A0A077Z5S0_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077Z5S0, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 130 aa.

						>A0A077Z5S0_TRITR|A0A077Z5S0
MIVSVVLASASVVGYLVARRLFVAADSGCLWGILKGGKMTQLSDSSCGSTADLGCLWGILKGGKMAQLSDSSCGTTADSACLSGISKGTFHFFISIKRYHHSNAQTTRNRYSVGKNEQLHMEQARRVLGV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	43.9	Very low	31.4	Very low	217 Å²	217	102.3 Å²	102.3	100%	1.069	62%	0.621	S	S	*	*				0	-16.2	0	-66.2	174.7	82	0	0	114.4
2	I	30.2	Very low	31.9	Very low	142 Å²	142	101 Å²	101	73%	0.728	61%	0.613	S	S	*	*	H	α-helix	trans	-75.1	-33.2	-176	-66.4	159.8	0	0	0	113.5	S4 V5 V6	I2-S4 VanDerWaalsContact C-N 3.31Å; I2-S4 PolarHBondContact O-N 3.27Å; I2-V5 PolarHBondContact O-N 3.38Å; I2-V6 HydrophobicContact CG2-CG2 4.48Å; I2-V6 WeakPolarHBondContact O-CG2 3.33Å; I2-V6 PolarHBondContact O-N 3.01Å
3	V	26.6	Very low	32.6	Very low	113 Å²	113	100 Å²	100	69%	0.685	61%	0.607	S	S	*	*	H	α-helix	trans	-65.1	-32.7	-175.5	-176.5	0	0	0	0	112.6	L7	V3-L7 PolarHBondContact O-N 3.37Å
4	S	27.5	Very low	33	Very low	90 Å²	90	95.6 Å²	95.6	63%	0.629	59%	0.592	S	S	*	*	H	α-helix	trans	-72.4	-31.8	-179.2	-49.6	0	0	0	0	113	I2 A8	I2-S4 VanDerWaalsContact C-N 3.31Å; I2-S4 PolarHBondContact O-N 3.27Å; S4-A8 PolarHBondContact O-N 3.45Å
5	V	29.3	Very low	33.2	Very low	101 Å²	101	99.5 Å²	99.5	61%	0.612	59%	0.593	S	S	*	*	H	α-helix	trans	-75.9	-36.4	-179.7	-179.7	0	0	0	0	111	I2 L7 A8 S9	I2-V5 PolarHBondContact O-N 3.38Å; V5-L7 VanDerWaalsContact C-N 3.35Å; V5-A8 PolarHBondContact O-N 3.41Å; V5-S9 PolarHBondContact O-N 2.97Å; V5-S9 VanDerWaalsContact O-N 3.15Å; V5-S9 PolarHBondContact O-OG 3.29Å; V5-S9 VanDerWaalsContact O-OG 3.06Å
6	V	28.9	Very low	33.7	Very low	89 Å²	89	98.8 Å²	98.8	54%	0.539	59%	0.585	S	S	.	*	H	α-helix	trans	-69	-33.6	177	179.1	0	0	0	0	111.7	I2 S9 A10	I2-V6 HydrophobicContact CG2-CG2 4.48Å; I2-V6 WeakPolarHBondContact O-CG2 3.33Å; I2-V6 PolarHBondContact O-N 3.01Å; V6-S9 PolarHBondContact O-OG 3.04Å; V6-S9 VanDerWaalsContact O-OG 3.11Å; V6-A10 WeakPolarHBondContact O-CB 3.34Å; V6-A10 PolarHBondContact O-N 3.43Å
7	L	29.5	Very low	34.3	Very low	108 Å²	108	95.2 Å²	95.2	57%	0.565	56%	0.564	S	S	*	*	H	α-helix	trans	-73.6	-35.8	176.1	-117.9	74.1	0	0	0	112.7	V3 V5 S11	V3-L7 PolarHBondContact O-N 3.37Å; V5-L7 VanDerWaalsContact C-N 3.35Å; L7-S11 PolarHBondContact O-N 2.93Å; L7-S11 VanDerWaalsContact O-N 3.13Å
8	A	28.2	Very low	34.5	Very low	58 Å²	58	93.1 Å²	93.1	48%	0.479	56%	0.559	S	S	.	*	H	α-helix	trans	-68.4	-42.6	177.8	0	0	0	0	0	111.9	S4 V5 S11 V12	S4-A8 PolarHBondContact O-N 3.45Å; V5-A8 PolarHBondContact O-N 3.41Å; A8-S11 WeakPolarHBondContact O-CB 3.34Å; A8-S11 PolarHBondContact O-N 2.91Å; A8-V12 WeakPolarHBondContact O-CG2 3.23Å; A8-V12 PolarHBondContact O-N 3.43Å; A8-V12 VanDerWaalsContact O-N 3.12Å
9	S	31.7	Very low	34.6	Very low	64 Å²	64	96.8 Å²	96.8	45%	0.448	56%	0.562	S	S	.	*	H	α-helix	trans	-67.7	-37	176.6	52.6	0	0	0	0	112.3	V5 V6 S11 V12 V13	V5-S9 PolarHBondContact O-N 2.97Å; V5-S9 VanDerWaalsContact O-N 3.15Å; V5-S9 PolarHBondContact O-OG 3.29Å; V5-S9 VanDerWaalsContact O-OG 3.06Å; V6-S9 PolarHBondContact O-OG 3.04Å; V6-S9 VanDerWaalsContact O-OG 3.11Å; S9-S11 VanDerWaalsContact C-N 3.28Å; S9-S11 PolarHBondContact O-N 2.88Å; S9-V12 PolarHBondContact O-N 2.85Å; S9-V13 WeakPolarHBondContact O-CB 3.31Å; S9-V13 WeakPolarHBondContact O-CG2 3.32Å; S9-V13 PolarHBondContact O-N 3.34Å
10	A	32.7	Very low	34.7	Very low	62 Å²	62	101 Å²	101	51%	0.512	57%	0.568	S	S	.	*	H	α-helix	trans	-62.7	-34	172	0	0	0	0	0	112.9	V6 G14	V6-A10 WeakPolarHBondContact O-CB 3.34Å; V6-A10 PolarHBondContact O-N 3.43Å; A10-G14 PolarHBondContact O-N 2.96Å
11	S	37.1	Very low	34.7	Very low	81 Å²	81	97.8 Å²	97.8	57%	0.566	55%	0.549	S	S	*	.	H	α-helix	trans	-70.8	-39.7	177.3	-170.4	0	0	0	0	112.6	L7 A8 S9 Y15	L7-S11 PolarHBondContact O-N 2.93Å; L7-S11 VanDerWaalsContact O-N 3.13Å; A8-S11 WeakPolarHBondContact O-CB 3.34Å; A8-S11 PolarHBondContact O-N 2.91Å; S9-S11 VanDerWaalsContact C-N 3.28Å; S9-S11 PolarHBondContact O-N 2.88Å; S11-Y15 WeakPolarHBondContact O-CB 3.39Å; S11-Y15 PolarHBondContact O-N 2.93Å
12	V	37.4	Very low	34.2	Very low	87 Å²	87	95.6 Å²	95.6	53%	0.527	53%	0.534	S	S	.	.	H	α-helix	trans	-71	-44.5	177.6	175.7	0	0	0	0	110.3	A8 S9 G14 Y15 L16	A8-V12 WeakPolarHBondContact O-CG2 3.23Å; A8-V12 PolarHBondContact O-N 3.43Å; A8-V12 VanDerWaalsContact O-N 3.12Å; S9-V12 PolarHBondContact O-N 2.85Å; V12-G14 PolarHBondContact O-N 3.5Å; V12-Y15 PolarHBondContact O-N 3.42Å; V12-L16 HydrophobicContact CG1-CD1 3.62Å; V12-L16 WeakPolarHBondContact O-CD1 3.43Å; V12-L16 PolarHBondContact O-N 2.94Å
13	V	40.6	Very low	34.1	Very low	88 Å²	88	93.9 Å²	93.9	53%	0.533	53%	0.53	S	S	.	.	H	α-helix	trans	-61.7	-44.8	177.2	173.4	0	0	0	0	110.8	S9 Y15 L16 V17	S9-V13 WeakPolarHBondContact O-CB 3.31Å; S9-V13 WeakPolarHBondContact O-CG2 3.32Å; S9-V13 PolarHBondContact O-N 3.34Å; V13-Y15 VanDerWaalsContact C-N 3.31Å; V13-Y15 PolarHBondContact O-N 3.43Å; V13-L16 PolarHBondContact O-N 2.86Å; V13-V17 HydrophobicContact CG1-CG2 4.21Å; V13-V17 VanDerWaalsContact O-CB 3.28Å; V13-V17 WeakPolarHBondContact O-CB 3.44Å; V13-V17 WeakPolarHBondContact O-CG2 3.45Å; V13-V17 PolarHBondContact O-N 2.86Å
14	G	38.3	Very low	34.4	Very low	38 Å²	38	89.3 Å²	89.3	39%	0.392	50%	0.504	S	S	.	.	H	α-helix	trans	-61	-37.8	176.6	0	0	0	0	0	113.5	A10 V12 A18	A10-G14 PolarHBondContact O-N 2.96Å; V12-G14 PolarHBondContact O-N 3.5Å; G14-A18 WeakPolarHBondContact O-CB 3.33Å; G14-A18 PolarHBondContact O-N 3.11Å
15	Y	36.9	Very low	34.6	Very low	154 Å²	154	87.8 Å²	87.8	60%	0.604	50%	0.497	S	S	*	.	H	α-helix	trans	-70.8	-41.3	178.3	-165.4	-96.8	0	0	0	112.7	S11 V12 V13 R19	S11-Y15 WeakPolarHBondContact O-CB 3.39Å; S11-Y15 PolarHBondContact O-N 2.93Å; V12-Y15 PolarHBondContact O-N 3.42Å; V13-Y15 VanDerWaalsContact C-N 3.31Å; V13-Y15 PolarHBondContact O-N 3.43Å; Y15-R19 HydrophobicContact CE1-CG 4.31Å; Y15-R19 WeakPolarHBondContact O-CB 3.44Å; Y15-R19 PolarHBondContact O-N 2.93Å
