	27.9	Very low	78 Å²	78	103.7 Å²	103.7	47%	0.473	56%	0.561	S	S	.	*			trans	-78	97.5	170.8	-174.6	0	0	0	0	105.8	Y28 G32	Y28-V30 PolarHBondContact O-N 3.17Å; V30-G32 PolarHBondContact O-N 2.69Å
31	R	25.1	Very low	27.9	Very low	249 Å²	249	96.8 Å²	96.8	94%	0.94	54%	0.543	S	S	*	.			trans	-58.8	101.8	163.7	-93.2	-175.5	164.8	179.9	-4	107.5	R29	R29-R31 PolarHBondContact O-N 2.93Å
32	G	26.6	Very low	27.7	Very low	35 Å²	35	102.5 Å²	102.5	36%	0.361	55%	0.55	S	S	.	*	S	Bend	trans	131.5	103.2	170.4	0	0	0	0	0	114	V30 H34	V30-G32 PolarHBondContact O-N 2.69Å; G32-H34 PolarHBondContact O-N 3.28Å; G32-H34 PolarHBondContact O-ND1 2.86Å; G32-H34 VanDerWaalsContact O-ND1 3.09Å
33	T	30	Very low	27.7	Very low	135 Å²	135	102.7 Å²	102.7	83%	0.828	55%	0.551	S	S	*	*	S	Bend	trans	38.8	5.9	145.6	51.5	0	0	0	0	122.9
34	H	28.8	Very low	27.6	Very low	144 Å²	144	106.8 Å²	106.8	67%	0.667	56%	0.557	S	S	*	*			trans	-123.5	111.8	-172.9	-57.6	91.7	0	0	0	111.6	G32	G32-H34 PolarHBondContact O-N 3.28Å; G32-H34 PolarHBondContact O-ND1 2.86Å; G32-H34 VanDerWaalsContact O-ND1 3.09Å
35	P	31.6	Very low	27.5	Very low	47 Å²	47	108.7 Å²	108.7	31%	0.305	56%	0.564	S	S	.	*	P	Polyproline II helix	trans	-68	132.1	171.6	28.9	-33.9	0	0	0	110.3	Y69	P35-Y69 HydrophobicContact CB-CG 4.31Å
36	V	29.2	Very low	27.6	Very low	77 Å²	77	106.3 Å²	106.3	47%	0.467	54%	0.539	S	S	.	.	P	Polyproline II helix	trans	-90.3	119	176.3	-179.7	0	0	0	0	109.9
37	C	29.9	Very low	27.6	Very low	49 Å²	49	107.4 Å²	107.4	33%	0.331	54%	0.544	S	S	.	.	P	Polyproline II helix	trans	-76	119.5	175.7	-62	0	0	0	0	111.5	T39 C71	C37-T39 PolarHBondContact O-N 2.91Å; C37-C71 WeakPolarHBondContact SG-CB 3.35Å; C37-C71 VanDerWaalsContact SG-SG 3.7Å
38	L	29.9	Very low	27.8	Very low	48 Å²	48	107.8 Å²	107.8	25%	0.251	54%	0.544	S	S	.	.			trans	-87.1	91.1	166.2	-68.4	174.1	0	0	0	110.1	L27 G40 I43	L27-L38 HydrophobicContact CD1-CD1 4.29Å; L27-L38 HydrophobicContact CD2-CD1 4.37Å; L27-L38 HydrophobicContact CD2-CD2 4.34Å; L38-G40 PolarHBondContact O-N 2.72Å; L38-I43 HydrophobicContact CD1-CD1 4.21Å
39	T	30.2	Very low	27.8	Very low	108 Å²	108	111.9 Å²	111.9	66%	0.663	57%	0.571	S	S	*	*			trans	-83.7	85.4	168.6	56.2	0	0	0	0	109.3	M13 C37	M13-T39 WeakPolarHBondContact CE-O 3.22Å; C37-T39 PolarHBondContact O-N 2.91Å
40	G	27	Very low	28.1	Very low	37 Å²	37	101.7 Å²	101.7	38%	0.381	54%	0.537	S	S	.	.			trans	-174.9	117	179.8	0	0	0	0	0	114.7	L38 R42	L38-G40 PolarHBondContact O-N 2.72Å; G40-R42 PolarHBondContact O-N 3.09Å
41	N	26	Very low	28.2	Very low	110 Å²	110	107 Å²	107	59%	0.588	55%	0.548	S	S	*	.	S	Bend	trans	-60.1	95.8	166.5	-69.8	-27.7	0	0	0	109.7	A50	N41-A50 PolarHBondContact OD1-O 3.07Å; N41-A50 VanDerWaalsContact OD1-O 3.1Å
42	R	25.7	Very low	28.5	Very low	214 Å²	214	100.5 Å²	100.5	81%	0.808	54%	0.538	S	S	*	.			trans	150.1	99.1	150.5	-84.7	167.2	-175.7	178.8	3.5	109.5	G40	G40-R42 PolarHBondContact O-N 3.09Å
43	I	27.7	Very low	28.8	Very low	67 Å²	67	102.8 Å²	102.8	34%	0.344	56%	0.561	S	S	.	*			trans	-103.1	98.8	152.1	-56.9	178.6	0	0	0	104.6	L38 F48	L38-I43 HydrophobicContact CD1-CD1 4.21Å; I43-F48 HydrophobicContact CD1-CB 4.31Å
44	R	26	Very low	28.9	Very low	203 Å²	203	99 Å²	99	77%	0.766	54%	0.536	S	S	*	.	T	Hydrogen-bonded Turn	trans	-73.8	130	165.4	-85.2	179.8	175.2	172.6	-4	106.2
45	D	25.4	Very low	29.2	Very low	156 Å²	156	94.1 Å²	94.1	83%	0.834	52%	0.518	S	S	*	.	T	Hydrogen-bonded Turn	trans	93.2	26.3	173.1	-45.3	-30.8	0	0	0	118.6
46	G	27.8	Very low	29.3	Very low	30 Å²	30	93.1 Å²	93.1	31%	0.309	51%	0.511	S	S	.	.	S	Bend	trans	-165.4	151	163.6	0	0	0	0	0	111.7	F48	G46-F48 PolarHBondContact O-N 2.97Å
47	P	27.8	Very low	29.6	Very low	94 Å²	94	91.1 Å²	91.1	61%	0.61	50%	0.5	S	S	*	.	S	Bend	trans	-79.2	48.7	-163.8	34.6	-37.4	0	0	0	114.2
48	F	29	Very low	29.7	Very low	66 Å²	66	91.9 Å²	91.9	29%	0.289	51%	0.51	S	S	.	.			trans	-107.2	93.4	177.6	-62.1	-78.3	0	0	0	110.6	I43 G46 A50 T86	I43-F48 HydrophobicContact CD1-CB 4.31Å; G46-F48 PolarHBondContact O-N 2.97Å; F48-A50 PolarHBondContact O-N 3.46Å; F48-T86 VanDerWaalsContact CE1-O 3.26Å; F48-T86 WeakPolarHBondContact CE1-O 3.49Å
49	L	27.5	Very low	29.8	Very low	168 Å²	168	94.8 Å²	94.8	88%	0.88	52%	0.518	S	S	*	.			trans	-80.8	85.6	165.8	-77.1	163	0	0	0	109	R51	L49-R51 PolarHBondContact O-N 3.49Å
50	A	32.4	Very low	29.8	Very low	21 Å²	21	96 Å²	96	17%	0.174	52%	0.52	C	S	.	.	P	Polyproline II helix	trans	-68.3	118.2	166.1	0	0	0	0	0	108.9	N41 F48 V56	N41-A50 PolarHBondContact OD1-O 3.07Å; N41-A50 VanDerWaalsContact OD1-O 3.1Å; F48-A50 PolarHBondContact O-N 3.46Å; A50-V56 HydrophobicContact CB-CG2 3.81Å
51	R	29.4	Very low	29.9	Very low	188 Å²	188	96.4 Å²	96.4	71%	0.709	53%	0.525	S	S	*	.	P	Polyproline II helix	trans	-82.9	155.6	164.8	-64.1	-174.8	175.1	-170.6	-2.1	109	L49 G53 N54	L49-R51 PolarHBondContact O-N 3.49Å; R51-G53 PolarHBondContact O-N 3.16Å; R51-G53 VanDerWaalsContact O-N 3.14Å; R51-N54 WeakPolarHBondContact CB-ND2 3.38Å; R51-N54 PolarHBondContact N-ND2 3.22Å; R51-N54 VanDerWaalsContact N-ND2 3.15Å; R51-N54 VanDerWaalsContact O-CB 3.29Å; R51-N54 WeakPolarHBondContact O-CB 3.4Å; R51-N54 PolarHBondContact O-N 2.91Å
