A0A077Z616_TRITR Loading...

WGS project CAEQ00000000 data, annotated contig 1 422

AlphaFold DB , UniProt , Accession A0A077Z616, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 62 aa.

						>A0A077Z616_TRITR|A0A077Z616
MEEAVWSKNASAVAALYTEGCHFMPTGSTRIVLGDYTFQYGWYNSQWYIHVGCFNVVSVAKG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	33.7	Very low	37.1	Very low	185 Å²	185	116.8 Å²	116.8	91%	0.911	60%	0.599	S	S	*	*				0	-44.6	0	-153.8	173.3	-174.5	0	0	110.7	E3 A4 V5	M1-E3 PolarHBondContact O-N 3.48Å; M1-A4 PolarHBondContact O-N 2.99Å; M1-V5 PolarHBondContact O-N 3.33Å
2	E	31.3	Very low	37.5	Very low	161 Å²	161	108.7 Å²	108.7	75%	0.752	56%	0.562	S	S	*	*	H	α-helix	trans	-53.1	-47.4	174.1	-87.1	172.9	101.5	0	0	115	A4 V5 W6	E2-A4 VanDerWaalsContact C-N 3.27Å; E2-A4 PolarHBondContact O-N 2.82Å; E2-V5 PolarHBondContact O-N 2.95Å; E2-W6 PolarHBondContact O-N 3.08Å; E2-W6 VanDerWaalsContact O-N 3.14Å
3	E	34.4	Very low	37.9	Very low	176 Å²	176	105.6 Å²	105.6	82%	0.822	55%	0.551	S	S	*	*	H	α-helix	trans	-60.2	-35.2	-178.8	-80.2	-171.1	126.1	0	0	113.5	M1 W6 S7	M1-E3 PolarHBondContact O-N 3.48Å; E3-W6 PolarHBondContact O-N 3.13Å; E3-S7 WeakPolarHBondContact O-CB 3.47Å; E3-S7 PolarHBondContact O-N 3.28Å; E3-S7 VanDerWaalsContact O-N 3.08Å
4	A	35.9	Very low	38.2	Very low	46 Å²	46	100.5 Å²	100.5	38%	0.38	53%	0.532	S	S	.	.	H	α-helix	trans	-69.5	-40	-178.9	0	0	0	0	0	111.1	M1 E2 S7 A10	M1-A4 PolarHBondContact O-N 2.99Å; E2-A4 VanDerWaalsContact C-N 3.27Å; E2-A4 PolarHBondContact O-N 2.82Å; A4-S7 PolarHBondContact O-N 3.25Å; A4-S7 PolarHBondContact O-OG 3.17Å; A4-A10 HydrophobicContact CB-CB 3.69Å; A4-A10 WeakPolarHBondContact O-CB 3.5Å
5	V	36.7	Very low	38.5	Very low	49 Å²	49	99.3 Å²	99.3	30%	0.297	54%	0.541	S	S	.	.	H	α-helix	trans	-65.4	-40.4	177.2	178.5	0	0	0	0	111.2	M1 E2 A12 W47	M1-V5 PolarHBondContact O-N 3.33Å; E2-V5 PolarHBondContact O-N 2.95Å; V5-A12 HydrophobicContact CG2-CB 4.07Å; V5-W47 HydrophobicContact CG1-CH2 4.39Å
6	W	37.5	Very low	38.9	Very low	223 Å²	223	97.7 Å²	97.7	85%	0.845	53%	0.532	S	S	*	.	H	α-helix	trans	-74.9	-25.7	179.7	-82.8	28.4	0	0	0	113.8	E2 E3 K8	E2-W6 PolarHBondContact O-N 3.08Å; E2-W6 VanDerWaalsContact O-N 3.14Å; E3-W6 PolarHBondContact O-N 3.13Å; W6-K8 PolarHBondContact O-N 3.14Å; W6-K8 VanDerWaalsContact O-N 3.17Å
7	S	45.7	Very low	38.9	Very low	72 Å²	72	102.2 Å²	102.2	50%	0.503	54%	0.541	S	S	.	.	T	Hydrogen-bonded Turn	trans	-71.6	-1.3	176.7	76.7	0	0	0	0	114.9	E3 A4 N9	E3-S7 WeakPolarHBondContact O-CB 3.47Å; E3-S7 PolarHBondContact O-N 3.28Å; E3-S7 VanDerWaalsContact O-N 3.08Å; A4-S7 PolarHBondContact O-N 3.25Å; A4-S7 PolarHBondContact O-OG 3.17Å; S7-N9 PolarHBondContact O-N 3.47Å; S7-N9 PolarHBondContact OG-N 3.23Å
8	K	41.8	Very low	39.1	Very low	118 Å²	118	98.9 Å²	98.9	51%	0.513	53%	0.525	S	S	.	.	T	Hydrogen-bonded Turn	trans	57	9.1	-174.3	-59.5	-175.5	174.6	-171.5	0	115.3	W6 W42	W6-K8 PolarHBondContact O-N 3.14Å; W6-K8 VanDerWaalsContact O-N 3.17Å; K8-W42 HydrophobicContact CB-CG 4.47Å; K8-W42 HydrophobicContact CD-CZ2 4.46Å