16	L	40.6	Very low	34.7	Very low	89 Å²	89	90.2 Å²	90.2	47%	0.466	51%	0.507	S	S	.	.	H	α-helix	trans	-64.9	-40.2	173.5	-93.3	126.1	0	0	0	111.9	V12 V13 R20	V12-L16 HydrophobicContact CG1-CD1 3.62Å; V12-L16 WeakPolarHBondContact O-CD1 3.43Å; V12-L16 PolarHBondContact O-N 2.94Å; V13-L16 PolarHBondContact O-N 2.86Å; L16-R20 WeakPolarHBondContact O-CB 3.47Å; L16-R20 VanDerWaalsContact O-CG 3.31Å; L16-R20 WeakPolarHBondContact O-CG 3.37Å; L16-R20 PolarHBondContact O-N 2.81Å
17	V	43	Very low	34.7	Very low	37 Å²	37	89.8 Å²	89.8	22%	0.224	51%	0.508	C	S	.	.	H	α-helix	trans	-64.1	-46.8	176.2	162.3	0	0	0	0	111	V13 R20 L21 I33	V13-V17 HydrophobicContact CG1-CG2 4.21Å; V13-V17 VanDerWaalsContact O-CB 3.28Å; V13-V17 WeakPolarHBondContact O-CB 3.44Å; V13-V17 WeakPolarHBondContact O-CG2 3.45Å; V13-V17 PolarHBondContact O-N 2.86Å; V17-R20 PolarHBondContact O-N 2.96Å; V17-L21 HydrophobicContact CG1-CD1 3.79Å; V17-L21 WeakPolarHBondContact O-CB 3.28Å; V17-L21 WeakPolarHBondContact O-CD1 3.41Å; V17-L21 PolarHBondContact O-N 3.45Å; V17-I33 HydrophobicContact CB-CD1 4.13Å; V17-I33 HydrophobicContact CG1-CB 4.09Å; V17-I33 HydrophobicContact CG1-CD1 3.86Å; V17-I33 HydrophobicContact CG1-CG1 4.39Å; V17-I33 HydrophobicContact CG1-CG2 4.26Å; V17-I33 HydrophobicContact CG2-CD1 3.77Å; V17-I33 HydrophobicContact CG2-CG2 3.9Å
18	A	38.1	Very low	34.9	Very low	58 Å²	58	87.8 Å²	87.8	48%	0.479	51%	0.513	S	S	.	.	H	α-helix	trans	-65.2	-41.3	177.9	0	0	0	0	0	112.5	G14 L21 F22	G14-A18 WeakPolarHBondContact O-CB 3.33Å; G14-A18 PolarHBondContact O-N 3.11Å; A18-L21 PolarHBondContact O-N 3.13Å; A18-F22 WeakPolarHBondContact O-CB 3.39Å; A18-F22 PolarHBondContact O-N 3.43Å
19	R	36.1	Very low	35	Very low	164 Å²	164	87.5 Å²	87.5	62%	0.619	51%	0.506	S	S	*	.	H	α-helix	trans	-63.9	-40.4	174.2	-90.4	-172.7	153.8	-144.4	-5.8	112.5	Y15 F22 V23	Y15-R19 HydrophobicContact CE1-CG 4.31Å; Y15-R19 WeakPolarHBondContact O-CB 3.44Å; Y15-R19 PolarHBondContact O-N 2.93Å; R19-F22 PolarHBondContact O-N 3.2Å; R19-V23 WeakPolarHBondContact O-CG2 3.43Å; R19-V23 PolarHBondContact O-N 3.34Å; R19-V23 VanDerWaalsContact O-N 3.09Å
20	R	36.8	Very low	35.1	Very low	180 Å²	180	86.5 Å²	86.5	68%	0.679	50%	0.496	S	S	*	.	H	α-helix	trans	-71.7	-35.6	177.9	-75	-174.5	171.8	-171.9	-2.1	112.3	L16 V17 F22 V23 A24	L16-R20 WeakPolarHBondContact O-CB 3.47Å; L16-R20 VanDerWaalsContact O-CG 3.31Å; L16-R20 WeakPolarHBondContact O-CG 3.37Å; L16-R20 PolarHBondContact O-N 2.81Å; V17-R20 PolarHBondContact O-N 2.96Å; R20-F22 VanDerWaalsContact C-N 3.32Å; R20-V23 PolarHBondContact O-N 3.26Å; R20-A24 VanDerWaalsContact O-CB 3.25Å; R20-A24 WeakPolarHBondContact O-CB 3.18Å; R20-A24 PolarHBondContact O-N 3.31Å
21	L	36	Very low	35.1	Very low	34 Å²	34	89.3 Å²	89.3	18%	0.178	49%	0.493	C	S	.	.	H	α-helix	trans	-63.5	-37.8	170.5	-105.3	113.6	0	0	0	112.2	V17 A18 A24 A25 L30 I33 W57	V17-L21 HydrophobicContact CG1-CD1 3.79Å; V17-L21 WeakPolarHBondContact O-CB 3.28Å; V17-L21 WeakPolarHBondContact O-CD1 3.41Å; V17-L21 PolarHBondContact O-N 3.45Å; A18-L21 PolarHBondContact O-N 3.13Å; L21-A24 PolarHBondContact O-N 3.43Å; L21-A25 WeakPolarHBondContact O-CB 3.45Å; L21-A25 PolarHBondContact O-N 3.23Å; L21-L30 HydrophobicContact CD2-CD2 3.82Å; L21-L30 HydrophobicContact CD2-CG 4.41Å; L21-I33 HydrophobicContact CD1-CD1 4.36Å; L21-I33 HydrophobicContact CD1-CG1 4.37Å; L21-W57 HydrophobicContact CD2-CZ2 4.46Å
22	F	32.1	Very low	35	Very low	170 Å²	170	87.7 Å²	87.7	75%	0.746	49%	0.49	S	S	*	.	H	α-helix	trans	-69.2	-39.4	178.6	-168.9	-96.9	0	0	0	112.4	A18 R19 R20	A18-F22 WeakPolarHBondContact O-CB 3.39Å; A18-F22 PolarHBondContact O-N 3.43Å; R19-F22 PolarHBondContact O-N 3.2Å; R20-F22 VanDerWaalsContact C-N 3.32Å
23	V	29.8	Very low	34.8	Very low	106 Å²	106	86.5 Å²	86.5	64%	0.642	48%	0.48	S	S	*	.	H	α-helix	trans	-70.1	-32.9	175.7	173.9	0	0	0	0	111.8	R19 R20 D26	R19-V23 WeakPolarHBondContact O-CG2 3.43Å; R19-V23 PolarHBondContact O-N 3.34Å; R19-V23 VanDerWaalsContact O-N 3.09Å; R20-V23 PolarHBondContact O-N 3.26Å; V23-D26 PolarHBondContact O-N 3.38Å
24	A	31.8	Very low	34.4	Very low	18 Å²	18	87 Å²	87	15%	0.149	48%	0.479	C	S	.	.	H	α-helix	trans	-76.6	-26.4	178.8	0	0	0	0	0	113.4	R20 L21 D26 S27 C29	R20-A24 VanDerWaalsContact O-CB 3.25Å; R20-A24 WeakPolarHBondContact O-CB 3.18Å; R20-A24 PolarHBondContact O-N 3.31Å; L21-A24 PolarHBondContact O-N 3.43Å; A24-D26 VanDerWaalsContact C-N 3.3Å; A24-S27 PolarHBondContact O-N 2.92Å; A24-S27 PolarHBondContact O-OG 3.19Å; A24-C29 WeakPolarHBondContact CB-O 3.45Å; A24-C29 CarbonylContact O-C 3.57Å; A24-C29 PolarHBondContact O-N 3.13Å
25	A	31.8	Very low	34	Very low	57 Å²	57	95.3 Å²	95.3	47%	0.471	50%	0.504	S	S	.	.	H	α-helix	trans	-69.6	-27.1	173.4	0	0	0	0	0	112.9	L21 S27 L30	L21-A25 WeakPolarHBondContact O-CB 3.45Å; L21-A25 PolarHBondContact O-N 3.23Å; A25-S27 VanDerWaalsContact C-N 3.32Å; A25-L30 HydrophobicContact CB-CD1 3.67Å
26	D	32.4	Very low	33.6	Very low	153 Å²	153	90.7 Å²	90.7	82%	0.818	50%	0.504	S	S	*	.	H	α-helix	trans	-77.4	-20.1	177.8	-154.1	65.7	0	0	0	112.2	V23 A24	V23-D26 PolarHBondContact O-N 3.38Å; A24-D26 VanDerWaalsContact C-N 3.3Å
27	S	27.9	Very low	32.9	Very low	80 Å²	80	90.5 Å²	90.5	56%	0.559	52%	0.523	S	S	*	.	T	Hydrogen-bonded Turn	trans	-110.1	17.8	-178.9	66.3	0	0	0	0	114.6	A24 A25 C29	A24-S27 PolarHBondContact O-N 2.92Å; A24-S27 PolarHBondContact O-OG 3.19Å; A25-S27 VanDerWaalsContact C-N 3.32Å; S27-C29 PolarHBondContact O-N 3.32Å; S27-C29 VanDerWaalsContact O-N 3.12Å
28	G	33.2	Very low	32.1	Very low	65 Å²	65	97.1 Å²	97.1	67%	0.67	55%	0.549	S	S	*	.	T	Hydrogen-bonded Turn	trans	69.4	6.2	173.9	0	0	0	0	0	116.1
29	C	30.9	Very low	31.6	Very low	52 Å²	52	101 Å²	101	35%	0.351	56%	0.558	S	S	.	*			trans	-123.8	82.8	-174.3	-64.8	0	0	0	0	110.2	A24 S27 W31	A24-C29 WeakPolarHBondContact CB-O 3.45Å; A24-C29 CarbonylContact O-C 3.57Å; A24-C29 PolarHBondContact O-N 3.13Å; S27-C29 PolarHBondContact O-N 3.32Å; S27-C29 VanDerWaalsContact O-N 3.12Å; C29-W31 PolarHBondContact O-N 2.97Å