52	P	31.4	Very low	30	Very low	114 Å²	114	98.4 Å²	98.4	74%	0.74	54%	0.536	S	S	*	.	T	Hydrogen-bonded Turn	trans	-50.7	122.8	165.4	-22.5	32.2	0	0	0	109.6
53	G	31.9	Very low	30	Very low	82 Å²	82	98.1 Å²	98.1	85%	0.845	54%	0.535	S	S	*	.	T	Hydrogen-bonded Turn	trans	96	-3.9	-173.2	0	0	0	0	0	115.7	R51	R51-G53 PolarHBondContact O-N 3.16Å; R51-G53 VanDerWaalsContact O-N 3.14Å
54	N	33.2	Very low	30	Very low	55 Å²	55	102.2 Å²	102.2	29%	0.294	55%	0.546	S	S	.	.			trans	-93.4	119	174.9	-67.8	-2.1	0	0	0	110.5	R51	R51-N54 WeakPolarHBondContact CB-ND2 3.38Å; R51-N54 PolarHBondContact N-ND2 3.22Å; R51-N54 VanDerWaalsContact N-ND2 3.15Å; R51-N54 VanDerWaalsContact O-CB 3.29Å; R51-N54 WeakPolarHBondContact O-CB 3.4Å; R51-N54 PolarHBondContact O-N 2.91Å
55	C	34.8	Very low	30.1	Very low	42 Å²	42	96.5 Å²	96.5	28%	0.284	53%	0.534	S	S	.	.			trans	-75.3	132.5	167.3	-63.6	0	0	0	0	109.4	C71 L83	C55-C71 HydrophobicContact CB-CB 3.61Å; C55-L83 HydrophobicContact CB-CD2 4.42Å
56	V	33.8	Very low	30.3	Very low	26 Å²	26	91.5 Å²	91.5	16%	0.158	51%	0.509	C	S	.	.			trans	-110.9	117.8	172.4	-179.7	0	0	0	0	107.7	A50	A50-V56 HydrophobicContact CB-CG2 3.81Å
57	C	34.7	Very low	30.6	Very low	35 Å²	35	94.4 Å²	94.4	24%	0.236	51%	0.514	C	S	.	.	P	Polyproline II helix	trans	-93.8	125.5	177.6	-47.3	0	0	0	0	108.9	Y69	C57-Y69 PolarHBondContact SG-O 3.32Å
58	A	32.8	Very low	30.8	Very low	65 Å²	65	93.5 Å²	93.5	54%	0.537	51%	0.514	S	S	.	.	P	Polyproline II helix	trans	-81.5	142.8	169.4	0	0	0	0	0	109.9
59	Y	30.8	Very low	31	Very low	110 Å²	110	95.7 Å²	95.7	43%	0.431	52%	0.521	S	S	.	.	P	Polyproline II helix	trans	-89.9	126.5	-179.7	-66.9	-101.4	0	0	0	109.5	V66 M91	Y59-V66 HydrophobicContact CE1-CG1 4Å; Y59-V66 HydrophobicContact CE1-CG2 4.32Å; Y59-M91 HydrophobicContact CE1-CE 3.92Å
60	D	31.7	Very low	31.1	Very low	132 Å²	132	90.1 Å²	90.1	71%	0.706	50%	0.495	S	S	*	.			trans	-119.5	132.4	153.1	-171.4	9.6	0	0	0	106.1
61	G	29	Very low	31	Very low	47 Å²	47	89.2 Å²	89.2	49%	0.485	49%	0.487	S	S	.	.			trans	163.2	94.8	-175.8	0	0	0	0	0	111.7	R63	G61-R63 PolarHBondContact O-N 3.16Å
62	D	26.8	Very low	31	Very low	151 Å²	151	85.8 Å²	85.8	81%	0.807	48%	0.483	S	S	*	.	S	Bend	trans	-33.7	116.2	151.6	-78.7	-46.6	0	0	0	110.3
63	R	27.2	Very low	30.9	Very low	208 Å²	208	82.1 Å²	82.1	79%	0.785	46%	0.457	S	S	*	.	S	Bend	trans	34	103.8	160.7	-52	-174.9	-170.7	173.7	3.1	114.8	G61	G61-R63 PolarHBondContact O-N 3.16Å
64	W	26.1	Very low	30.8	Very low	154 Å²	154	85.9 Å²	85.9	58%	0.583	46%	0.456	S	S	*	.	S	Bend	trans	98.7	4.5	152.2	-44.4	111.7	0	0	0	119.9	T92	W64-T92 HydrophobicContact CE3-CG2 3.84Å; W64-T92 HydrophobicContact CH2-CG2 3.83Å; W64-T92 HydrophobicContact CZ3-CG2 3.24Å; W64-T92 WeakPolarHBondContact CZ3-OG1 3.26Å
65	T	28.6	Very low	30.9	Very low	83 Å²	83	86.7 Å²	86.7	51%	0.509	47%	0.47	S	S	.	.			trans	-123.3	124.1	-179.8	-44.4	0	0	0	0	112.7	H67	T65-H67 WeakPolarHBondContact CG2-NE2 3.23Å
66	V	30.1	Very low	31	Very low	51 Å²	51	87 Å²	87	31%	0.309	48%	0.475	S	S	.	.			trans	-87.2	108	170.8	175.2	0	0	0	0	108.8	Y59 M91	Y59-V66 HydrophobicContact CE1-CG1 4Å; Y59-V66 HydrophobicContact CE1-CG2 4.32Å; V66-M91 HydrophobicContact CG2-CE 3.48Å; V66-M91 VanDerWaalsContact CG2-CE 3.48Å; V66-M91 HydrophobicContact CG2-SD 3.37Å; V66-M91 WeakPolarHBondContact CG2-SD 3.4Å
67	H	33.4	Very low	31.2	Very low	91 Å²	91	87.3 Å²	87.3	42%	0.421	48%	0.478	S	S	.	.			trans	-94.8	106	167.7	-70.1	-88.2	0	0	0	109.6	T65 Y69	T65-H67 WeakPolarHBondContact CG2-NE2 3.23Å; H67-Y69 HydrophobicContact CB-CD2 4.05Å; H67-Y69 HydrophobicContact CB-CE2 3.39Å; H67-Y69 PolarHBondContact O-N 2.74Å
68	A	33.2	Very low	31.2	Very low	75 Å²	75	90.1 Å²	90.1	62%	0.62	50%	0.496	S	S	*	.			trans	-82.9	98.7	165.8	0	0	0	0	0	108.2
69	Y	31.8	Very low	31.4	Very low	111 Å²	111	93.2 Å²	93.2	44%	0.435	51%	0.511	S	S	.	.			trans	-80.9	124	168	-64	-80.4	0	0	0	108.5	P35 C57 H67 C71	P35-Y69 HydrophobicContact CB-CG 4.31Å; C57-Y69 PolarHBondContact SG-O 3.32Å; H67-Y69 HydrophobicContact CB-CD2 4.05Å; H67-Y69 HydrophobicContact CB-CE2 3.39Å; H67-Y69 PolarHBondContact O-N 2.74Å; Y69-C71 VanDerWaalsContact C-N 3.28Å; Y69-C71 PolarHBondContact O-N 3.33Å
70	T	29.8	Very low	31.7	Very low	52 Å²	52	90.7 Å²	90.7	32%	0.319	52%	0.518	S	S	.	.			trans	-71	99.1	163.2	52.3	0	0	0	0	107.5	D72 I106 F116	T70-D72 PolarHBondContact O-N 3.16Å; T70-I106 HydrophobicContact CG2-CD1 3.17Å; T70-I106 HydrophobicContact CG2-CG1 4.34Å; T70-F116 HydrophobicContact CG2-CE2 4.12Å; T70-F116 HydrophobicContact CG2-CZ 4.23Å
71	C	30.1	Very low	31.9	Very low	1 Å²	1	86 Å²	86	1%	0.007	50%	0.497	C	S	.	.			trans	-36	127.2	153.8	-71.7	0	0	0	0	107.6	C37 C55 Y69 L73	C37-C71 WeakPolarHBondContact SG-CB 3.35Å; C37-C71 VanDerWaalsContact SG-SG 3.7Å; C55-C71 HydrophobicContact CB-CB 3.61Å; Y69-C71 VanDerWaalsContact C-N 3.28Å; Y69-C71 PolarHBondContact O-N 3.33Å; C71-L73 PolarHBondContact O-N 2.92Å