9	N	33.2	Very low	39.1	Very low	154 Å²	154	103.2 Å²	103.2	82%	0.824	54%	0.542	S	S	*	.			trans	-107.6	5	-178.5	-106.7	-8.4	0	0	0	113.5	S7	S7-N9 PolarHBondContact O-N 3.47Å; S7-N9 PolarHBondContact OG-N 3.23Å
10	A	35.2	Very low	39.2	Very low	24 Å²	24	101.5 Å²	101.5	20%	0.198	55%	0.55	C	S	.	.			trans	-105.3	125.9	179.7	0	0	0	0	0	111.9	A4 A12	A4-A10 HydrophobicContact CB-CB 3.69Å; A4-A10 WeakPolarHBondContact O-CB 3.5Å; A10-A12 PolarHBondContact O-N 3.49Å; A10-A12 VanDerWaalsContact O-N 3.13Å
11	S	43.3	Very low	39.2	Very low	77 Å²	77	98.7 Å²	98.7	54%	0.538	54%	0.538	S	S	.	.			trans	-66.4	102.4	151.5	-28.6	0	0	0	0	106.8	V13 Y40	S11-V13 PolarHBondContact O-N 3.43Å; S11-Y40 WeakPolarHBondContact CA-O 3.33Å
12	A	41	Very low	39.6	Very low	19 Å²	19	95.2 Å²	95.2	16%	0.157	52%	0.519	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.2	113	172.9	0	0	0	0	0	107	V5 A10 A14 Y40	V5-A12 HydrophobicContact CG2-CB 4.07Å; A10-A12 PolarHBondContact O-N 3.49Å; A10-A12 VanDerWaalsContact O-N 3.13Å; A12-A14 PolarHBondContact O-N 3.08Å; A12-Y40 PolarHBondContact N-O 3.1Å; A12-Y40 WeakPolarHBondContact O-CD2 3.12Å; A12-Y40 PolarHBondContact O-N 3.21Å
13	V	43	Very low	40.2	Very low	69 Å²	69	94 Å²	94	42%	0.418	51%	0.512	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.9	105.9	166.9	178.6	0	0	0	0	105.8	S11 T37 F38 Q39	S11-V13 PolarHBondContact O-N 3.43Å; V13-T37 HydrophobicContact CG1-CG2 3.47Å; V13-T37 VanDerWaalsContact CG1-CG2 3.47Å; V13-F38 WeakPolarHBondContact CA-O 3.2Å; V13-Q39 HydrophobicContact CG2-CG 4.15Å
14	A	42.4	Very low	40.4	Very low	34 Å²	34	90.5 Å²	90.5	28%	0.281	50%	0.497	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.3	114.3	167.4	0	0	0	0	0	107.4	A12 L16 F38 Y40	A12-A14 PolarHBondContact O-N 3.08Å; A14-L16 VanDerWaalsContact C-N 3.3Å; A14-L16 HydrophobicContact CB-CD1 4.4Å; A14-L16 PolarHBondContact O-N 3.31Å; A14-L16 VanDerWaalsContact O-N 3.1Å; A14-F38 PolarHBondContact N-O 2.86Å; A14-F38 PolarHBondContact O-N 3.24Å; A14-Y40 HydrophobicContact CB-CD2 4.32Å; A14-Y40 HydrophobicContact CB-CE2 3.68Å
15	A	43	Very low	40.7	Very low	82 Å²	82	92.1 Å²	92.1	68%	0.678	50%	0.503	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-74.3	92.4	160.8	0	0	0	0	0	106.6	Y17	A15-Y17 PolarHBondContact O-N 3.45Å
16	L	44.2	Very low	41.1	Very low	74 Å²	74	97.1 Å²	97.1	39%	0.387	53%	0.534	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.7	105.7	169.6	-87.8	142.2	0	0	0	107	A14 T18 F38 Y40	A14-L16 VanDerWaalsContact C-N 3.3Å; A14-L16 HydrophobicContact CB-CD1 4.4Å; A14-L16 PolarHBondContact O-N 3.31Å; A14-L16 VanDerWaalsContact O-N 3.1Å; L16-T18 VanDerWaalsContact C-N 3.28Å; L16-T18 HydrophobicContact CB-CG2 4.01Å; L16-T18 PolarHBondContact O-N 2.81Å; L16-F38 HydrophobicContact CB-CD2 3.98Å; L16-F38 HydrophobicContact CB-CE2 4.05Å; L16-F38 HydrophobicContact CD1-CD2 3.81Å; L16-F38 HydrophobicContact CD1-CE2 4.27Å; L16-F38 HydrophobicContact CD1-CG 4.46Å; L16-Y40 VanDerWaalsContact CD1-OH 3.26Å; L16-Y40 WeakPolarHBondContact CD1-OH 3.4Å