30	L	34	Very low	31.4	Very low	43 Å²	43	99 Å²	99	23%	0.225	57%	0.565	C	S	.	*			trans	-84.9	108.1	-175.6	-149.5	121	0	0	0	112.7	L21 A25 L56 W57	L21-L30 HydrophobicContact CD2-CD2 3.82Å; L21-L30 HydrophobicContact CD2-CG 4.41Å; A25-L30 HydrophobicContact CB-CD1 3.67Å; L30-L56 HydrophobicContact CB-CD1 4.45Å; L30-L56 HydrophobicContact CD1-CD1 3.88Å; L30-L56 HydrophobicContact CD1-CD2 4.27Å; L30-L56 HydrophobicContact CD1-CG 4.13Å; L30-L56 HydrophobicContact CD2-CD1 4.46Å; L30-L56 HydrophobicContact CD2-CD2 4Å; L30-L56 HydrophobicContact CD2-CG 3.82Å; L30-L56 HydrophobicContact CG-CD1 4.46Å; L30-L56 HydrophobicContact CG-CG 4.34Å; L30-W57 HydrophobicContact CD2-CG 4.16Å
31	W	33.1	Very low	31.2	Very low	121 Å²	121	97.9 Å²	97.9	46%	0.458	57%	0.568	S	S	.	*			trans	-83.9	131.2	176.4	-81.8	52.6	0	0	0	112.4	C29 M39	C29-W31 PolarHBondContact O-N 2.97Å; W31-M39 HydrophobicContact CE3-CE 3.71Å; W31-M39 HydrophobicContact CZ3-CE 3.62Å; W31-M39 HydrophobicContact CZ3-CG 4.05Å; W31-M39 HydrophobicContact CZ3-SD 3.89Å
32	G	33.9	Very low	30.9	Very low	48 Å²	48	103.8 Å²	103.8	50%	0.495	60%	0.598	S	S	.	*			trans	-84.8	128.4	172.2	0	0	0	0	0	112.5
33	I	34.6	Very low	30.7	Very low	62 Å²	62	100.2 Å²	100.2	32%	0.318	60%	0.595	S	S	.	*			trans	-103.6	89.6	179.1	-61.9	-172.1	0	0	0	110.5	V17 L21 I59	V17-I33 HydrophobicContact CB-CD1 4.13Å; V17-I33 HydrophobicContact CG1-CB 4.09Å; V17-I33 HydrophobicContact CG1-CD1 3.86Å; V17-I33 HydrophobicContact CG1-CG1 4.39Å; V17-I33 HydrophobicContact CG1-CG2 4.26Å; V17-I33 HydrophobicContact CG2-CD1 3.77Å; V17-I33 HydrophobicContact CG2-CG2 3.9Å; L21-I33 HydrophobicContact CD1-CD1 4.36Å; L21-I33 HydrophobicContact CD1-CG1 4.37Å; I33-I59 WeakPolarHBondContact O-CD1 3.25Å
34	L	31.6	Very low	30.7	Very low	97 Å²	97	101.4 Å²	101.4	51%	0.508	60%	0.597	S	S	.	*			trans	-66.7	129	176.7	-144.2	84.8	0	0	0	111.2	G36 I59 M65	L34-G36 PolarHBondContact O-N 3.38Å; L34-I59 HydrophobicContact CD1-CD1 4.4Å; L34-M65 HydrophobicContact CD1-CE 3.7Å; L34-M65 HydrophobicContact CD1-SD 4.48Å
35	K	29.9	Very low	30.4	Very low	213 Å²	213	105.8 Å²	105.8	93%	0.926	63%	0.627	S	S	*	*	S	Bend	trans	-72.1	90.4	170.8	-157.3	-167.8	-170.3	-168.8	0	108.8
36	G	29.2	Very low	30.2	Very low	58 Å²	58	108 Å²	108	60%	0.598	64%	0.638	S	S	*	*	S	Bend	trans	132.3	81.5	174.3	0	0	0	0	0	114.5	L34 K38	L34-G36 PolarHBondContact O-N 3.38Å; G36-K38 PolarHBondContact O-N 3.1Å
37	G	25.3	Very low	30	Very low	84 Å²	84	105.6 Å²	105.6	87%	0.866	63%	0.633	S	S	*	*	S	Bend	trans	71.1	3.8	139.8	0	0	0	0	0	121.3
38	K	25.9	Very low	29.8	Very low	176 Å²	176	104.6 Å²	104.6	77%	0.765	64%	0.635	S	S	*	*			trans	-143.6	108	169	-80.4	-173.9	174.5	175.2	0	111.7	G36 T40	G36-K38 PolarHBondContact O-N 3.1Å; K38-T40 PolarHBondContact O-N 3.01Å
39	M	28.3	Very low	29.4	Very low	139 Å²	139	106.3 Å²	106.3	69%	0.685	64%	0.637	S	S	*	*			trans	-83.5	94.1	166.4	-140.1	169.5	-156.6	0	0	105.8	W31 Q41	W31-M39 HydrophobicContact CE3-CE 3.71Å; W31-M39 HydrophobicContact CZ3-CE 3.62Å; W31-M39 HydrophobicContact CZ3-CG 4.05Å; W31-M39 HydrophobicContact CZ3-SD 3.89Å; M39-Q41 PolarHBondContact O-N 2.87Å
40	T	30.9	Very low	29	Very low	124 Å²	124	110.4 Å²	110.4	76%	0.761	66%	0.66	S	S	*	*			trans	-73	106.2	166.7	-1.1	0	0	0	0	106	K38 L42	K38-T40 PolarHBondContact O-N 3.01Å; T40-L42 PolarHBondContact O-N 3.41Å
41	Q	32.4	Very low	28.6	Very low	156 Å²	156	113 Å²	113	73%	0.729	69%	0.688	S	S	*	*			trans	-52.8	108	162.2	-83.7	177.1	-27.3	0	0	106.8	M39 S43	M39-Q41 PolarHBondContact O-N 2.87Å; Q41-S43 VanDerWaalsContact C-N 3.35Å; Q41-S43 PolarHBondContact O-N 2.98Å
42	L	29.3	Very low	28.4	Very low	158 Å²	158	113.8 Å²	113.8	83%	0.827	70%	0.701	S	S	*	*			trans	-77.3	101	159.1	-84.5	156.6	0	0	0	104.2	T40 D44	T40-L42 PolarHBondContact O-N 3.41Å; L42-D44 PolarHBondContact O-N 3.35Å; L42-D44 VanDerWaalsContact O-N 3.14Å
43	S	29.5	Very low	28.1	Very low	95 Å²	95	120.4 Å²	120.4	66%	0.664	72%	0.724	S	S	*	*			trans	-54.3	117.2	-176.9	-70.5	0	0	0	0	110.5	Q41 S45	Q41-S43 VanDerWaalsContact C-N 3.35Å; Q41-S43 PolarHBondContact O-N 2.98Å; S43-S45 PolarHBondContact O-N 2.97Å; S43-S45 VanDerWaalsContact O-N 3.08Å; S43-S45 PolarHBondContact O-OG 2.72Å
44	D	28.2	Very low	27.8	Very low	131 Å²	131	119.3 Å²	119.3	70%	0.701	73%	0.728	S	S	*	*			trans	-39.8	111.1	160.1	-64.4	-48.4	0	0	0	109.8	L42	L42-D44 PolarHBondContact O-N 3.35Å; L42-D44 VanDerWaalsContact O-N 3.14Å
45	S	27.1	Very low	27.7	Very low	109 Å²	109	119 Å²	119	76%	0.762	73%	0.733	S	S	*	*			trans	-149.3	4.6	171.2	43	0	0	0	0	116.4	S43	S43-S45 PolarHBondContact O-N 2.97Å; S43-S45 VanDerWaalsContact O-N 3.08Å; S43-S45 PolarHBondContact O-OG 2.72Å
46	S	27.8	Very low	27.8	Very low	103 Å²	103	115.2 Å²	115.2	72%	0.72	72%	0.722	S	S	*	*			trans	-152.9	15.8	178.2	53.1	0	0	0	0	117.5	G48	S46-G48 PolarHBondContact O-N 3.44Å
47	C	27	Very low	28	Very low	104 Å²	104	118.2 Å²	118.2	70%	0.703	72%	0.715	S	S	*	*			trans	-81.1	54.5	177	-37.9	0	0	0	0	111.3	S49	C47-S49 PolarHBondContact O-N 3.08Å
48	G	24	Very low	28.2	Very low	58 Å²	58	115.7 Å²	115.7	60%	0.598	69%	0.689	S	S	*	*			trans	-80.6	113.9	176.3	0	0	0	0	0	109.8	S46	S46-G48 PolarHBondContact O-N 3.44Å
49	S	24.5	Very low	28.5	Very low	102 Å²	102	110 Å²	110	71%	0.713	67%	0.667	S	S	*	*	S	Bend	trans	47.2	119.2	154.9	53.8	0	0	0	0	117.4	C47	C47-S49 PolarHBondContact O-N 3.08Å
50	T	23.5	Very low	28.6	Very low	137 Å²	137	110.1 Å²	110.1	84%	0.84	67%	0.669	S	S	*	*	S	Bend	trans	66.4	109	167.3	43.5	0	0	0	0	116.1
51	A	25.1	Very low	28.6	Very low	97 Å²	97	113.9 Å²	113.9	80%	0.802	68%	0.675	S	S	*	*			trans	61	71.5	152.6	0	0	0	0	0	116.7
52	D	28.9	Very low	28.3	Very low	139 Å²	139	110.3 Å²	110.3	74%	0.743	68%	0.68	S	S	*	*			trans	-121.7	80.6	162.9	-121.7	-24.8	0	0	0	109.3	G54	D52-G54 PolarHBondContact O-N 2.97Å
53	L	27.7	Very low	28.1	Very low	186 Å²	186	106.1 Å²	106.1	97%	0.974	68%	0.676	S	S	*	*			trans	-69.7	25.4	175.3	-85.2	158.8	0	0	0	112.5
54	G	28.4	Very low	27.9	Very low	39 Å²	39	111.5 Å²	111.5	40%	0.402	69%	0.687	S	S	.	*			trans	-98.6	-4.8	-156.1	0	0	0	0	0	117.7	D52	D52-G54 PolarHBondContact O-N 2.97Å