72	D	30.2	Very low	32.4	Very low	116 Å²	116	88.1 Å²	88.1	62%	0.62	49%	0.494	S	S	*	.			trans	-39.1	111.4	178.6	-75.8	-47.9	0	0	0	108.8	T70 I74	T70-D72 PolarHBondContact O-N 3.16Å; D72-I74 HydrophobicContact CB-CG1 4.13Å; D72-I74 PolarHBondContact O-N 2.88Å
73	L	29.3	Very low	32.9	Very low	38 Å²	38	83 Å²	83	20%	0.199	47%	0.466	C	S	.	.			trans	-70.5	77.4	174.2	-79.1	165.1	0	0	0	105.7	C71 A75 P77 F114	C71-L73 PolarHBondContact O-N 2.92Å; L73-A75 PolarHBondContact O-N 2.83Å; L73-A75 VanDerWaalsContact O-N 3.09Å; L73-P77 HydrophobicContact CD1-CG 4.36Å; L73-P77 HydrophobicContact CD2-CG 3.79Å; L73-F114 HydrophobicContact CD1-CG 4.4Å
74	I	30.2	Very low	33.3	Very low	161 Å²	161	76.7 Å²	76.7	83%	0.826	45%	0.448	S	S	*	.	S	Bend	trans	-59.1	-18.2	175.1	-65.4	167.4	0	0	0	109.5	D72	D72-I74 HydrophobicContact CB-CG1 4.13Å; D72-I74 PolarHBondContact O-N 2.88Å
75	A	33.9	Very low	33.9	Very low	72 Å²	72	71.2 Å²	71.2	60%	0.595	44%	0.435	S	S	*	.	S	Bend	trans	-138.4	152.4	164.9	0	0	0	0	0	111.1	L73	L73-A75 PolarHBondContact O-N 2.83Å; L73-A75 VanDerWaalsContact O-N 3.09Å
76	A	37.2	Very low	34.2	Very low	47 Å²	47	69.7 Å²	69.7	39%	0.388	43%	0.426	S	S	.	.	P	Polyproline II helix	trans	-57.4	129.4	167.1	0	0	0	0	0	110.1	R108 F114	A76-R108 VanDerWaalsContact CB-NH1 3.29Å; A76-F114 HydrophobicContact CB-CZ 4.02Å
77	P	37.5	Very low	34.7	Very low	33 Å²	33	67.8 Å²	67.8	21%	0.214	41%	0.414	C	S	.	.	P	Polyproline II helix	trans	-53.6	136.7	160	-8.4	19.4	0	0	0	107.4	L73 A81 F114	L73-P77 HydrophobicContact CD1-CG 4.36Å; L73-P77 HydrophobicContact CD2-CG 3.79Å; P77-A81 HydrophobicContact CB-CB 3.28Å; P77-F114 HydrophobicContact CG-CD1 4.1Å; P77-F114 HydrophobicContact CG-CE1 3.72Å
78	P	35.3	Very low	34.6	Very low	94 Å²	94	66 Å²	66	61%	0.61	41%	0.412	S	S	*	.	P	Polyproline II helix	trans	-55.8	151.4	173.2	22.4	-31.7	0	0	0	109.9	G80 A81	P78-G80 PolarHBondContact O-N 2.81Å; P78-G80 VanDerWaalsContact O-N 3.16Å; P78-A81 HydrophobicContact CG-CB 4.14Å; P78-A81 VanDerWaalsContact O-CB 3.23Å; P78-A81 WeakPolarHBondContact O-CB 3.45Å; P78-A81 PolarHBondContact O-N 2.84Å
79	P	38.1	Very low	34.6	Very low	131 Å²	131	69 Å²	69	85%	0.851	42%	0.417	S	S	*	.	T	Hydrogen-bonded Turn	trans	-49.7	125.6	172	-26.7	34.4	0	0	0	110.5
80	G	36.2	Very low	34.5	Very low	56 Å²	56	65.6 Å²	65.6	58%	0.577	42%	0.416	S	S	*	.	T	Hydrogen-bonded Turn	trans	87.1	6.3	-174.6	0	0	0	0	0	115.3	P78 H82	P78-G80 PolarHBondContact O-N 2.81Å; P78-G80 VanDerWaalsContact O-N 3.16Å; G80-H82 PolarHBondContact O-CD2 2.64Å; G80-H82 VanDerWaalsContact O-CD2 3.23Å; G80-H82 PolarHBondContact O-NE2 3.03Å
81	A	36.1	Very low	34.8	Very low	33 Å²	33	64.7 Å²	64.7	27%	0.273	41%	0.408	S	S	.	.			trans	-65.1	139.1	169.7	0	0	0	0	0	110.8	P77 P78	P77-A81 HydrophobicContact CB-CB 3.28Å; P78-A81 HydrophobicContact CG-CB 4.14Å; P78-A81 VanDerWaalsContact O-CB 3.23Å; P78-A81 WeakPolarHBondContact O-CB 3.45Å; P78-A81 PolarHBondContact O-N 2.84Å
82	H	38.7	Very low	34.9	Very low	93 Å²	93	66.1 Å²	66.1	43%	0.431	42%	0.417	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.7	123.9	176.5	-57.6	-72.6	0	0	0	108.4	G80 I84 L138	G80-H82 PolarHBondContact O-CD2 2.64Å; G80-H82 VanDerWaalsContact O-CD2 3.23Å; G80-H82 PolarHBondContact O-NE2 3.03Å; H82-I84 HydrophobicContact CB-CG1 4.29Å; H82-I84 PolarHBondContact O-N 2.9Å; H82-L138 WeakPolarHBondContact CE1-CD2 3.19Å; H82-L138 VanDerWaalsContact ND1-CD2 3.29Å; H82-L138 WeakPolarHBondContact ND1-CD2 2.93Å
83	L	38	Very low	34.8	Very low	42 Å²	42	62.3 Å²	62.3	22%	0.22	40%	0.401	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.2	118	160.3	-98.9	143.8	0	0	0	107	C55 F116 V135 L137	C55-L83 HydrophobicContact CB-CD2 4.42Å; L83-F116 HydrophobicContact CD1-CE1 4.02Å; L83-F116 HydrophobicContact CD1-CZ 3.8Å; L83-V135 VanDerWaalsContact O-O 3.07Å; L83-L137 HydrophobicContact CB-CB 3.93Å; L83-L137 HydrophobicContact CB-CD1 3.74Å; L83-L137 HydrophobicContact CB-CG 4.16Å; L83-L137 HydrophobicContact CD1-CD1 4.12Å; L83-L137 HydrophobicContact CG-CD1 4.46Å; L83-L137 PolarHBondContact O-N 3.09Å; L83-L137 VanDerWaalsContact O-N 3.16Å
84	I	36.2	Very low	35	Very low	76 Å²	76	66.4 Å²	66.4	39%	0.39	42%	0.424	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.6	103.2	174.3	-64	174.1	0	0	0	106.3	H82 T86 K134 V135	H82-I84 HydrophobicContact CB-CG1 4.29Å; H82-I84 PolarHBondContact O-N 2.9Å; I84-T86 HydrophobicContact CG2-CG2 4.23Å; I84-K134 HydrophobicContact CG2-CD 4.29Å; I84-K134 HydrophobicContact CG2-CG 3.81Å; I84-V135 WeakPolarHBondContact CA-O 3.49Å
85	A	37.7	Very low	35	Very low	40 Å²	40	60 Å²	60	33%	0.331	40%	0.397	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.4	110.9	164.3	0	0	0	0	0	107.5	V135	A85-V135 HydrophobicContact CB-CB 4.14Å; A85-V135 HydrophobicContact CB-CG2 4.43Å; A85-V135 PolarHBondContact N-O 2.82Å; A85-V135 PolarHBondContact O-N 3.23Å
86	T	35.9	Very low	34.8	Very low	50 Å²	50	57.4 Å²	57.4	31%	0.307	38%	0.375	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.7	138.9	163.9	41.9	0	0	0	0	108.2	F48 I84 G133	F48-T86 VanDerWaalsContact CE1-O 3.26Å; F48-T86 WeakPolarHBondContact CE1-O 3.49Å; I84-T86 HydrophobicContact CG2-CG2 4.23Å; T86-G133 WeakPolarHBondContact CA-O 3.38Å