17	Y	39.5	Very low	41.7	Very low	175 Å²	175	90.6 Å²	90.6	69%	0.686	54%	0.536	S	S	*	.			trans	-65.4	93.9	163.4	-114.5	-88.8	0	0	0	107.4	A15	A15-Y17 PolarHBondContact O-N 3.45Å
18	T	42.3	Very low	41.8	Very low	43 Å²	43	89.1 Å²	89.1	26%	0.264	53%	0.526	S	S	.	.			trans	-97.2	98.2	174.4	62.4	0	0	0	0	108.3	L16 G20 C21	L16-T18 VanDerWaalsContact C-N 3.28Å; L16-T18 HydrophobicContact CB-CG2 4.01Å; L16-T18 PolarHBondContact O-N 2.81Å; T18-G20 PolarHBondContact O-N 2.89Å; T18-C21 PolarHBondContact OG1-SG 2.79Å
19	E	39.2	Very low	42.3	Very low	180 Å²	180	87.9 Å²	87.9	84%	0.841	53%	0.528	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63	-4.2	171.7	-62.9	-174.6	163.7	0	0	112.9
20	G	40.5	Very low	42.9	Very low	68 Å²	68	87.1 Å²	87.1	70%	0.701	51%	0.514	S	S	*	.	T	Hydrogen-bonded Turn	trans	-103.3	-4.1	-169.3	0	0	0	0	0	117.4	T18 H22	T18-G20 PolarHBondContact O-N 2.89Å; G20-H22 VanDerWaalsContact C-N 3.3Å; G20-H22 PolarHBondContact O-N 2.88Å
21	C	39.9	Very low	43.8	Very low	44 Å²	44	88.8 Å²	88.8	30%	0.297	52%	0.518	S	S	.	.			trans	-87.5	67.9	-177.6	-67.8	0	0	0	0	112.1	T18 F23 Y36	T18-C21 PolarHBondContact OG1-SG 2.79Å; C21-F23 VanDerWaalsContact C-N 3.3Å; C21-F23 PolarHBondContact O-N 2.86Å; C21-Y36 HydrophobicContact CB-CD2 4.21Å; C21-Y36 HydrophobicContact CB-CE2 3.4Å; C21-Y36 VanDerWaalsContact CB-CE2 3.4Å
22	H	41.9	Very low	44.2	Very low	112 Å²	112	86.7 Å²	86.7	52%	0.519	50%	0.502	S	S	.	.			trans	-71.4	88.4	160.8	-83.6	174.4	0	0	0	109.4	G20 M24 I31	G20-H22 VanDerWaalsContact C-N 3.3Å; G20-H22 PolarHBondContact O-N 2.88Å; H22-M24 VanDerWaalsContact C-N 3.26Å; H22-M24 PolarHBondContact O-N 3.19Å; H22-M24 VanDerWaalsContact O-N 3.08Å; H22-I31 WeakPolarHBondContact NE2-CG2 3.45Å
23	F	43	Very low	44.9	Very low	136 Å²	136	89.6 Å²	89.6	60%	0.596	52%	0.515	S	S	*	.			trans	-73.3	91.5	153.9	-84.8	-88.5	0	0	0	107.3	C21 P25 Y36	C21-F23 VanDerWaalsContact C-N 3.3Å; C21-F23 PolarHBondContact O-N 2.86Å; F23-P25 VanDerWaalsContact O-CD 3.32Å; F23-P25 WeakPolarHBondContact O-CD 3.33Å; F23-Y36 WeakPolarHBondContact CD2-OH 3.36Å; F23-Y36 WeakPolarHBondContact CE2-OH 3.47Å
24	M	38.5	Very low	45.5	Very low	102 Å²	102	86.8 Å²	86.8	50%	0.502	50%	0.5	S	S	.	.			trans	-93.3	103.3	157.6	-69.8	-171.8	76.8	0	0	106.9	H22 T26	H22-M24 VanDerWaalsContact C-N 3.26Å; H22-M24 PolarHBondContact O-N 3.19Å; H22-M24 VanDerWaalsContact O-N 3.08Å; M24-T26 PolarHBondContact O-N 3.27Å