55	C	28.1	Very low	27.9	Very low	90 Å²	90	111.3 Å²	111.3	61%	0.608	68%	0.683	S	S	*	*			trans	-128.3	89.4	-164.8	-60.5	0	0	0	0	113.5
56	L	31.5	Very low	28.2	Very low	134 Å²	134	110.1 Å²	110.1	70%	0.702	68%	0.68	S	S	*	*			trans	-144.7	142.9	165.9	-101.8	106.6	0	0	0	107.9	L30	L30-L56 HydrophobicContact CB-CD1 4.45Å; L30-L56 HydrophobicContact CD1-CD1 3.88Å; L30-L56 HydrophobicContact CD1-CD2 4.27Å; L30-L56 HydrophobicContact CD1-CG 4.13Å; L30-L56 HydrophobicContact CD2-CD1 4.46Å; L30-L56 HydrophobicContact CD2-CD2 4Å; L30-L56 HydrophobicContact CD2-CG 3.82Å; L30-L56 HydrophobicContact CG-CD1 4.46Å; L30-L56 HydrophobicContact CG-CG 4.34Å
57	W	34.6	Very low	28.4	Very low	121 Å²	121	113.7 Å²	113.7	46%	0.458	69%	0.686	S	S	.	*			cis	-176.2	175.5	-3.1	-178.8	67.4	0	0	0	105.3	L21 L30 I59	L21-W57 HydrophobicContact CD2-CZ2 4.46Å; L30-W57 HydrophobicContact CD2-CG 4.16Å; W57-I59 HydrophobicContact CH2-CB 3.82Å; W57-I59 WeakPolarHBondContact CH2-O 3.16Å; W57-I59 HydrophobicContact CZ2-CB 4.07Å; W57-I59 HydrophobicContact CZ2-CG1 4.31Å; W57-I59 HydrophobicContact CZ3-CB 4.31Å; W57-I59 VanDerWaalsContact CZ3-N 3.33Å; W57-I59 WeakPolarHBondContact CZ3-O 3.22Å
58	G	28.8	Very low	28.5	Very low	31 Å²	31	116.8 Å²	116.8	32%	0.32	69%	0.694	S	S	.	*			trans	-164.3	106.7	159.1	0	0	0	0	0	114
59	I	32.1	Very low	28.8	Very low	57 Å²	57	118.3 Å²	118.3	29%	0.292	70%	0.695	S	S	.	*			trans	-149.6	101.8	143.2	-52.3	-177.9	0	0	0	110.3	I33 L34 W57	I33-I59 WeakPolarHBondContact O-CD1 3.25Å; L34-I59 HydrophobicContact CD1-CD1 4.4Å; W57-I59 HydrophobicContact CH2-CB 3.82Å; W57-I59 WeakPolarHBondContact CH2-O 3.16Å; W57-I59 HydrophobicContact CZ2-CB 4.07Å; W57-I59 HydrophobicContact CZ2-CG1 4.31Å; W57-I59 HydrophobicContact CZ3-CB 4.31Å; W57-I59 VanDerWaalsContact CZ3-N 3.33Å; W57-I59 WeakPolarHBondContact CZ3-O 3.22Å
60	L	30.6	Very low	29.1	Very low	141 Å²	141	120.4 Å²	120.4	74%	0.738	70%	0.699	S	S	*	*			trans	-109.5	141.7	160.9	-150.6	79.5	0	0	0	109.5	G62	L60-G62 PolarHBondContact O-N 2.93Å; L60-G62 VanDerWaalsContact O-N 3.12Å
61	K	30.9	Very low	29.3	Very low	203 Å²	203	118.3 Å²	118.3	88%	0.883	69%	0.69	S	S	*	*	S	Bend	trans	-46	116	170.1	-85.4	-171.3	171.7	-176.2	0	110.5
62	G	26.5	Very low	29.4	Very low	81 Å²	81	119.3 Å²	119.3	84%	0.835	69%	0.691	S	S	*	*	S	Bend	trans	69.2	102.9	163	0	0	0	0	0	114.8	L60	L60-G62 PolarHBondContact O-N 2.93Å; L60-G62 VanDerWaalsContact O-N 3.12Å
63	G	24.6	Very low	29.3	Very low	71 Å²	71	118 Å²	118	73%	0.732	69%	0.691	S	S	*	*	S	Bend	trans	118.7	110.3	166.4	0	0	0	0	0	112.8
64	K	25.7	Very low	29.3	Very low	208 Å²	208	111 Å²	111	90%	0.904	67%	0.665	S	S	*	*			trans	33.2	101.1	156.8	-71.2	-179.7	171	-178.9	0	116.8	A66	K64-A66 PolarHBondContact O-N 2.85Å
65	M	29.2	Very low	29.3	Very low	126 Å²	126	115.6 Å²	115.6	62%	0.621	69%	0.685	S	S	*	*			trans	-72.7	112.4	152.7	-70.5	-173.1	-63.1	0	0	107.9	L34 Q67	L34-M65 HydrophobicContact CD1-CE 3.7Å; L34-M65 HydrophobicContact CD1-SD 4.48Å; M65-Q67 PolarHBondContact O-N 2.87Å
66	A	32.1	Very low	29.4	Very low	84 Å²	84	117.6 Å²	117.6	69%	0.694	70%	0.695	S	S	*	*			trans	-70.7	121.8	161.2	0	0	0	0	0	107.1	K64 L68	K64-A66 PolarHBondContact O-N 2.85Å; A66-L68 PolarHBondContact O-N 3.48Å
67	Q	31.8	Very low	29.3	Very low	179 Å²	179	113.6 Å²	113.6	84%	0.836	68%	0.681	S	S	*	*			trans	-58.7	106.2	161.8	-80.5	174.2	-44.5	0	0	107.1	M65 S69	M65-Q67 PolarHBondContact O-N 2.87Å; Q67-S69 VanDerWaalsContact C-N 3.31Å; Q67-S69 PolarHBondContact O-N 3.11Å
68	L	30	Very low	29.3	Very low	169 Å²	169	113.2 Å²	113.2	89%	0.885	69%	0.688	S	S	*	*			trans	-84.1	92.4	157.9	-76.2	164	0	0	0	104.7	A66 D70	A66-L68 PolarHBondContact O-N 3.48Å; L68-D70 PolarHBondContact O-N 2.82Å
69	S	29.7	Very low	29.3	Very low	89 Å²	89	116.7 Å²	116.7	62%	0.622	71%	0.707	S	S	*	*			trans	-60.3	130.7	173.5	-62.1	0	0	0	0	108.9	Q67 S71	Q67-S69 VanDerWaalsContact C-N 3.31Å; Q67-S69 PolarHBondContact O-N 3.11Å; S69-S71 PolarHBondContact O-N 3.46Å
70	D	30.8	Very low	29.1	Very low	147 Å²	147	117.7 Å²	117.7	79%	0.786	72%	0.724	S	S	*	*	S	Bend	trans	-42.5	98.6	166.5	-79.3	-43.3	0	0	0	110.3	L68	L68-D70 PolarHBondContact O-N 2.82Å
71	S	27.7	Very low	29	Very low	92 Å²	92	114.8 Å²	114.8	64%	0.643	71%	0.714	S	S	*	*			trans	-158.2	97.2	173.7	-63.1	0	0	0	0	106.9	S69	S69-S71 PolarHBondContact O-N 3.46Å
72	S	28	Very low	28.9	Very low	118 Å²	118	110.5 Å²	110.5	83%	0.825	70%	0.7	S	S	*	*			trans	63.5	73.3	161.5	55.6	0	0	0	0	117.1	G74	S72-G74 PolarHBondContact O-N 2.84Å
73	C	27	Very low	28.9	Very low	111 Å²	111	109.9 Å²	109.9	75%	0.75	68%	0.683	S	S	*	*			trans	-74.9	62.8	153.8	-49.5	0	0	0	0	109.2	T75	C73-T75 PolarHBondContact O-N 3.42Å
74	G	26.7	Very low	29.2	Very low	41 Å²	41	108.8 Å²	108.8	42%	0.423	67%	0.672	S	S	.	*			trans	-75.6	102.1	177.6	0	0	0	0	0	110.5	S72 T76	S72-G74 PolarHBondContact O-N 2.84Å; G74-T76 PolarHBondContact O-N 3.27Å; G74-T76 PolarHBondContact O-OG1 3.43Å; G74-T76 VanDerWaalsContact O-OG1 3.12Å
75	T	29.7	Very low	29.6	Very low	134 Å²	134	103.3 Å²	103.3	82%	0.822	65%	0.652	S	S	*	*	S	Bend	trans	42.8	4.1	146.6	59.9	0	0	0	0	121.7	C73	C73-T75 PolarHBondContact O-N 3.42Å
76	T	29.8	Very low	29.6	Very low	133 Å²	133	100.3 Å²	100.3	82%	0.816	64%	0.643	S	S	*	*	S	Bend	trans	-139	0.2	-175.4	13.8	0	0	0	0	114.2	G74	G74-T76 PolarHBondContact O-N 3.27Å; G74-T76 PolarHBondContact O-OG1 3.43Å; G74-T76 VanDerWaalsContact O-OG1 3.12Å
77	A	29.5	Very low	29.6	Very low	50 Å²	50	104 Å²	104	41%	0.413	64%	0.644	S	S	.	*			trans	-98.3	2.1	-179.7	0	0	0	0	0	114.6	S79 A80 C81	A77-S79 VanDerWaalsContact C-N 3.28Å; A77-S79 PolarHBondContact O-N 2.91Å; A77-S79 VanDerWaalsContact O-N 3.15Å; A77-A80 PolarHBondContact O-N 3.43Å; A77-C81 PolarHBondContact O-N 3.15Å
78	D	34.2	Very low	29.7	Very low	112 Å²	112	97.7 Å²	97.7	60%	0.599	63%	0.627	S	S	*	*	H	α-helix	trans	-60.2	-30.1	-170.5	-77.2	-22.4	0	0	0	114.1	L82	D78-L82 WeakPolarHBondContact O-CB 3.39Å; D78-L82 WeakPolarHBondContact O-CD1 3.44Å; D78-L82 PolarHBondContact O-N 3.46Å