87	F	39.4	Very low	34.4	Very low	12 Å²	12	59.8 Å²	59.8	5%	0.053	39%	0.386	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.4	138	172.2	56.3	-89.9	0	0	0	109.6	M91 V121 L130 S132 G133 V135	F87-M91 HydrophobicContact CB-CE 3.56Å; F87-M91 HydrophobicContact CB-SD 4.03Å; F87-M91 HydrophobicContact CD1-SD 4.4Å; F87-M91 HydrophobicContact CD2-CE 4.23Å; F87-M91 HydrophobicContact CD2-CG 4.35Å; F87-M91 HydrophobicContact CD2-SD 3.63Å; F87-M91 HydrophobicContact CE2-SD 4.17Å; F87-M91 HydrophobicContact CG-CE 4Å; F87-M91 HydrophobicContact CG-SD 3.76Å; F87-V121 HydrophobicContact CE1-CG1 4.12Å; F87-V121 HydrophobicContact CZ-CG1 4.07Å; F87-L130 HydrophobicContact CE2-CB 3.75Å; F87-L130 HydrophobicContact CE2-CD1 4.4Å; F87-L130 HydrophobicContact CZ-CB 4.21Å; F87-L130 HydrophobicContact CZ-CD1 4.17Å; F87-S132 WeakPolarHBondContact O-CA 3.26Å; F87-G133 VanDerWaalsContact CE1-C 3.4Å; F87-G133 PolarHBondContact N-O 2.79Å; F87-G133 VanDerWaalsContact N-O 3.17Å; F87-G133 PolarHBondContact O-N 3.09Å; F87-V135 HydrophobicContact CD1-CG2 4.21Å; F87-V135 HydrophobicContact CE1-CG2 4.06Å
88	S	33.1	Very low	34.2	Very low	54 Å²	54	60.2 Å²	60.2	38%	0.378	39%	0.392	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.6	130.9	170.9	53.2	0	0	0	0	107
89	N	32.6	Very low	34	Very low	136 Å²	136	62.6 Å²	62.6	73%	0.727	39%	0.392	S	S	*	.	E	Extended strand (participates in β ladder)	trans	102.4	106.1	173.3	-53.6	-15.2	0	0	0	116	M91	N89-M91 VanDerWaalsContact C-N 3.34Å; N89-M91 PolarHBondContact O-N 3.47Å
90	G	30	Very low	33.7	Very low	40 Å²	40	64.2 Å²	64.2	41%	0.412	39%	0.388	S	S	.	.	E	Extended strand (participates in β ladder)	trans	65.7	13.6	140.2	0	0	0	0	0	119.2	T92	G90-T92 PolarHBondContact O-N 3.41Å
91	M	35.9	Very low	33.4	Very low	33 Å²	33	64.6 Å²	64.6	16%	0.163	39%	0.392	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.4	122.9	179.4	-66.5	-177.7	-174.9	0	0	109.8	Y59 V66 F87 N89 L130	Y59-M91 HydrophobicContact CE1-CE 3.92Å; V66-M91 HydrophobicContact CG2-CE 3.48Å; V66-M91 VanDerWaalsContact CG2-CE 3.48Å; V66-M91 HydrophobicContact CG2-SD 3.37Å; V66-M91 WeakPolarHBondContact CG2-SD 3.4Å; F87-M91 HydrophobicContact CB-CE 3.56Å; F87-M91 HydrophobicContact CB-SD 4.03Å; F87-M91 HydrophobicContact CD1-SD 4.4Å; F87-M91 HydrophobicContact CD2-CE 4.23Å; F87-M91 HydrophobicContact CD2-CG 4.35Å; F87-M91 HydrophobicContact CD2-SD 3.63Å; F87-M91 HydrophobicContact CE2-SD 4.17Å; F87-M91 HydrophobicContact CG-CE 4Å; F87-M91 HydrophobicContact CG-SD 3.76Å; N89-M91 VanDerWaalsContact C-N 3.34Å; N89-M91 PolarHBondContact O-N 3.47Å; M91-L130 HydrophobicContact CB-CB 4.48Å; M91-L130 PolarHBondContact O-N 3Å
92	T	31	Very low	33.4	Very low	32 Å²	32	71.8 Å²	71.8	20%	0.196	41%	0.412	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-65.5	143.2	168.5	42.2	0	0	0	0	109.4	W64 G90 D94 G95 A96 R128	W64-T92 HydrophobicContact CE3-CG2 3.84Å; W64-T92 HydrophobicContact CH2-CG2 3.83Å; W64-T92 HydrophobicContact CZ3-CG2 3.24Å; W64-T92 WeakPolarHBondContact CZ3-OG1 3.26Å; G90-T92 PolarHBondContact O-N 3.41Å; T92-D94 PolarHBondContact O-N 3.23Å; T92-G95 PolarHBondContact O-N 2.86Å; T92-A96 PolarHBondContact O-N 2.86Å; T92-R128 WeakPolarHBondContact CA-O 3.46Å
93	A	29.9	Very low	33.4	Very low	35 Å²	35	72.6 Å²	72.6	29%	0.289	42%	0.42	S	S	.	.	T	Hydrogen-bonded Turn	trans	-55.5	-21.5	177.3	0	0	0	0	0	112.8	R128	A93-R128 PolarHBondContact N-O 3.02Å
94	D	32.5	Very low	33.6	Very low	125 Å²	125	76.3 Å²	76.3	67%	0.668	44%	0.436	S	S	*	.	T	Hydrogen-bonded Turn	trans	-77.8	-32.5	178.2	-62.5	-30.7	0	0	0	113.1	T92 T97	T92-D94 PolarHBondContact O-N 3.23Å; D94-T97 PolarHBondContact O-OG1 3.14Å
95	G	29.8	Very low	33.8	Very low	25 Å²	25	78 Å²	78	26%	0.258	44%	0.442	S	S	.	.	T	Hydrogen-bonded Turn	trans	-85.9	-22	179.8	0	0	0	0	0	114.4	T92 T97	T92-G95 PolarHBondContact O-N 2.86Å; G95-T97 PolarHBondContact O-N 3.25Å
96	A	29.4	Very low	34	Very low	18 Å²	18	77.6 Å²	77.6	15%	0.149	44%	0.435	C	S	.	.	T	Hydrogen-bonded Turn	trans	-88.3	18.9	174.7	0	0	0	0	0	113.2	T92 A98 L130	T92-A96 PolarHBondContact O-N 2.86Å; A96-A98 PolarHBondContact O-N 3.06Å; A96-L130 HydrophobicContact CB-CD1 3.39Å
97	T	29.4	Very low	34.2	Very low	98 Å²	98	82.3 Å²	82.3	60%	0.601	45%	0.451	S	S	*	.			trans	-69.7	73.5	161.4	45	0	0	0	0	108.6	D94 G95 K99	D94-T97 PolarHBondContact O-OG1 3.14Å; G95-T97 PolarHBondContact O-N 3.25Å; T97-K99 VanDerWaalsContact C-N 3.26Å; T97-K99 PolarHBondContact O-N 3.21Å
98	A	32.2	Very low	34.1	Very low	41 Å²	41	83 Å²	83	34%	0.339	45%	0.453	S	S	.	.			trans	-49.4	109.1	145.3	0	0	0	0	0	104.3	A96 Q100 V119	A96-A98 PolarHBondContact O-N 3.06Å; A98-Q100 VanDerWaalsContact C-N 3.25Å; A98-Q100 WeakPolarHBondContact O-CA 3.39Å; A98-Q100 PolarHBondContact O-N 3.36Å; A98-V119 HydrophobicContact CB-CB 3.89Å; A98-V119 HydrophobicContact CB-CG1 3.39Å; A98-V119 HydrophobicContact CB-CG2 4.31Å
99	K	32.2	Very low	34.2	Very low	144 Å²	144	87.1 Å²	87.1	63%	0.626	48%	0.479	S	S	*	.			trans	-50	98	-174.2	-77.4	-178.8	178.7	176.6	0	107.4	T97 G101	T97-K99 VanDerWaalsContact C-N 3.26Å; T97-K99 PolarHBondContact O-N 3.21Å; K99-G101 PolarHBondContact O-N 3.16Å; K99-G101 VanDerWaalsContact O-N 3.09Å