25	P	42.4	Very low	46.4	Very low	80 Å²	80	87.2 Å²	87.2	52%	0.519	50%	0.498	S	S	.	.			trans	-58.3	126.3	163.4	-6.5	17.8	0	0	0	106.7	F23 G27 S28	F23-P25 VanDerWaalsContact O-CD 3.32Å; F23-P25 WeakPolarHBondContact O-CD 3.33Å; P25-G27 PolarHBondContact O-N 3.03Å; P25-S28 VanDerWaalsContact CB-OG 3.32Å; P25-S28 WeakPolarHBondContact CB-OG 3.47Å; P25-S28 WeakPolarHBondContact CD-OG 3.37Å; P25-S28 VanDerWaalsContact CG-OG 3.26Å; P25-S28 WeakPolarHBondContact CG-OG 3.42Å; P25-S28 WeakPolarHBondContact O-CB 3.08Å; P25-S28 PolarHBondContact O-N 2.9Å; P25-S28 PolarHBondContact O-OG 3.49Å
26	T	45.8	Very low	47.3	Very low	154 Å²	154	84.6 Å²	84.6	95%	0.945	47%	0.47	S	S	*	.	T	Hydrogen-bonded Turn	trans	-50.2	117.2	178.4	28.8	0	0	0	0	109.6	M24	M24-T26 PolarHBondContact O-N 3.27Å
27	G	50.2	Low	48	Very low	86 Å²	86	83.3 Å²	83.3	89%	0.887	47%	0.465	S	S	*	.	T	Hydrogen-bonded Turn	trans	104.6	-0.5	-176.2	0	0	0	0	0	116.3	P25	P25-G27 PolarHBondContact O-N 3.03Å
28	S	48.4	Very low	49	Very low	41 Å²	41	76.7 Å²	76.7	29%	0.287	44%	0.44	S	S	.	.			trans	-92.7	122.5	179.2	-40.9	0	0	0	0	111.8	P25 R30	P25-S28 VanDerWaalsContact CB-OG 3.32Å; P25-S28 WeakPolarHBondContact CB-OG 3.47Å; P25-S28 WeakPolarHBondContact CD-OG 3.37Å; P25-S28 VanDerWaalsContact CG-OG 3.26Å; P25-S28 WeakPolarHBondContact CG-OG 3.42Å; P25-S28 WeakPolarHBondContact O-CB 3.08Å; P25-S28 PolarHBondContact O-N 2.9Å; P25-S28 PolarHBondContact O-OG 3.49Å; S28-R30 PolarHBondContact O-N 3.3Å; S28-R30 VanDerWaalsContact O-N 3.08Å
29	T	52.4	Low	50	Low	92 Å²	92	78.9 Å²	78.9	56%	0.564	45%	0.448	S	S	*	.	S	Bend	trans	-78	27.6	167.6	55.4	0	0	0	0	112.4	K61 G62	T29-K61 CarbonylContact O-C 3.56Å; T29-K61 WeakPolarHBondContact O-CA 2.97Å; T29-G62 PolarHBondContact O-N 2.92Å
30	R	44	Very low	51.3	Low	137 Å²	137	73.2 Å²	73.2	52%	0.517	42%	0.419	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.4	124.6	-176.7	-75.2	-177.9	168.3	175.8	-3.1	110.1	S28 V59 A60 K61	S28-R30 PolarHBondContact O-N 3.3Å; S28-R30 VanDerWaalsContact O-N 3.08Å; R30-V59 HydrophobicContact CB-CG1 4.06Å; R30-V59 HydrophobicContact CG-CG1 4.18Å; R30-A60 CarbonylContact C-O 3.57Å; R30-A60 VanDerWaalsContact CA-O 3.25Å; R30-A60 WeakPolarHBondContact CA-O 3.26Å; R30-K61 HydrophobicContact CG-CB 4.42Å; R30-K61 HydrophobicContact CG-CG 4.19Å
31	I	54	Low	52.4	Low	59 Å²	59	71.1 Å²	71.1	30%	0.303	40%	0.398	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.3	121.4	171.4	-61.7	171	0	0	0	106.5	H22 V59 A60	H22-I31 WeakPolarHBondContact NE2-CG2 3.45Å; I31-V59 WeakPolarHBondContact O-CA 3.36Å; I31-A60 PolarHBondContact N-O 2.77Å; I31-A60 PolarHBondContact O-N 3.08Å
32	V	53.1	Low	53.9	Low	33 Å²	33	72.8 Å²	72.8	20%	0.2	40%	0.398	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.7	114.1	177	-174.4	0	0	0	0	107.8	F54 V56 V59	V32-F54 HydrophobicContact CG1-CE1 3.9Å; V32-F54 HydrophobicContact CG1-CZ 3.85Å; V32-V56 HydrophobicContact CG1-CB 4.23Å; V32-V56 HydrophobicContact CG1-CG1 3.68Å; V32-V56 HydrophobicContact CG1-CG2 3.65Å; V32-V59 HydrophobicContact CG1-CG2 4.43Å; V32-V59 HydrophobicContact CG2-CG1 4.44Å; V32-V59 HydrophobicContact CG2-CG2 4.4Å