79	S	28.2	Very low	30	Very low	105 Å²	105	92.7 Å²	92.7	73%	0.734	60%	0.603	S	S	*	*	H	α-helix	trans	-80.5	-33.2	-178.6	-60.1	0	0	0	0	113.6	A77 S83	A77-S79 VanDerWaalsContact C-N 3.28Å; A77-S79 PolarHBondContact O-N 2.91Å; A77-S79 VanDerWaalsContact O-N 3.15Å; S79-S83 WeakPolarHBondContact O-CB 3.14Å; S79-S83 PolarHBondContact O-N 3.45Å; S79-S83 VanDerWaalsContact O-N 3.1Å
80	A	28.1	Very low	30.1	Very low	77 Å²	77	95 Å²	95	64%	0.636	60%	0.602	S	S	*	*	H	α-helix	trans	-78.8	-37.8	-178.1	0	0	0	0	0	111.6	A77 S83 G84	A77-A80 PolarHBondContact O-N 3.43Å; A80-S83 PolarHBondContact O-N 2.84Å; A80-G84 PolarHBondContact O-N 2.95Å
81	C	30	Very low	30.4	Very low	80 Å²	80	94.1 Å²	94.1	54%	0.541	59%	0.593	S	S	.	*	H	α-helix	trans	-65.7	-43	175.3	-72	0	0	0	0	111.3	A77 G84 I85	A77-C81 PolarHBondContact O-N 3.15Å; C81-G84 PolarHBondContact O-N 3.33Å; C81-I85 VanDerWaalsContact O-CD1 3.23Å; C81-I85 WeakPolarHBondContact O-CD1 3.41Å; C81-I85 WeakPolarHBondContact O-CG1 3.45Å; C81-I85 PolarHBondContact O-N 3.37Å
82	L	28.3	Very low	30.8	Very low	113 Å²	113	94.5 Å²	94.5	59%	0.592	58%	0.584	S	S	*	*	H	α-helix	trans	-67.9	-34.4	174.7	-89.8	130.1	0	0	0	113.9	D78 G84 I85 S86	D78-L82 WeakPolarHBondContact O-CB 3.39Å; D78-L82 WeakPolarHBondContact O-CD1 3.44Å; D78-L82 PolarHBondContact O-N 3.46Å; L82-G84 VanDerWaalsContact C-N 3.32Å; L82-G84 PolarHBondContact O-N 2.7Å; L82-I85 PolarHBondContact O-N 3.4Å; L82-S86 PolarHBondContact O-N 2.89Å; L82-S86 VanDerWaalsContact O-N 3.08Å
83	S	26.7	Very low	31.1	Very low	68 Å²	68	95.2 Å²	95.2	48%	0.476	57%	0.572	S	S	.	*	H	α-helix	trans	-69.7	-28.3	178.4	-174.1	0	0	0	0	113.3	S79 A80	S79-S83 WeakPolarHBondContact O-CB 3.14Å; S79-S83 PolarHBondContact O-N 3.45Å; S79-S83 VanDerWaalsContact O-N 3.1Å; A80-S83 PolarHBondContact O-N 2.84Å
84	G	29.8	Very low	31.5	Very low	48 Å²	48	93.8 Å²	93.8	50%	0.495	56%	0.556	S	S	.	*	H	α-helix	trans	-73.8	-37.9	172	0	0	0	0	0	112.5	A80 C81 L82 S86 K87 G88	A80-G84 PolarHBondContact O-N 2.95Å; C81-G84 PolarHBondContact O-N 3.33Å; L82-G84 VanDerWaalsContact C-N 3.32Å; L82-G84 PolarHBondContact O-N 2.7Å; G84-S86 PolarHBondContact O-N 2.88Å; G84-K87 PolarHBondContact O-N 2.86Å; G84-G88 PolarHBondContact O-N 3.31Å; G84-G88 VanDerWaalsContact O-N 3.14Å
85	I	33.7	Very low	32	Very low	94 Å²	94	94.3 Å²	94.3	48%	0.482	55%	0.553	S	S	.	*	H	α-helix	trans	-61.8	-41.3	176.9	-67.4	163.5	0	0	0	110.8	C81 L82 K87 T89	C81-I85 VanDerWaalsContact O-CD1 3.23Å; C81-I85 WeakPolarHBondContact O-CD1 3.41Å; C81-I85 WeakPolarHBondContact O-CG1 3.45Å; C81-I85 PolarHBondContact O-N 3.37Å; L82-I85 PolarHBondContact O-N 3.4Å; I85-K87 PolarHBondContact O-N 3.45Å; I85-T89 WeakPolarHBondContact O-CB 3.26Å; I85-T89 PolarHBondContact O-N 3.31Å; I85-T89 VanDerWaalsContact O-N 3.11Å; I85-T89 PolarHBondContact O-OG1 2.91Å
86	S	30	Very low	32.3	Very low	63 Å²	63	91.5 Å²	91.5	44%	0.441	53%	0.533	S	S	.	.	H	α-helix	trans	-61	-36.8	176.9	166.7	0	0	0	0	113.5	L82 G84 F90	L82-S86 PolarHBondContact O-N 2.89Å; L82-S86 VanDerWaalsContact O-N 3.08Å; G84-S86 PolarHBondContact O-N 2.88Å; S86-F90 WeakPolarHBondContact O-CB 3.17Å; S86-F90 WeakPolarHBondContact O-CD2 3.28Å; S86-F90 WeakPolarHBondContact O-CG 3.34Å
87	K	31.9	Very low	32.5	Very low	161 Å²	161	92.8 Å²	92.8	70%	0.7	53%	0.527	S	S	*	.	H	α-helix	trans	-85.4	-42.2	-176.5	-69	179.1	-178.6	172.5	0	112.7	G84 I85 H91	G84-K87 PolarHBondContact O-N 2.86Å; I85-K87 PolarHBondContact O-N 3.45Å; K87-H91 WeakPolarHBondContact O-CB 3.31Å; K87-H91 PolarHBondContact O-N 3.23Å; K87-H91 VanDerWaalsContact O-N 3.15Å
88	G	33.4	Very low	32.8	Very low	47 Å²	47	99.2 Å²	99.2	49%	0.485	54%	0.54	S	S	.	.	H	α-helix	trans	-70.6	-41.5	-179	0	0	0	0	0	113.3	G84 H91 F92	G84-G88 PolarHBondContact O-N 3.31Å; G84-G88 VanDerWaalsContact O-N 3.14Å; G88-H91 PolarHBondContact O-N 3.13Å; G88-F92 WeakPolarHBondContact O-CB 3.23Å; G88-F92 PolarHBondContact O-N 3.44Å
89	T	36.5	Very low	32.8	Very low	63 Å²	63	101 Å²	101	39%	0.387	54%	0.54	S	S	.	.	H	α-helix	trans	-72.9	-39.2	-176.5	-41.4	0	0	0	0	111.5	I85 F92 F93	I85-T89 WeakPolarHBondContact O-CB 3.26Å; I85-T89 PolarHBondContact O-N 3.31Å; I85-T89 VanDerWaalsContact O-N 3.11Å; I85-T89 PolarHBondContact O-OG1 2.91Å; T89-F92 PolarHBondContact O-N 3.14Å; T89-F93 HydrophobicContact CG2-CD2 4.43Å; T89-F93 PolarHBondContact O-N 3.37Å
90	F	31.4	Very low	33.3	Very low	138 Å²	138	102 Å²	102	61%	0.605	53%	0.533	S	S	*	.	H	α-helix	trans	-66.5	-39.2	173.1	-81.4	-103.8	0	0	0	111.5	S86 F92 F93 I94	S86-F90 WeakPolarHBondContact O-CB 3.17Å; S86-F90 WeakPolarHBondContact O-CD2 3.28Å; S86-F90 WeakPolarHBondContact O-CG 3.34Å; F90-F92 VanDerWaalsContact C-N 3.32Å; F90-F92 PolarHBondContact O-N 3.28Å; F90-F93 PolarHBondContact O-N 3.43Å; F90-I94 WeakPolarHBondContact O-CB 3.47Å; F90-I94 WeakPolarHBondContact O-CD1 2.9Å; F90-I94 WeakPolarHBondContact O-CG1 3.33Å; F90-I94 PolarHBondContact O-N 3.23Å
91	H	37.6	Very low	33.8	Very low	129 Å²	129	104 Å²	104	60%	0.597	53%	0.528	S	S	*	.	H	α-helix	trans	-65.2	-36.3	175.3	-166	-106.3	0	0	0	112.2	K87 G88 S95	K87-H91 WeakPolarHBondContact O-CB 3.31Å; K87-H91 PolarHBondContact O-N 3.23Å; K87-H91 VanDerWaalsContact O-N 3.15Å; G88-H91 PolarHBondContact O-N 3.13Å; H91-S95 WeakPolarHBondContact O-CB 3.47Å; H91-S95 PolarHBondContact O-N 3.25Å; H91-S95 PolarHBondContact O-OG 3.45Å
92	F	36.5	Very low	34.2	Very low	100 Å²	100	103.5 Å²	103.5	44%	0.439	53%	0.526	S	S	.	.	H	α-helix	trans	-68.5	-44.1	174.7	-169.4	-105.6	0	0	0	112.3	G88 T89 F90 S95 I96	G88-F92 WeakPolarHBondContact O-CB 3.23Å; G88-F92 PolarHBondContact O-N 3.44Å; T89-F92 PolarHBondContact O-N 3.14Å; F90-F92 VanDerWaalsContact C-N 3.32Å; F90-F92 PolarHBondContact O-N 3.28Å; F92-S95 PolarHBondContact O-N 3.4Å; F92-I96 HydrophobicContact CD1-CD1 3.59Å; F92-I96 HydrophobicContact CD1-CG1 4.44Å; F92-I96 HydrophobicContact CE1-CD1 3.21Å; F92-I96 HydrophobicContact CE1-CG1 4.27Å; F92-I96 HydrophobicContact CE2-CD1 4.45Å; F92-I96 HydrophobicContact CG-CD1 4.37Å; F92-I96 HydrophobicContact CZ-CD1 3.7Å; F92-I96 HydrophobicContact CZ-CG1 4.45Å; F92-I96 WeakPolarHBondContact O-CG1 3.33Å; F92-I96 PolarHBondContact O-N 3.08Å