100	Q	31.8	Very low	34.8	Very low	165 Å²	165	86.2 Å²	86.2	77%	0.771	47%	0.474	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67	117.6	-168.7	-162.2	-179.2	19.2	0	0	105.1	A98	A98-Q100 VanDerWaalsContact C-N 3.25Å; A98-Q100 WeakPolarHBondContact O-CA 3.39Å; A98-Q100 PolarHBondContact O-N 3.36Å
101	G	30.8	Very low	35.4	Very low	64 Å²	64	86.5 Å²	86.5	66%	0.66	48%	0.477	S	S	*	.	T	Hydrogen-bonded Turn	trans	86.1	35.6	174.8	0	0	0	0	0	116.8	K99	K99-G101 PolarHBondContact O-N 3.16Å; K99-G101 VanDerWaalsContact O-N 3.09Å
102	R	34.8	Very low	35.5	Very low	184 Å²	184	85.5 Å²	85.5	69%	0.694	47%	0.473	S	S	*	.			trans	-118.5	125.7	153	-69.2	-168.2	-170.4	-173.1	1.9	110	Q104	R102-Q104 PolarHBondContact O-N 3.49Å; R102-Q104 VanDerWaalsContact O-N 3.07Å
103	D	39.4	Very low	36	Very low	111 Å²	111	84 Å²	84	59%	0.594	46%	0.464	S	S	*	.			trans	-54.4	113.7	169.5	-65.9	-25.5	0	0	0	108.2
104	Q	41.1	Very low	36.5	Very low	120 Å²	120	82.8 Å²	82.8	56%	0.561	45%	0.452	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-92.5	109.7	167.2	-72.7	-163.4	16.6	0	0	107.5	R102 F114 S115 F116	R102-Q104 PolarHBondContact O-N 3.49Å; R102-Q104 VanDerWaalsContact O-N 3.07Å; Q104-F114 VanDerWaalsContact O-O 3.06Å; Q104-S115 WeakPolarHBondContact O-CA 3.5Å; Q104-F116 HydrophobicContact CB-CD2 4.38Å; Q104-F116 PolarHBondContact O-N 3.23Å
105	E	40.8	Very low	37	Very low	110 Å²	110	77.4 Å²	77.4	51%	0.514	42%	0.424	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.9	120.4	170.5	-68.5	-172.6	160.7	0	0	110	F114	E105-F114 CarbonylContact C-O 3.55Å; E105-F114 WeakPolarHBondContact CA-O 3.33Å
106	I	42.8	Very low	37.8	Very low	33 Å²	33	77 Å²	77	17%	0.169	42%	0.415	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.9	103.2	167.7	-63.4	157.1	0	0	0	107.4	T70 R108 A113 F114 F116	T70-I106 HydrophobicContact CG2-CD1 3.17Å; T70-I106 HydrophobicContact CG2-CG1 4.34Å; I106-R108 PolarHBondContact O-N 3.23Å; I106-A113 CarbonylContact O-C 3.54Å; I106-A113 VanDerWaalsContact O-CA 3.27Å; I106-A113 WeakPolarHBondContact O-CA 3.3Å; I106-F114 HydrophobicContact CB-CB 4.41Å; I106-F114 PolarHBondContact N-O 3.23Å; I106-F114 PolarHBondContact O-N 3.04Å; I106-F116 HydrophobicContact CD1-CD2 4.1Å; I106-F116 HydrophobicContact CD1-CE2 3.29Å; I106-F116 HydrophobicContact CD1-CZ 3.92Å; I106-F116 HydrophobicContact CG1-CE2 4.49Å
107	K	39.7	Very low	38.5	Very low	149 Å²	149	78.7 Å²	78.7	65%	0.648	43%	0.43	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-69.7	125.9	171.4	-64.7	-174.5	179	-178.5	0	108.9	L144	K107-L144 HydrophobicContact CG-CD1 4.35Å
108	R	36.8	Very low	39.1	Very low	25 Å²	25	79.5 Å²	79.5	9%	0.094	43%	0.425	C	S	.	.			trans	-89.2	153.4	173.5	-70.7	175.4	166.6	175.1	10.2	110.4	A76 I106 N110 G111 S112 F114	A76-R108 VanDerWaalsContact CB-NH1 3.29Å; I106-R108 PolarHBondContact O-N 3.23Å; R108-N110 WeakPolarHBondContact CB-OD1 3.29Å; R108-N110 PolarHBondContact O-N 3.4Å; R108-N110 VanDerWaalsContact O-N 3.08Å; R108-G111 PolarHBondContact O-N 3.01Å; R108-S112 VanDerWaalsContact CB-O 3.28Å; R108-S112 WeakPolarHBondContact CB-O 3.42Å; R108-S112 WeakPolarHBondContact CD-OG 3.37Å; R108-S112 PolarHBondContact N-O 3.02Å; R108-F114 VanDerWaalsContact NE-CD2 3.34Å
109	P	34.9	Very low	39.7	Very low	141 Å²	141	78.5 Å²	78.5	92%	0.916	42%	0.415	S	S	*	.	T	Hydrogen-bonded Turn	trans	-55.8	-25.2	173.2	-25.5	34.2	0	0	0	114	G111	P109-G111 VanDerWaalsContact C-N 3.28Å; P109-G111 PolarHBondContact O-N 3.35Å
110	N	45.6	Very low	40.2	Very low	117 Å²	117	73.5 Å²	73.5	63%	0.626	40%	0.396	S	S	*	.	T	Hydrogen-bonded Turn	trans	-83.5	7	178.6	73.4	-7.5	0	0	0	114.5	R108 S112	R108-N110 WeakPolarHBondContact CB-OD1 3.29Å; R108-N110 PolarHBondContact O-N 3.4Å; R108-N110 VanDerWaalsContact O-N 3.08Å; N110-S112 PolarHBondContact ND2-OG 3.26Å; N110-S112 PolarHBondContact O-N 3Å; N110-S112 WeakPolarHBondContact OD1-CB 3.37Å; N110-S112 PolarHBondContact OD1-N 2.84Å; N110-S112 PolarHBondContact OD1-OG 3.25Å
111	G	41.8	Very low	40.8	Very low	46 Å²	46	68.1 Å²	68.1	47%	0.474	37%	0.374	S	S	.	.	S	Bend	trans	82	1.3	-179.6	0	0	0	0	0	115.8	R108 P109	R108-G111 PolarHBondContact O-N 3.01Å; P109-G111 VanDerWaalsContact C-N 3.28Å; P109-G111 PolarHBondContact O-N 3.35Å
112	S	39	Very low	41.4	Very low	13 Å²	13	70 Å²	70	9%	0.091	37%	0.366	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.2	154.9	171.4	60.3	0	0	0	0	111.7	R108 N110	R108-S112 VanDerWaalsContact CB-O 3.28Å; R108-S112 WeakPolarHBondContact CB-O 3.42Å; R108-S112 WeakPolarHBondContact CD-OG 3.37Å; R108-S112 PolarHBondContact N-O 3.02Å; N110-S112 PolarHBondContact ND2-OG 3.26Å; N110-S112 PolarHBondContact O-N 3Å; N110-S112 WeakPolarHBondContact OD1-CB 3.37Å; N110-S112 PolarHBondContact OD1-N 2.84Å; N110-S112 PolarHBondContact OD1-OG 3.25Å