33	L	54.3	Low	55.3	Low	81 Å²	81	75.6 Å²	75.6	42%	0.424	41%	0.405	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.8	127.4	169.1	-71.2	160.5	0	0	0	107.4	V57 S58	L33-V57 PolarHBondContact O-N 3.08Å; L33-S58 PolarHBondContact N-O 2.89Å; L33-S58 PolarHBondContact O-N 2.77Å; L33-S58 VanDerWaalsContact O-N 3.12Å
34	G	57.3	Low	57.2	Low	10 Å²	10	75.2 Å²	75.2	10%	0.103	41%	0.409	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-145	151	179.8	0	0	0	0	0	113.1	N55	G34-N55 CarbonylContact C-O 3.39Å; G34-N55 WeakPolarHBondContact CA-O 3.25Å
35	D	60.5	Low	59.2	Low	43 Å²	43	74.7 Å²	74.7	23%	0.23	42%	0.416	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.5	134.1	173	-68.3	-41.9	0	0	0	109.7	N55 V57	D35-N55 PolarHBondContact N-O 3.21Å; D35-N55 PolarHBondContact O-N 2.76Å; D35-V57 HydrophobicContact CB-CG2 4.25Å; D35-V57 VanDerWaalsContact OD2-CG2 3.22Å; D35-V57 WeakPolarHBondContact OD2-CG2 3.45Å
36	Y	61.4	Low	60.8	Low	27 Å²	27	76.3 Å²	76.3	11%	0.106	42%	0.416	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99	129	170.9	-72.2	-91.5	0	0	0	109.7	C21 F23 F38 V51 F54	C21-Y36 HydrophobicContact CB-CD2 4.21Å; C21-Y36 HydrophobicContact CB-CE2 3.4Å; C21-Y36 VanDerWaalsContact CB-CE2 3.4Å; F23-Y36 WeakPolarHBondContact CD2-OH 3.36Å; F23-Y36 WeakPolarHBondContact CE2-OH 3.47Å; Y36-F38 HydrophobicContact CD1-CZ 4.32Å; Y36-F38 HydrophobicContact CG-CE2 4.21Å; Y36-F38 HydrophobicContact CG-CZ 4.04Å; Y36-V51 HydrophobicContact CD1-CG1 4.23Å; Y36-F54 HydrophobicContact CD1-CB 4.33Å; Y36-F54 HydrophobicContact CD1-CD2 4.1Å; Y36-F54 AromaticContact CD2-CD2 3.94Å; Y36-F54 HydrophobicContact CD2-CD2 3.94Å; Y36-F54 HydrophobicContact CD2-CE2 4.3Å; Y36-F54 HydrophobicContact CE1-CB 3.98Å; Y36-F54 AromaticContact CE1-CD2 3.6Å; Y36-F54 HydrophobicContact CE1-CD2 3.6Å; Y36-F54 HydrophobicContact CE1-CE2 4.42Å; Y36-F54 HydrophobicContact CE1-CG 4.15Å; Y36-F54 AromaticContact CE2-CD2 3.36Å; Y36-F54 HydrophobicContact CE2-CD2 3.36Å; Y36-F54 AromaticContact CE2-CE2 3.49Å; Y36-F54 HydrophobicContact CE2-CE2 3.49Å; Y36-F54 VanDerWaalsContact CE2-CE2 3.49Å; Y36-F54 HydrophobicContact CG-CD2 4.26Å; Y36-F54 AromaticContact CZ-CD2 3.18Å; Y36-F54 AromaticContact CZ-CE2 3.57Å; Y36-F54 WeakPolarHBondContact OH-CD2 3.32Å; Y36-F54 WeakPolarHBondContact OH-CE2 3.32Å
37	T	59	Low	62.2	Low	46 Å²	46	74.9 Å²	74.9	28%	0.282	39%	0.394	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.8	118.6	166.7	-49.9	0	0	0	0	108.2	V13 G52 C53	V13-T37 HydrophobicContact CG1-CG2 3.47Å; V13-T37 VanDerWaalsContact CG1-CG2 3.47Å; T37-G52 WeakPolarHBondContact O-CA 3.33Å; T37-G52 PolarHBondContact O-N 2.99Å; T37-C53 PolarHBondContact N-O 2.97Å