93	F	34.3	Very low	34.7	Very low	133 Å²	133	101.7 Å²	101.7	58%	0.583	52%	0.517	S	S	*	.	H	α-helix	trans	-62.8	-42.8	174.9	-106.5	-88.9	0	0	0	112.6	T89 F90 S95 I96 K97	T89-F93 HydrophobicContact CG2-CD2 4.43Å; T89-F93 PolarHBondContact O-N 3.37Å; F90-F93 PolarHBondContact O-N 3.43Å; F93-S95 VanDerWaalsContact C-N 3.33Å; F93-I96 PolarHBondContact O-N 3.29Å; F93-K97 WeakPolarHBondContact O-CB 3.2Å; F93-K97 PolarHBondContact O-N 3.26Å
94	I	35.8	Very low	35.3	Very low	81 Å²	81	100.5 Å²	100.5	42%	0.415	51%	0.511	S	S	.	.	H	α-helix	trans	-65.4	-40	175.1	-68.5	165.2	0	0	0	109.9	F90 K97 R98	F90-I94 WeakPolarHBondContact O-CB 3.47Å; F90-I94 WeakPolarHBondContact O-CD1 2.9Å; F90-I94 WeakPolarHBondContact O-CG1 3.33Å; F90-I94 PolarHBondContact O-N 3.23Å; I94-K97 PolarHBondContact O-N 3.47Å; I94-R98 HydrophobicContact CG2-CG 4.29Å; I94-R98 VanDerWaalsContact O-CB 3.31Å; I94-R98 WeakPolarHBondContact O-CB 3.39Å; I94-R98 VanDerWaalsContact O-CG 3.28Å; I94-R98 WeakPolarHBondContact O-CG 3.43Å; I94-R98 PolarHBondContact O-N 2.59Å
95	S	36.3	Very low	35.8	Very low	52 Å²	52	103 Å²	103	36%	0.364	51%	0.51	S	S	.	.	H	α-helix	trans	-65.5	-41.5	177.6	-65.2	0	0	0	0	112.1	H91 F92 F93 R98 Y99	H91-S95 WeakPolarHBondContact O-CB 3.47Å; H91-S95 PolarHBondContact O-N 3.25Å; H91-S95 PolarHBondContact O-OG 3.45Å; F92-S95 PolarHBondContact O-N 3.4Å; F93-S95 VanDerWaalsContact C-N 3.33Å; S95-R98 PolarHBondContact O-N 3.11Å; S95-Y99 VanDerWaalsContact O-CB 3.23Å; S95-Y99 WeakPolarHBondContact O-CB 3.42Å; S95-Y99 PolarHBondContact O-N 3.31Å
96	I	36.5	Very low	36.3	Very low	75 Å²	75	101 Å²	101	39%	0.385	50%	0.502	S	S	.	.	H	α-helix	trans	-66.3	-45.5	174.8	-70.3	172.8	0	0	0	110.7	F92 F93 R98 Y99 H100	F92-I96 HydrophobicContact CD1-CD1 3.59Å; F92-I96 HydrophobicContact CD1-CG1 4.44Å; F92-I96 HydrophobicContact CE1-CD1 3.21Å; F92-I96 HydrophobicContact CE1-CG1 4.27Å; F92-I96 HydrophobicContact CE2-CD1 4.45Å; F92-I96 HydrophobicContact CG-CD1 4.37Å; F92-I96 HydrophobicContact CZ-CD1 3.7Å; F92-I96 HydrophobicContact CZ-CG1 4.45Å; F92-I96 WeakPolarHBondContact O-CG1 3.33Å; F92-I96 PolarHBondContact O-N 3.08Å; F93-I96 PolarHBondContact O-N 3.29Å; I96-R98 PolarHBondContact O-N 2.97Å; I96-Y99 PolarHBondContact O-N 3.21Å; I96-H100 WeakPolarHBondContact O-CB 3.46Å; I96-H100 PolarHBondContact O-CD2 3.11Å; I96-H100 PolarHBondContact O-N 3.21Å
97	K	34.2	Very low	36.9	Very low	160 Å²	160	101.1 Å²	101.1	70%	0.696	50%	0.5	S	S	*	.	H	α-helix	trans	-62.2	-41.3	176.2	-85.2	-157.6	174.7	-175.4	0	112.1	F93 I94 H100 H101	F93-K97 WeakPolarHBondContact O-CB 3.2Å; F93-K97 PolarHBondContact O-N 3.26Å; I94-K97 PolarHBondContact O-N 3.47Å; K97-H100 PolarHBondContact O-N 3.1Å; K97-H101 VanDerWaalsContact O-CB 3.25Å; K97-H101 WeakPolarHBondContact O-CB 3.42Å; K97-H101 PolarHBondContact O-N 3.06Å
98	R	35.3	Very low	37.2	Very low	184 Å²	184	102.2 Å²	102.2	69%	0.694	50%	0.5	S	S	*	.	H	α-helix	trans	-66.8	-38.7	175.4	-75.6	-175	-171.8	-172.7	4.6	112	I94 S95 I96 H101 S102	I94-R98 HydrophobicContact CG2-CG 4.29Å; I94-R98 VanDerWaalsContact O-CB 3.31Å; I94-R98 WeakPolarHBondContact O-CB 3.39Å; I94-R98 VanDerWaalsContact O-CG 3.28Å; I94-R98 WeakPolarHBondContact O-CG 3.43Å; I94-R98 PolarHBondContact O-N 2.59Å; S95-R98 PolarHBondContact O-N 3.11Å; I96-R98 PolarHBondContact O-N 2.97Å; R98-H101 PolarHBondContact O-N 3.39Å; R98-S102 VanDerWaalsContact O-CB 3.22Å; R98-S102 WeakPolarHBondContact O-CB 3.13Å; R98-S102 PolarHBondContact O-N 3.18Å
99	Y	34.9	Very low	37.7	Very low	150 Å²	150	105.1 Å²	105.1	59%	0.588	50%	0.504	S	S	*	.	H	α-helix	trans	-65	-44.8	175.4	-168	-97.7	0	0	0	111.2	S95 I96 N103	S95-Y99 VanDerWaalsContact O-CB 3.23Å; S95-Y99 WeakPolarHBondContact O-CB 3.42Å; S95-Y99 PolarHBondContact O-N 3.31Å; I96-Y99 PolarHBondContact O-N 3.21Å; Y99-N103 VanDerWaalsContact O-CB 3.26Å; Y99-N103 WeakPolarHBondContact O-CB 3.38Å; Y99-N103 PolarHBondContact O-N 3.37Å
100	H	37.8	Very low	38.3	Very low	127 Å²	127	111 Å²	111	59%	0.588	52%	0.52	S	S	*	.	H	α-helix	trans	-65.2	-40	174.5	-91	-90.8	0	0	0	112.9	I96 K97 A104	I96-H100 WeakPolarHBondContact O-CB 3.46Å; I96-H100 PolarHBondContact O-CD2 3.11Å; I96-H100 PolarHBondContact O-N 3.21Å; K97-H100 PolarHBondContact O-N 3.1Å; H100-A104 WeakPolarHBondContact O-CB 3.49Å; H100-A104 PolarHBondContact O-N 3.15Å
101	H	38.1	Very low	38.8	Very low	118 Å²	118	113.1 Å²	113.1	55%	0.546	53%	0.525	S	S	.	.	H	α-helix	trans	-67.3	-44.2	178.2	-170.6	-97.4	0	0	0	111.7	K97 R98 A104 Q105	K97-H101 VanDerWaalsContact O-CB 3.25Å; K97-H101 WeakPolarHBondContact O-CB 3.42Å; K97-H101 PolarHBondContact O-N 3.06Å; R98-H101 PolarHBondContact O-N 3.39Å; H101-A104 PolarHBondContact O-N 2.92Å; H101-Q105 PolarHBondContact CE1-NE2 3.37Å; H101-Q105 VanDerWaalsContact CE1-NE2 3.31Å; H101-Q105 WeakPolarHBondContact O-CG 3.4Å; H101-Q105 PolarHBondContact O-N 3.24Å
102	S	39.9	Very low	39.4	Very low	69 Å²	69	110 Å²	110	48%	0.483	52%	0.518	S	S	.	.	H	α-helix	trans	-64.4	-41.6	176.2	-178.3	0	0	0	0	111.7	R98 Q105 T106	R98-S102 VanDerWaalsContact O-CB 3.22Å; R98-S102 WeakPolarHBondContact O-CB 3.13Å; R98-S102 PolarHBondContact O-N 3.18Å; S102-Q105 PolarHBondContact O-N 3.37Å; S102-T106 WeakPolarHBondContact O-CB 3.42Å; S102-T106 PolarHBondContact O-N 2.96Å; S102-T106 PolarHBondContact O-OG1 2.96Å
103	N	38.6	Very low	40.2	Very low	76 Å²	76	109.2 Å²	109.2	41%	0.406	52%	0.521	S	S	.	.	H	α-helix	trans	-72.8	-33.7	179	-142.3	18.2	0	0	0	112.2	Y99 T106 T107	Y99-N103 VanDerWaalsContact O-CB 3.26Å; Y99-N103 WeakPolarHBondContact O-CB 3.38Å; Y99-N103 PolarHBondContact O-N 3.37Å; N103-T106 PolarHBondContact O-N 3.45Å; N103-T107 WeakPolarHBondContact O-CG2 3.33Å; N103-T107 PolarHBondContact O-N 3.48Å; N103-T107 PolarHBondContact O-OG1 2.97Å; N103-T107 VanDerWaalsContact O-OG1 3.08Å