113	A	41.2	Very low	41.9	Very low	0 Å²	0	63 Å²	63	0%	0	35%	0.351	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.8	145	175.4	0	0	0	0	0	111.2	I106 V142 L144	I106-A113 CarbonylContact O-C 3.54Å; I106-A113 VanDerWaalsContact O-CA 3.27Å; I106-A113 WeakPolarHBondContact O-CA 3.3Å; A113-V142 HydrophobicContact CB-CB 4.38Å; A113-V142 PolarHBondContact N-O 3.4Å; A113-V142 PolarHBondContact O-N 2.8Å; A113-L144 HydrophobicContact CB-CD1 4.18Å; A113-L144 HydrophobicContact CB-CD2 4.07Å; A113-L144 HydrophobicContact CB-CG 3.9Å
114	F	40.1	Very low	41.7	Very low	9 Å²	9	60.8 Å²	60.8	4%	0.039	35%	0.348	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.1	117	169	-90.3	-106.3	0	0	0	108.3	L73 A76 P77 Q104 E105 I106 R108 E141	L73-F114 HydrophobicContact CD1-CG 4.4Å; A76-F114 HydrophobicContact CB-CZ 4.02Å; P77-F114 HydrophobicContact CG-CD1 4.1Å; P77-F114 HydrophobicContact CG-CE1 3.72Å; Q104-F114 VanDerWaalsContact O-O 3.06Å; E105-F114 CarbonylContact C-O 3.55Å; E105-F114 WeakPolarHBondContact CA-O 3.33Å; I106-F114 HydrophobicContact CB-CB 4.41Å; I106-F114 PolarHBondContact N-O 3.23Å; I106-F114 PolarHBondContact O-N 3.04Å; R108-F114 VanDerWaalsContact NE-CD2 3.34Å; F114-E141 HydrophobicContact CE1-CB 4.36Å; F114-E141 HydrophobicContact CE2-CB 4.16Å; F114-E141 HydrophobicContact CE2-CG 3.85Å; F114-E141 HydrophobicContact CZ-CB 3.8Å; F114-E141 HydrophobicContact CZ-CG 3.9Å
115	S	44	Very low	41.6	Very low	12 Å²	12	63.4 Å²	63.4	8%	0.084	36%	0.357	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.1	124.5	175.1	177.1	0	0	0	0	109.7	Q104 A117 G139 K140	Q104-S115 WeakPolarHBondContact O-CA 3.5Å; S115-A117 PolarHBondContact O-N 3.1Å; S115-G139 CarbonylContact O-C 3.6Å; S115-G139 VanDerWaalsContact O-CA 3.26Å; S115-G139 WeakPolarHBondContact O-CA 3.29Å; S115-K140 PolarHBondContact N-O 3.09Å; S115-K140 VanDerWaalsContact N-O 3.16Å; S115-K140 PolarHBondContact O-N 3.42Å
116	F	45.5	Very low	41.5	Very low	17 Å²	17	60.9 Å²	60.9	8%	0.075	35%	0.351	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.1	101.2	167.4	-61.5	-61.3	0	0	0	109.7	T70 L83 Q104 I106 K118 L137	T70-F116 HydrophobicContact CG2-CE2 4.12Å; T70-F116 HydrophobicContact CG2-CZ 4.23Å; L83-F116 HydrophobicContact CD1-CE1 4.02Å; L83-F116 HydrophobicContact CD1-CZ 3.8Å; Q104-F116 HydrophobicContact CB-CD2 4.38Å; Q104-F116 PolarHBondContact O-N 3.23Å; I106-F116 HydrophobicContact CD1-CD2 4.1Å; I106-F116 HydrophobicContact CD1-CE2 3.29Å; I106-F116 HydrophobicContact CD1-CZ 3.92Å; I106-F116 HydrophobicContact CG1-CE2 4.49Å; F116-K118 VanDerWaalsContact C-N 3.3Å; F116-K118 PolarHBondContact O-N 2.9Å; F116-L137 HydrophobicContact CD1-CB 3.62Å; F116-L137 HydrophobicContact CD1-CD1 4.36Å; F116-L137 HydrophobicContact CD1-CG 4.38Å; F116-L137 HydrophobicContact CE1-CB 3.74Å; F116-L137 HydrophobicContact CE1-CD1 4Å; F116-L137 HydrophobicContact CE1-CG 4.41Å; F116-L137 HydrophobicContact CE2-CD1 4.14Å; F116-L137 HydrophobicContact CG-CB 4.3Å; F116-L137 HydrophobicContact CG-CD2 4.37Å; F116-L137 HydrophobicContact CZ-CB 4.48Å; F116-L137 HydrophobicContact CZ-CD1 3.89Å
117	A	43.7	Very low	41.3	Very low	54 Å²	54	66.9 Å²	66.9	45%	0.446	38%	0.384	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.8	-20.7	-177.7	0	0	0	0	0	113.1	S115 L138	S115-A117 PolarHBondContact O-N 3.1Å; A117-L138 PolarHBondContact N-O 3.2Å
118	K	42.7	Very low	41.2	Very low	114 Å²	114	69.4 Å²	69.4	50%	0.496	39%	0.39	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-153.7	128	-179.8	-164.2	174.4	-175.9	177.1	0	111.4	F116 L138	F116-K118 VanDerWaalsContact C-N 3.3Å; F116-K118 PolarHBondContact O-N 2.9Å; K118-L138 HydrophobicContact CB-CB 4.35Å; K118-L138 HydrophobicContact CB-CD1 4.21Å; K118-L138 HydrophobicContact CD-CD1 4.37Å; K118-L138 PolarHBondContact O-N 3.12Å
119	V	45.3	Very low	41.1	Very low	21 Å²	21	72.5 Å²	72.5	13%	0.127	41%	0.405	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.9	115	165	-167.4	0	0	0	0	107.9	A98 V135 I136 L137	A98-V119 HydrophobicContact CB-CB 3.89Å; A98-V119 HydrophobicContact CB-CG1 3.39Å; A98-V119 HydrophobicContact CB-CG2 4.31Å; V119-V135 HydrophobicContact CG1-CG1 3.36Å; V119-I136 WeakPolarHBondContact CA-O 3.34Å; V119-L137 HydrophobicContact CB-CD2 4.08Å; V119-L137 HydrophobicContact CG1-CD2 3.73Å; V119-L137 HydrophobicContact CG2-CD2 3.5Å
120	T	42	Very low	41.3	Very low	38 Å²	38	66.1 Å²	66.1	23%	0.233	36%	0.363	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.8	124.6	172	-51.3	0	0	0	0	108.3	E122 V135 I136	T120-E122 HydrophobicContact CG2-CG 4.11Å; T120-V135 CarbonylContact O-C 3.57Å; T120-V135 WeakPolarHBondContact O-CA 3.41Å; T120-I136 PolarHBondContact N-O 2.87Å; T120-I136 PolarHBondContact O-N 3.33Å
121	V	45.5	Very low	40.7	Very low	52 Å²	52	64.7 Å²	64.7	32%	0.315	35%	0.353	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.1	108.4	170.7	-175.1	0	0	0	0	107.6	F87 L130 K134 V135	F87-V121 HydrophobicContact CE1-CG1 4.12Å; F87-V121 HydrophobicContact CZ-CG1 4.07Å; V121-L130 HydrophobicContact CG1-CD1 4.28Å; V121-K134 WeakPolarHBondContact CA-O 3.34Å; V121-V135 HydrophobicContact CG2-CG2 4.37Å