38	F	61.6	Low	62.9	Low	36 Å²	36	75.3 Å²	75.3	16%	0.158	37%	0.369	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.4	133.6	173.1	-60.5	-88.5	0	0	0	109.4	V13 A14 L16 Y36 Y40 I49 V51	V13-F38 WeakPolarHBondContact CA-O 3.2Å; A14-F38 PolarHBondContact N-O 2.86Å; A14-F38 PolarHBondContact O-N 3.24Å; L16-F38 HydrophobicContact CB-CD2 3.98Å; L16-F38 HydrophobicContact CB-CE2 4.05Å; L16-F38 HydrophobicContact CD1-CD2 3.81Å; L16-F38 HydrophobicContact CD1-CE2 4.27Å; L16-F38 HydrophobicContact CD1-CG 4.46Å; Y36-F38 HydrophobicContact CD1-CZ 4.32Å; Y36-F38 HydrophobicContact CG-CE2 4.21Å; Y36-F38 HydrophobicContact CG-CZ 4.04Å; F38-Y40 HydrophobicContact CB-CE2 3.77Å; F38-I49 HydrophobicContact CB-CG2 4.31Å; F38-I49 HydrophobicContact CD1-CG2 3.84Å; F38-I49 HydrophobicContact CG-CG2 4.49Å; F38-V51 HydrophobicContact CD1-CB 4.34Å; F38-V51 HydrophobicContact CD1-CG1 4.22Å; F38-V51 HydrophobicContact CD1-CG2 4.04Å; F38-V51 HydrophobicContact CE1-CB 4.31Å; F38-V51 HydrophobicContact CE1-CG1 3.87Å; F38-V51 HydrophobicContact CE1-CG2 3.89Å
39	Q	62.5	Low	64	Low	90 Å²	90	78 Å²	78	42%	0.421	38%	0.38	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.2	117.2	176.1	-162.5	172.8	6.4	0	0	108.5	V13 H50	V13-Q39 HydrophobicContact CG2-CG 4.15Å; Q39-H50 HydrophobicContact CB-CB 4.39Å; Q39-H50 PolarHBondContact N-O 3.5Å; Q39-H50 WeakPolarHBondContact O-CB 3.38Å; Q39-H50 PolarHBondContact O-N 3.02Å
40	Y	66	Low	64.5	Low	60 Å²	60	79.6 Å²	79.6	24%	0.235	38%	0.38	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.9	130	179.9	-61.6	-100.5	0	0	0	108.9	S11 A12 A14 L16 F38 Y48 I49	S11-Y40 WeakPolarHBondContact CA-O 3.33Å; A12-Y40 PolarHBondContact N-O 3.1Å; A12-Y40 WeakPolarHBondContact O-CD2 3.12Å; A12-Y40 PolarHBondContact O-N 3.21Å; A14-Y40 HydrophobicContact CB-CD2 4.32Å; A14-Y40 HydrophobicContact CB-CE2 3.68Å; L16-Y40 VanDerWaalsContact CD1-OH 3.26Å; L16-Y40 WeakPolarHBondContact CD1-OH 3.4Å; F38-Y40 HydrophobicContact CB-CE2 3.77Å; Y40-Y48 WeakPolarHBondContact CA-O 3.1Å; Y40-I49 HydrophobicContact CD1-CD1 4.37Å; Y40-I49 HydrophobicContact CD1-CG1 3.77Å; Y40-I49 HydrophobicContact CE1-CD1 3.72Å; Y40-I49 HydrophobicContact CE1-CG1 3.61Å; Y40-I49 HydrophobicContact CE1-CG2 4.34Å
41	G	65.1	Low	65.4	Low	25 Å²	25	77.5 Å²	77.5	26%	0.258	38%	0.383	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.9	144.6	175	0	0	0	0	0	110.9	Y48	G41-Y48 PolarHBondContact N-O 3Å; G41-Y48 PolarHBondContact O-N 2.93Å
42	W	70.7	Confident	65.6	Low	79 Å²	79	76.4 Å²	76.4	30%	0.299	39%	0.386	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.3	121.7	171.8	-178.7	-92.3	0	0	0	109.4	K8 S45 Q46 W47	K8-W42 HydrophobicContact CB-CG 4.47Å; K8-W42 HydrophobicContact CD-CZ2 4.46Å; W42-S45 WeakPolarHBondContact CH2-O 3.26Å; W42-Q46 WeakPolarHBondContact CA-O 3.22Å; W42-W47 HydrophobicContact CB-CE3 4.19Å; W42-W47 HydrophobicContact CB-CH2 4.38Å; W42-W47 HydrophobicContact CB-CZ3 4.05Å; W42-W47 HydrophobicContact CE3-CB 4.33Å; W42-W47 AromaticContact CE3-CD1 3.57Å; W42-W47 AromaticContact CE3-CD2 3.46Å; W42-W47 HydrophobicContact CE3-CD2 3.46Å; W42-W47 VanDerWaalsContact CE3-CD2 3.46Å; W42-W47 AromaticContact CE3-CE2 3.39Å; W42-W47 HydrophobicContact CE3-CE3 4.13Å; W42-W47 AromaticContact CE3-CG 3.54Å; W42-W47 HydrophobicContact CE3-CG 3.54Å; W42-W47 AromaticContact CE3-CZ2 4Å; W42-W47 HydrophobicContact CE3-CZ2 4Å; W42-W47 AromaticContact CE3-NE1 3.45Å; W42-W47 AromaticContact CZ3-CD1 3.3Å; W42-W47 HydrophobicContact CZ3-CD2 4.04Å; W42-W47 AromaticContact CZ3-CE2 3.76Å; W42-W47 AromaticContact CZ3-CG 3.73Å; W42-W47 HydrophobicContact CZ3-CG 3.73Å; W42-W47 AromaticContact CZ3-NE1 3.28Å; W42-W47 VanDerWaalsContact CZ3-NE1 3.28Å