104	A	39	Very low	41.1	Very low	43 Å²	43	104.3 Å²	104.3	36%	0.355	51%	0.508	S	S	.	.	H	α-helix	trans	-68.3	-34.9	173.7	0	0	0	0	0	113	H100 H101 T107 R108	H100-A104 WeakPolarHBondContact O-CB 3.49Å; H100-A104 PolarHBondContact O-N 3.15Å; H101-A104 PolarHBondContact O-N 2.92Å; A104-T107 PolarHBondContact O-OG1 2.98Å; A104-T107 VanDerWaalsContact O-OG1 3.11Å; A104-R108 WeakPolarHBondContact O-CB 3.38Å; A104-R108 WeakPolarHBondContact O-CG 3.39Å; A104-R108 PolarHBondContact O-N 3.25Å; A104-R108 VanDerWaalsContact O-N 3.1Å
105	Q	40.5	Very low	42.2	Very low	100 Å²	100	107.3 Å²	107.3	47%	0.467	52%	0.518	S	S	.	.	H	α-helix	trans	-69.9	-39.6	171.6	-76	-179.4	-35.9	0	0	111.5	H101 S102 R108 N109	H101-Q105 PolarHBondContact CE1-NE2 3.37Å; H101-Q105 VanDerWaalsContact CE1-NE2 3.31Å; H101-Q105 WeakPolarHBondContact O-CG 3.4Å; H101-Q105 PolarHBondContact O-N 3.24Å; S102-Q105 PolarHBondContact O-N 3.37Å; Q105-R108 PolarHBondContact O-N 3.12Å; Q105-N109 WeakPolarHBondContact O-CB 3.45Å; Q105-N109 PolarHBondContact O-N 3.09Å
106	T	44.9	Very low	43.2	Very low	52 Å²	52	109.6 Å²	109.6	32%	0.319	53%	0.526	S	S	.	.	H	α-helix	trans	-66.6	-39.3	179.6	-52.7	0	0	0	0	111.8	S102 N103 R110	S102-T106 WeakPolarHBondContact O-CB 3.42Å; S102-T106 PolarHBondContact O-N 2.96Å; S102-T106 PolarHBondContact O-OG1 2.96Å; N103-T106 PolarHBondContact O-N 3.45Å; T106-R110 WeakPolarHBondContact O-CG 3.48Å; T106-R110 PolarHBondContact O-N 3.32Å
107	T	41.5	Very low	44.3	Very low	66 Å²	66	111.9 Å²	111.9	41%	0.405	54%	0.535	S	S	.	.	H	α-helix	trans	-69.9	-45.4	174.5	51.9	0	0	0	0	111.7	N103 A104 N109 R110 Y111	N103-T107 WeakPolarHBondContact O-CG2 3.33Å; N103-T107 PolarHBondContact O-N 3.48Å; N103-T107 PolarHBondContact O-OG1 2.97Å; N103-T107 VanDerWaalsContact O-OG1 3.08Å; A104-T107 PolarHBondContact O-OG1 2.98Å; A104-T107 VanDerWaalsContact O-OG1 3.11Å; T107-N109 VanDerWaalsContact C-N 3.34Å; T107-N109 PolarHBondContact O-N 3.15Å; T107-R110 PolarHBondContact O-N 2.86Å; T107-Y111 WeakPolarHBondContact O-CD2 3.18Å; T107-Y111 PolarHBondContact O-N 3.12Å
108	R	39	Very low	45.6	Very low	184 Å²	184	111.1 Å²	111.1	69%	0.694	53%	0.534	S	S	*	.	H	α-helix	trans	-59.1	-40.8	175.3	-81.4	-171.4	-161.8	161.2	5.4	113.4	A104 Q105 Y111 S112	A104-R108 WeakPolarHBondContact O-CB 3.38Å; A104-R108 WeakPolarHBondContact O-CG 3.39Å; A104-R108 PolarHBondContact O-N 3.25Å; A104-R108 VanDerWaalsContact O-N 3.1Å; Q105-R108 PolarHBondContact O-N 3.12Å; R108-Y111 PolarHBondContact O-N 3.42Å; R108-S112 WeakPolarHBondContact O-CB 3.36Å; R108-S112 PolarHBondContact O-N 3.25Å; R108-S112 PolarHBondContact O-OG 3.06Å
109	N	44.2	Very low	46.8	Very low	107 Å²	107	106.7 Å²	106.7	57%	0.572	52%	0.524	S	S	*	.	H	α-helix	trans	-66.6	-39.4	178.2	-78.5	-2.4	0	0	0	111.5	Q105 T107 S112 V113	Q105-N109 WeakPolarHBondContact O-CB 3.45Å; Q105-N109 PolarHBondContact O-N 3.09Å; T107-N109 VanDerWaalsContact C-N 3.34Å; T107-N109 PolarHBondContact O-N 3.15Å; N109-S112 PolarHBondContact O-N 3.37Å; N109-V113 VanDerWaalsContact O-CG2 3.28Å; N109-V113 WeakPolarHBondContact O-CG2 3.42Å; N109-V113 PolarHBondContact O-N 3.47Å
110	R	47.8	Very low	48.2	Very low	188 Å²	188	105.9 Å²	105.9	71%	0.709	53%	0.525	S	S	*	.	H	α-helix	trans	-65.4	-39.3	174.7	-72.5	-176.2	-165.1	173.6	5.4	113	T106 T107 S112 G114	T106-R110 WeakPolarHBondContact O-CG 3.48Å; T106-R110 PolarHBondContact O-N 3.32Å; T107-R110 PolarHBondContact O-N 2.86Å; R110-S112 VanDerWaalsContact C-N 3.34Å; R110-G114 PolarHBondContact O-N 3.49Å; R110-G114 VanDerWaalsContact O-N 3.13Å
111	Y	43.3	Very low	49.3	Very low	181 Å²	181	106.4 Å²	106.4	71%	0.71	53%	0.529	S	S	*	.	H	α-helix	trans	-68.7	-32	175.5	-81.7	-73.6	0	0	0	113	T107 R108 K115	T107-Y111 WeakPolarHBondContact O-CD2 3.18Å; T107-Y111 PolarHBondContact O-N 3.12Å; R108-Y111 PolarHBondContact O-N 3.42Å; Y111-K115 PolarHBondContact O-N 2.94Å
112	S	49.5	Very low	50.8	Low	65 Å²	65	105.4 Å²	105.4	46%	0.455	53%	0.525	S	S	.	.	H	α-helix	trans	-77.9	-39.6	179.7	-54.7	0	0	0	0	112.1	R108 N109 R110 K115 N116	R108-S112 WeakPolarHBondContact O-CB 3.36Å; R108-S112 PolarHBondContact O-N 3.25Å; R108-S112 PolarHBondContact O-OG 3.06Å; N109-S112 PolarHBondContact O-N 3.37Å; R110-S112 VanDerWaalsContact C-N 3.34Å; S112-K115 PolarHBondContact O-N 2.9Å; S112-N116 PolarHBondContact O-N 3.36Å; S112-N116 VanDerWaalsContact O-N 3.11Å
113	V	53.1	Low	52.2	Low	82 Å²	82	107.7 Å²	107.7	50%	0.497	53%	0.528	S	S	.	.	H	α-helix	trans	-64.4	-45.1	174.1	174.4	0	0	0	0	110.7	N109 K115 N116 E117	N109-V113 VanDerWaalsContact O-CG2 3.28Å; N109-V113 WeakPolarHBondContact O-CG2 3.42Å; N109-V113 PolarHBondContact O-N 3.47Å; V113-K115 VanDerWaalsContact C-N 3.33Å; V113-K115 PolarHBondContact O-N 3.05Å; V113-N116 PolarHBondContact O-N 3.5Å; V113-E117 HydrophobicContact CG1-CG 4.39Å; V113-E117 WeakPolarHBondContact O-CG 3.11Å; V113-E117 PolarHBondContact O-N 2.65Å
114	G	53.9	Low	53.5	Low	31 Å²	31	106 Å²	106	32%	0.32	53%	0.525	S	S	.	.	H	α-helix	trans	-63.7	-33.1	178.3	0	0	0	0	0	114.3	R110 Q118	R110-G114 PolarHBondContact O-N 3.49Å; R110-G114 VanDerWaalsContact O-N 3.13Å; G114-Q118 WeakPolarHBondContact O-CG 3.12Å; G114-Q118 PolarHBondContact O-N 2.97Å; G114-Q118 VanDerWaalsContact O-N 3.13Å
115	K	58.1	Low	55	Low	144 Å²	144	112.3 Å²	112.3	63%	0.626	54%	0.54	S	S	*	.	H	α-helix	trans	-71.7	-38.8	173.6	-83.8	-174.4	175.2	-175.3	0	112.7	Y111 S112 V113 Q118 L119	Y111-K115 PolarHBondContact O-N 2.94Å; S112-K115 PolarHBondContact O-N 2.9Å; V113-K115 VanDerWaalsContact C-N 3.33Å; V113-K115 PolarHBondContact O-N 3.05Å; K115-Q118 PolarHBondContact O-N 2.92Å; K115-L119 WeakPolarHBondContact O-CB 3.23Å; K115-L119 WeakPolarHBondContact O-CG 3.14Å; K115-L119 PolarHBondContact O-N 3.32Å
116	N	58.1	Low	56.5	Low	99 Å²	99	116.7 Å²	116.7	53%	0.529	55%	0.552	S	S	.	*	H	α-helix	trans	-69.3	-37.2	177	-78.1	-11.7	0	0	0	112	S112 V113 L119 H120	S112-N116 PolarHBondContact O-N 3.36Å; S112-N116 VanDerWaalsContact O-N 3.11Å; V113-N116 PolarHBondContact O-N 3.5Å; N116-L119 PolarHBondContact O-N 3.27Å; N116-H120 WeakPolarHBondContact O-CB 3.22Å; N116-H120 PolarHBondContact O-N 3.32Å