122	E	42.8	Very low	40.5	Very low	105 Å²	105	65.7 Å²	65.7	49%	0.491	35%	0.352	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97	123.4	171	-66.1	179.3	160.4	0	0	108.2	T120 G133 K134	T120-E122 HydrophobicContact CG2-CG 4.11Å; E122-G133 CarbonylContact O-C 3.32Å; E122-G133 WeakPolarHBondContact O-CA 3.45Å; E122-K134 HydrophobicContact CB-CB 4.41Å; E122-K134 PolarHBondContact N-O 3.31Å; E122-K134 PolarHBondContact O-N 3.43Å
123	G	44	Very low	40.5	Very low	36 Å²	36	65.7 Å²	65.7	37%	0.371	35%	0.354	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-168.3	153.4	178.9	0	0	0	0	0	111.8	K125 S132	G123-K125 PolarHBondContact O-N 3.15Å; G123-K125 VanDerWaalsContact O-N 3.09Å; G123-S132 WeakPolarHBondContact CA-O 3.43Å
124	A	35.9	Very low	40.4	Very low	64 Å²	64	69 Å²	69	53%	0.529	37%	0.368	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-69	106.5	171.9	0	0	0	0	0	108.2	S132	A124-S132 PolarHBondContact N-O 3.33Å
125	K	40.3	Very low	40.4	Very low	176 Å²	176	69.6 Å²	69.6	77%	0.765	37%	0.373	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-78.4	117.7	168.2	-68	-178.2	179.6	-178.1	0	107.7	G123 L130	G123-K125 PolarHBondContact O-N 3.15Å; G123-K125 VanDerWaalsContact O-N 3.09Å; K125-L130 HydrophobicContact CG-CD2 3.9Å
126	S	37.2	Very low	40.3	Very low	56 Å²	56	70.1 Å²	70.1	39%	0.392	38%	0.375	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.8	128.3	157.4	98.1	0	0	0	0	107.3	R128 Q129 H131	S126-R128 PolarHBondContact O-N 3.29Å; S126-R128 VanDerWaalsContact O-N 3.09Å; S126-Q129 PolarHBondContact N-O 3.17Å; S126-Q129 VanDerWaalsContact N-O 3.12Å; S126-Q129 PolarHBondContact O-N 2.86Å; S126-Q129 VanDerWaalsContact O-O 3.1Å; S126-H131 PolarHBondContact OG-CD2 2.8Å; S126-H131 PolarHBondContact OG-NE2 2.86Å
127	D	38.6	Very low	40.2	Very low	159 Å²	159	70.5 Å²	70.5	85%	0.85	38%	0.377	S	S	*	.	T	Hydrogen-bonded Turn	trans	32.8	65.6	169.5	-63.1	-20.2	0	0	0	115.4	Q129	D127-Q129 PolarHBondContact O-N 2.72Å
128	R	38.9	Very low	40.2	Very low	203 Å²	203	71.1 Å²	71.1	77%	0.766	37%	0.373	S	S	*	.	T	Hydrogen-bonded Turn	trans	68.2	7.6	177.4	-54.6	178	174	156.4	-1.9	116.5	T92 A93 S126	T92-R128 WeakPolarHBondContact CA-O 3.46Å; A93-R128 PolarHBondContact N-O 3.02Å; S126-R128 PolarHBondContact O-N 3.29Å; S126-R128 VanDerWaalsContact O-N 3.09Å
129	Q	34.9	Very low	40.3	Very low	89 Å²	89	66.9 Å²	66.9	42%	0.416	36%	0.362	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.1	135.4	177	-65.4	-177.1	-7.9	0	0	111.5	S126 D127 H131	S126-Q129 PolarHBondContact N-O 3.17Å; S126-Q129 VanDerWaalsContact N-O 3.12Å; S126-Q129 PolarHBondContact O-N 2.86Å; S126-Q129 VanDerWaalsContact O-O 3.1Å; D127-Q129 PolarHBondContact O-N 2.72Å; Q129-H131 PolarHBondContact OE1-CE1 2.93Å; Q129-H131 VanDerWaalsContact OE1-CE1 3.31Å
130	L	38	Very low	40.2	Very low	8 Å²	8	73.2 Å²	73.2	4%	0.042	39%	0.387	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96	104	165.5	-66.9	164.5	0	0	0	107.4	F87 M91 A96 V121 K125	F87-L130 HydrophobicContact CE2-CB 3.75Å; F87-L130 HydrophobicContact CE2-CD1 4.4Å; F87-L130 HydrophobicContact CZ-CB 4.21Å; F87-L130 HydrophobicContact CZ-CD1 4.17Å; M91-L130 HydrophobicContact CB-CB 4.48Å; M91-L130 PolarHBondContact O-N 3Å; A96-L130 HydrophobicContact CB-CD1 3.39Å; V121-L130 HydrophobicContact CG1-CD1 4.28Å; K125-L130 HydrophobicContact CG-CD2 3.9Å
131	H	32.5	Very low	40	Very low	87 Å²	87	76.5 Å²	76.5	40%	0.403	40%	0.4	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.3	-31.4	-179.1	-68.3	-72.4	0	0	0	112.4	S126 Q129	S126-H131 PolarHBondContact OG-CD2 2.8Å; S126-H131 PolarHBondContact OG-NE2 2.86Å; Q129-H131 PolarHBondContact OE1-CE1 2.93Å; Q129-H131 VanDerWaalsContact OE1-CE1 3.31Å
132	S	38.1	Very low	39.6	Very low	66 Å²	66	76.4 Å²	76.4	46%	0.462	40%	0.399	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-161.4	152.6	174	57.7	0	0	0	0	109.1	F87 G123 A124	F87-S132 WeakPolarHBondContact O-CA 3.26Å; G123-S132 WeakPolarHBondContact CA-O 3.43Å; A124-S132 PolarHBondContact N-O 3.33Å
133	G	38.5	Very low	39.2	Very low	13 Å²	13	80.2 Å²	80.2	13%	0.134	41%	0.414	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-172.7	179.1	174.5	0	0	0	0	0	114.1	T86 F87 E122	T86-G133 WeakPolarHBondContact CA-O 3.38Å; F87-G133 VanDerWaalsContact CE1-C 3.4Å; F87-G133 PolarHBondContact N-O 2.79Å; F87-G133 VanDerWaalsContact N-O 3.17Å; F87-G133 PolarHBondContact O-N 3.09Å; E122-G133 CarbonylContact O-C 3.32Å; E122-G133 WeakPolarHBondContact O-CA 3.45Å
134	K	40	Very low	38.7	Very low	69 Å²	69	85.5 Å²	85.5	30%	0.3	43%	0.433	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.3	123.9	-176.4	-172.5	-172.2	179.3	-166.8	0	108.1	I84 V121 E122 I136	I84-K134 HydrophobicContact CG2-CD 4.29Å; I84-K134 HydrophobicContact CG2-CG 3.81Å; V121-K134 WeakPolarHBondContact CA-O 3.34Å; E122-K134 HydrophobicContact CB-CB 4.41Å; E122-K134 PolarHBondContact N-O 3.31Å; E122-K134 PolarHBondContact O-N 3.43Å; K134-I136 HydrophobicContact CD-CD1 4.12Å; K134-I136 HydrophobicContact CD-CG1 3.9Å; K134-I136 HydrophobicContact CG-CG1 4.1Å