43	Y	71.1	Confident	65.8	Low	170 Å²	170	79.2 Å²	79.2	67%	0.667	41%	0.406	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-143.2	140.4	179.1	-177.3	-100.9	0	0	0	110.3	S45 Q46 Y48	Y43-S45 PolarHBondContact O-N 2.83Å; Y43-S45 VanDerWaalsContact O-N 3.08Å; Y43-Q46 PolarHBondContact N-O 3.35Å; Y43-Q46 PolarHBondContact O-N 2.88Å; Y43-Q46 VanDerWaalsContact O-O 3.05Å; Y43-Y48 HydrophobicContact CD1-CE2 4.17Å; Y43-Y48 WeakPolarHBondContact O-CE2 3.37Å
44	N	82.3	Confident	66.2	Low	128 Å²	128	78.8 Å²	78.8	68%	0.684	40%	0.401	S	S	*	.	T	Hydrogen-bonded Turn	trans	43.6	45.6	179	-162.8	34.5	0	0	0	115.1	Q46	N44-Q46 VanDerWaalsContact C-N 3.27Å; N44-Q46 PolarHBondContact O-N 3.12Å
45	S	81.5	Confident	66.4	Low	92 Å²	92	82.7 Å²	82.7	64%	0.643	42%	0.419	S	S	*	.	T	Hydrogen-bonded Turn	trans	64.4	21	-178.6	-57.5	0	0	0	0	116.1	W42 Y43	W42-S45 WeakPolarHBondContact CH2-O 3.26Å; Y43-S45 PolarHBondContact O-N 2.83Å; Y43-S45 VanDerWaalsContact O-N 3.08Å
46	Q	75.8	Confident	66.4	Low	113 Å²	113	84.4 Å²	84.4	53%	0.528	43%	0.431	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.4	150	176	-64.4	-176.2	-9.4	0	0	111.5	W42 Y43 N44 Y48	W42-Q46 WeakPolarHBondContact CA-O 3.22Å; Y43-Q46 PolarHBondContact N-O 3.35Å; Y43-Q46 PolarHBondContact O-N 2.88Å; Y43-Q46 VanDerWaalsContact O-O 3.05Å; N44-Q46 VanDerWaalsContact C-N 3.27Å; N44-Q46 PolarHBondContact O-N 3.12Å; Q46-Y48 HydrophobicContact CB-CE2 3.94Å
47	W	74.6	Confident	66.5	Low	125 Å²	125	87.3 Å²	87.3	47%	0.473	45%	0.451	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.1	131.1	169.6	-75.7	110.5	0	0	0	109.9	V5 W42	V5-W47 HydrophobicContact CG1-CH2 4.39Å; W42-W47 HydrophobicContact CB-CE3 4.19Å; W42-W47 HydrophobicContact CB-CH2 4.38Å; W42-W47 HydrophobicContact CB-CZ3 4.05Å; W42-W47 HydrophobicContact CE3-CB 4.33Å; W42-W47 AromaticContact CE3-CD1 3.57Å; W42-W47 AromaticContact CE3-CD2 3.46Å; W42-W47 HydrophobicContact CE3-CD2 3.46Å; W42-W47 VanDerWaalsContact CE3-CD2 3.46Å; W42-W47 AromaticContact CE3-CE2 3.39Å; W42-W47 HydrophobicContact CE3-CE3 4.13Å; W42-W47 AromaticContact CE3-CG 3.54Å; W42-W47 HydrophobicContact CE3-CG 3.54Å; W42-W47 AromaticContact CE3-CZ2 4Å; W42-W47 HydrophobicContact CE3-CZ2 4Å; W42-W47 AromaticContact CE3-NE1 3.45Å; W42-W47 AromaticContact CZ3-CD1 3.3Å; W42-W47 HydrophobicContact CZ3-CD2 4.04Å; W42-W47 AromaticContact CZ3-CE2 3.76Å; W42-W47 AromaticContact CZ3-CG 3.73Å; W42-W47 HydrophobicContact CZ3-CG 3.73Å; W42-W47 AromaticContact CZ3-NE1 3.28Å; W42-W47 VanDerWaalsContact CZ3-NE1 3.28Å