117	E	59.3	Low	57.8	Low	123 Å²	123	120.3 Å²	120.3	58%	0.575	57%	0.573	S	S	*	*	H	α-helix	trans	-65.8	-39.8	173.7	-71.8	-177.1	143.2	0	0	111.9	V113 H120 M121	V113-E117 HydrophobicContact CG1-CG 4.39Å; V113-E117 WeakPolarHBondContact O-CG 3.11Å; V113-E117 PolarHBondContact O-N 2.65Å; E117-H120 PolarHBondContact O-N 3.12Å; E117-M121 WeakPolarHBondContact O-CB 3.41Å; E117-M121 WeakPolarHBondContact O-CG 3.41Å; E117-M121 PolarHBondContact O-N 3.42Å
118	Q	60.4	Low	58.8	Low	144 Å²	144	123.5 Å²	123.5	67%	0.673	59%	0.587	S	S	*	*	H	α-helix	trans	-65.8	-42.4	173.8	-79.1	-164.6	-23.5	0	0	112.7	G114 K115 M121 E122	G114-Q118 WeakPolarHBondContact O-CG 3.12Å; G114-Q118 PolarHBondContact O-N 2.97Å; G114-Q118 VanDerWaalsContact O-N 3.13Å; K115-Q118 PolarHBondContact O-N 2.92Å; Q118-M121 PolarHBondContact O-N 3.47Å; Q118-E122 WeakPolarHBondContact O-CB 3.12Å; Q118-E122 PolarHBondContact O-N 3.44Å
119	L	61.2	Low	60	Low	92 Å²	92	118.2 Å²	118.2	48%	0.482	59%	0.59	S	S	.	*	H	α-helix	trans	-64.2	-41.1	176.2	-80.5	161.6	0	0	0	112	K115 N116 E122 Q123	K115-L119 WeakPolarHBondContact O-CB 3.23Å; K115-L119 WeakPolarHBondContact O-CG 3.14Å; K115-L119 PolarHBondContact O-N 3.32Å; N116-L119 PolarHBondContact O-N 3.27Å; L119-E122 PolarHBondContact O-N 3.02Å; L119-Q123 WeakPolarHBondContact O-CB 3.28Å; L119-Q123 WeakPolarHBondContact O-CG 3.46Å; L119-Q123 PolarHBondContact O-N 3.12Å
120	H	63.6	Low	60.3	Low	132 Å²	132	120.9 Å²	120.9	61%	0.611	61%	0.61	S	S	*	*	H	α-helix	trans	-66.5	-38.7	175.2	-81.1	-161	0	0	0	112.2	N116 E117 A124	N116-H120 WeakPolarHBondContact O-CB 3.22Å; N116-H120 PolarHBondContact O-N 3.32Å; E117-H120 PolarHBondContact O-N 3.12Å; H120-A124 VanDerWaalsContact O-CB 3.23Å; H120-A124 WeakPolarHBondContact O-CB 3.25Å; H120-A124 PolarHBondContact O-N 3.37Å
121	M	61.5	Low	61	Low	138 Å²	138	117.6 Å²	117.6	68%	0.68	61%	0.605	S	S	*	*	H	α-helix	trans	-68.7	-37.4	175.2	-72.6	-73.8	-175.2	0	0	112.2	E117 Q118 A124 R125	E117-M121 WeakPolarHBondContact O-CB 3.41Å; E117-M121 WeakPolarHBondContact O-CG 3.41Å; E117-M121 PolarHBondContact O-N 3.42Å; Q118-M121 PolarHBondContact O-N 3.47Å; M121-A124 PolarHBondContact O-N 3.38Å; M121-R125 PolarHBondContact O-N 3.19Å
122	E	69.5	Low	61.9	Low	97 Å²	97	114.2 Å²	114.2	45%	0.453	60%	0.6	S	S	.	*	H	α-helix	trans	-71.3	-39	176.9	-158	-172.7	145.3	0	0	111.6	Q118 L119 R125 R126	Q118-E122 WeakPolarHBondContact O-CB 3.12Å; Q118-E122 PolarHBondContact O-N 3.44Å; L119-E122 PolarHBondContact O-N 3.02Å; E122-R125 PolarHBondContact O-N 3.47Å; E122-R126 WeakPolarHBondContact O-CG 3.31Å; E122-R126 PolarHBondContact O-N 2.88Å; E122-R126 IonicContact OE1-CZ 3.79Å; E122-R126 IonicContact OE1-NE 3.86Å; E122-R126 IonicContact OE1-NH2 2.86Å; E122-R126 PolarHBondContact OE1-NH2 3.31Å
123	Q	70.1	Confident	62.6	Low	117 Å²	117	116.9 Å²	116.9	55%	0.547	61%	0.608	S	S	.	*	H	α-helix	trans	-63.9	-42.6	170.1	-77.4	179.5	-20	0	0	111.6	L119 R125 R126 V127	L119-Q123 WeakPolarHBondContact O-CB 3.28Å; L119-Q123 WeakPolarHBondContact O-CG 3.46Å; L119-Q123 PolarHBondContact O-N 3.12Å; Q123-R125 VanDerWaalsContact C-N 3.34Å; Q123-R125 PolarHBondContact O-N 2.96Å; Q123-R126 PolarHBondContact O-N 3.24Å; Q123-V127 WeakPolarHBondContact O-CG2 3.35Å; Q123-V127 PolarHBondContact O-N 2.98Å
124	A	65.2	Low	63.1	Low	42 Å²	42	119 Å²	119	35%	0.347	61%	0.614	S	S	.	*	H	α-helix	trans	-61.9	-39.9	176	0	0	0	0	0	112.1	H120 M121 V127 L128	H120-A124 VanDerWaalsContact O-CB 3.23Å; H120-A124 WeakPolarHBondContact O-CB 3.25Å; H120-A124 PolarHBondContact O-N 3.37Å; M121-A124 PolarHBondContact O-N 3.38Å; A124-V127 PolarHBondContact O-N 3.17Å; A124-L128 VanDerWaalsContact O-CB 3.31Å; A124-L128 WeakPolarHBondContact O-CB 2.79Å; A124-L128 WeakPolarHBondContact O-CG 3.39Å; A124-L128 PolarHBondContact O-N 3.04Å
125	R	69.9	Low	63.7	Low	175 Å²	175	124.5 Å²	124.5	66%	0.66	63%	0.632	S	S	*	*	H	α-helix	trans	-63.6	-44	173.4	-80.8	-172.4	179.2	-174.7	-2.1	112.8	M121 E122 Q123 V127 L128 G129	M121-R125 PolarHBondContact O-N 3.19Å; E122-R125 PolarHBondContact O-N 3.47Å; Q123-R125 VanDerWaalsContact C-N 3.34Å; Q123-R125 PolarHBondContact O-N 2.96Å; R125-V127 VanDerWaalsContact C-N 3.28Å; R125-V127 PolarHBondContact O-N 2.86Å; R125-L128 PolarHBondContact O-N 3.08Å; R125-G129 PolarHBondContact O-N 3.14Å
126	R	71.6	Confident	64.1	Low	192 Å²	192	123.2 Å²	123.2	73%	0.725	63%	0.633	S	S	*	*	H	α-helix	trans	-63.3	-33.8	176.8	-70.4	-172.1	-157.2	-168	6.8	112.9	E122 Q123	E122-R126 WeakPolarHBondContact O-CG 3.31Å; E122-R126 PolarHBondContact O-N 2.88Å; E122-R126 IonicContact OE1-CZ 3.79Å; E122-R126 IonicContact OE1-NE 3.86Å; E122-R126 IonicContact OE1-NH2 2.86Å; E122-R126 PolarHBondContact OE1-NH2 3.31Å; Q123-R126 PolarHBondContact O-N 3.24Å
127	V	72.2	Confident	64.5	Low	127 Å²	127	124.9 Å²	124.9	77%	0.77	64%	0.64	S	S	*	*	H	α-helix	trans	-76.8	-35.6	176.8	174.4	0	0	0	0	111.9	Q123 A124 R125	Q123-V127 WeakPolarHBondContact O-CG2 3.35Å; Q123-V127 PolarHBondContact O-N 2.98Å; A124-V127 PolarHBondContact O-N 3.17Å; R125-V127 VanDerWaalsContact C-N 3.28Å; R125-V127 PolarHBondContact O-N 2.86Å
128	L	64.1	Low	64.9	Low	134 Å²	134	125.1 Å²	125.1	70%	0.702	65%	0.645	S	S	*	*	H	α-helix	trans	-85.6	-8.7	-178.6	-71.1	167.6	0	0	0	114.3	A124 R125 V130	A124-L128 VanDerWaalsContact O-CB 3.31Å; A124-L128 WeakPolarHBondContact O-CB 2.79Å; A124-L128 WeakPolarHBondContact O-CG 3.39Å; A124-L128 PolarHBondContact O-N 3.04Å; R125-L128 PolarHBondContact O-N 3.08Å; L128-V130 VanDerWaalsContact C-N 3.35Å; L128-V130 PolarHBondContact O-N 3.17Å
129	G	62.9	Low	65.3	Low	73 Å²	73	123.5 Å²	123.5	75%	0.753	64%	0.643	S	S	*	*	T	Hydrogen-bonded Turn	trans	68	28.2	172.8	0	0	0	0	0	115	R125	R125-G129 PolarHBondContact O-N 3.14Å
130	V	51.7	Low	65.7	Low	163 Å²	163	126.4 Å²	126.4	99%	0.988	66%	0.658	S	S	*	*			trans	-115	0	175.7	-170.3	0	0	0	0	110	L128	L128-V130 VanDerWaalsContact C-N 3.35Å; L128-V130 PolarHBondContact O-N 3.17Å

Retrieved 130 of 130 residues in 28.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).