135	V	40.8	Very low	38.8	Very low	23 Å²	23	86.6 Å²	86.6	14%	0.139	43%	0.429	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93	121.3	165.6	-173.4	0	0	0	0	107.7	L83 I84 A85 F87 V119 T120 V121 L137	L83-V135 VanDerWaalsContact O-O 3.07Å; I84-V135 WeakPolarHBondContact CA-O 3.49Å; A85-V135 HydrophobicContact CB-CB 4.14Å; A85-V135 HydrophobicContact CB-CG2 4.43Å; A85-V135 PolarHBondContact N-O 2.82Å; A85-V135 PolarHBondContact O-N 3.23Å; F87-V135 HydrophobicContact CD1-CG2 4.21Å; F87-V135 HydrophobicContact CE1-CG2 4.06Å; V119-V135 HydrophobicContact CG1-CG1 3.36Å; T120-V135 CarbonylContact O-C 3.57Å; T120-V135 WeakPolarHBondContact O-CA 3.41Å; V121-V135 HydrophobicContact CG2-CG2 4.37Å; V135-L137 HydrophobicContact CG1-CD2 4.2Å; V135-L137 HydrophobicContact CG1-CG 4.33Å
136	I	40.9	Very low	38.8	Very low	23 Å²	23	81.9 Å²	81.9	12%	0.118	41%	0.411	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104	113.9	172.2	-54.2	177.2	0	0	0	107.4	V119 T120 K134 L138	V119-I136 WeakPolarHBondContact CA-O 3.34Å; T120-I136 PolarHBondContact N-O 2.87Å; T120-I136 PolarHBondContact O-N 3.33Å; K134-I136 HydrophobicContact CD-CD1 4.12Å; K134-I136 HydrophobicContact CD-CG1 3.9Å; K134-I136 HydrophobicContact CG-CG1 4.1Å; I136-L138 HydrophobicContact CG2-CD2 4.27Å; I136-L138 HydrophobicContact CG2-CG 4.35Å
137	L	44	Very low	38.9	Very low	24 Å²	24	83.3 Å²	83.3	13%	0.126	41%	0.412	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.1	113.8	170	-61.1	175.4	0	0	0	109	L83 F116 V119 V135 G139	L83-L137 HydrophobicContact CB-CB 3.93Å; L83-L137 HydrophobicContact CB-CD1 3.74Å; L83-L137 HydrophobicContact CB-CG 4.16Å; L83-L137 HydrophobicContact CD1-CD1 4.12Å; L83-L137 HydrophobicContact CG-CD1 4.46Å; L83-L137 PolarHBondContact O-N 3.09Å; L83-L137 VanDerWaalsContact O-N 3.16Å; F116-L137 HydrophobicContact CD1-CB 3.62Å; F116-L137 HydrophobicContact CD1-CD1 4.36Å; F116-L137 HydrophobicContact CD1-CG 4.38Å; F116-L137 HydrophobicContact CE1-CB 3.74Å; F116-L137 HydrophobicContact CE1-CD1 4Å; F116-L137 HydrophobicContact CE1-CG 4.41Å; F116-L137 HydrophobicContact CE2-CD1 4.14Å; F116-L137 HydrophobicContact CG-CB 4.3Å; F116-L137 HydrophobicContact CG-CD2 4.37Å; F116-L137 HydrophobicContact CZ-CB 4.48Å; F116-L137 HydrophobicContact CZ-CD1 3.89Å; V119-L137 HydrophobicContact CB-CD2 4.08Å; V119-L137 HydrophobicContact CG1-CD2 3.73Å; V119-L137 HydrophobicContact CG2-CD2 3.5Å; V135-L137 HydrophobicContact CG1-CD2 4.2Å; V135-L137 HydrophobicContact CG1-CG 4.33Å; L137-G139 PolarHBondContact O-N 3.46Å
138	L	42.6	Very low	38.9	Very low	68 Å²	68	78.9 Å²	78.9	36%	0.356	39%	0.386	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.7	97	171.6	-66.5	175.9	0	0	0	109	H82 A117 K118 I136	H82-L138 WeakPolarHBondContact CE1-CD2 3.19Å; H82-L138 VanDerWaalsContact ND1-CD2 3.29Å; H82-L138 WeakPolarHBondContact ND1-CD2 2.93Å; A117-L138 PolarHBondContact N-O 3.2Å; K118-L138 HydrophobicContact CB-CB 4.35Å; K118-L138 HydrophobicContact CB-CD1 4.21Å; K118-L138 HydrophobicContact CD-CD1 4.37Å; K118-L138 PolarHBondContact O-N 3.12Å; I136-L138 HydrophobicContact CG2-CD2 4.27Å; I136-L138 HydrophobicContact CG2-CG 4.35Å
139	G	45.8	Very low	38.9	Very low	25 Å²	25	71.1 Å²	71.1	26%	0.258	36%	0.362	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.3	142.9	175.3	0	0	0	0	0	112.4	S115 L137	S115-G139 CarbonylContact O-C 3.6Å; S115-G139 VanDerWaalsContact O-CA 3.26Å; S115-G139 WeakPolarHBondContact O-CA 3.29Å; L137-G139 PolarHBondContact O-N 3.46Å
140	K	41.9	Very low	39.1	Very low	153 Å²	153	69.9 Å²	69.9	67%	0.665	36%	0.359	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-114.4	141.2	157	-70.1	-176.2	179.3	-179.7	0	108.5	S115 V142	S115-K140 PolarHBondContact N-O 3.09Å; S115-K140 VanDerWaalsContact N-O 3.16Å; S115-K140 PolarHBondContact O-N 3.42Å; K140-V142 PolarHBondContact O-N 3.09Å
141	E	39.8	Very low	39.2	Very low	108 Å²	108	74.4 Å²	74.4	51%	0.505	38%	0.381	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-67.7	128.3	165.8	-175.5	171.4	-164.4	0	0	108.3	F114	F114-E141 HydrophobicContact CE1-CB 4.36Å; F114-E141 HydrophobicContact CE2-CB 4.16Å; F114-E141 HydrophobicContact CE2-CG 3.85Å; F114-E141 HydrophobicContact CZ-CB 3.8Å; F114-E141 HydrophobicContact CZ-CG 3.9Å
142	V	37.2	Very low	39.7	Very low	49 Å²	49	73.4 Å²	73.4	30%	0.297	38%	0.38	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.4	120.3	175.6	-172.2	0	0	0	0	106.8	A113 K140	A113-V142 HydrophobicContact CB-CB 4.38Å; A113-V142 PolarHBondContact N-O 3.4Å; A113-V142 PolarHBondContact O-N 2.8Å; K140-V142 PolarHBondContact O-N 3.09Å
143	K	34.3	Very low	39.9	Very low	186 Å²	186	74 Å²	74	81%	0.809	37%	0.373	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-75.9	124.3	163.6	-76	-175	176.5	-178.5	0	107.3
144	L	32.9	Very low	40	Very low	147 Å²	147	79.5 Å²	79.5	77%	0.77	40%	0.395	S	S	*	.			trans	-71.7	0	165.4	-67.2	174.7	0	0	0	109.8	K107 A113	K107-L144 HydrophobicContact CG-CD1 4.35Å; A113-L144 HydrophobicContact CB-CD1 4.18Å; A113-L144 HydrophobicContact CB-CD2 4.07Å; A113-L144 HydrophobicContact CB-CG 3.9Å

Retrieved 144 of 144 residues in 127.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).