48	Y	66.2	Low	66.5	Low	94 Å²	94	87.7 Å²	87.7	37%	0.369	46%	0.456	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.1	137.6	172	-67.6	-92	0	0	0	109.4	Y40 G41 Y43 Q46	Y40-Y48 WeakPolarHBondContact CA-O 3.1Å; G41-Y48 PolarHBondContact N-O 3Å; G41-Y48 PolarHBondContact O-N 2.93Å; Y43-Y48 HydrophobicContact CD1-CE2 4.17Å; Y43-Y48 WeakPolarHBondContact O-CE2 3.37Å; Q46-Y48 HydrophobicContact CB-CE2 3.94Å
49	I	70.6	Confident	66.4	Low	99 Å²	99	89.6 Å²	89.6	51%	0.508	47%	0.47	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.1	112.4	172.1	-54.1	180	0	0	0	106.8	F38 Y40	F38-I49 HydrophobicContact CB-CG2 4.31Å; F38-I49 HydrophobicContact CD1-CG2 3.84Å; F38-I49 HydrophobicContact CG-CG2 4.49Å; Y40-I49 HydrophobicContact CD1-CD1 4.37Å; Y40-I49 HydrophobicContact CD1-CG1 3.77Å; Y40-I49 HydrophobicContact CE1-CD1 3.72Å; Y40-I49 HydrophobicContact CE1-CG1 3.61Å; Y40-I49 HydrophobicContact CE1-CG2 4.34Å
50	H	62.2	Low	65.8	Low	125 Å²	125	87.5 Å²	87.5	58%	0.579	47%	0.468	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-87.4	113.1	162.8	-74.9	-98.6	0	0	0	107.6	Q39 G52	Q39-H50 HydrophobicContact CB-CB 4.39Å; Q39-H50 PolarHBondContact N-O 3.5Å; Q39-H50 WeakPolarHBondContact O-CB 3.38Å; Q39-H50 PolarHBondContact O-N 3.02Å; H50-G52 PolarHBondContact O-N 2.93Å
51	V	64	Low	65.3	Low	93 Å²	93	92 Å²	92	56%	0.564	49%	0.489	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-70.1	112.2	168.3	-172.7	0	0	0	0	106.4	Y36 F38	Y36-V51 HydrophobicContact CD1-CG1 4.23Å; F38-V51 HydrophobicContact CD1-CB 4.34Å; F38-V51 HydrophobicContact CD1-CG1 4.22Å; F38-V51 HydrophobicContact CD1-CG2 4.04Å; F38-V51 HydrophobicContact CE1-CB 4.31Å; F38-V51 HydrophobicContact CE1-CG1 3.87Å; F38-V51 HydrophobicContact CE1-CG2 3.89Å
52	G	58.6	Low	64.6	Low	36 Å²	36	96 Å²	96	37%	0.371	53%	0.53	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.5	-155	176.2	0	0	0	0	0	111.5	T37 H50	T37-G52 WeakPolarHBondContact O-CA 3.33Å; T37-G52 PolarHBondContact O-N 2.99Å; H50-G52 PolarHBondContact O-N 2.93Å
53	C	55.6	Low	64.3	Low	92 Å²	92	96.9 Å²	96.9	62%	0.622	54%	0.542	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-70.6	141.1	-177	-62.4	0	0	0	0	111.6	T37	T37-C53 PolarHBondContact N-O 2.97Å
54	F	63.6	Low	63.9	Low	72 Å²	72	93.1 Å²	93.1	32%	0.316	54%	0.535	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.2	114.8	164	173.9	-109.6	0	0	0	108.3	V32 Y36 V56	V32-F54 HydrophobicContact CG1-CE1 3.9Å; V32-F54 HydrophobicContact CG1-CZ 3.85Å; Y36-F54 HydrophobicContact CD1-CB 4.33Å; Y36-F54 HydrophobicContact CD1-CD2 4.1Å; Y36-F54 AromaticContact CD2-CD2 3.94Å; Y36-F54 HydrophobicContact CD2-CD2 3.94Å; Y36-F54 HydrophobicContact CD2-CE2 4.3Å; Y36-F54 HydrophobicContact CE1-CB 3.98Å; Y36-F54 AromaticContact CE1-CD2 3.6Å; Y36-F54 HydrophobicContact CE1-CD2 3.6Å; Y36-F54 HydrophobicContact CE1-CE2 4.42Å; Y36-F54 HydrophobicContact CE1-CG 4.15Å; Y36-F54 AromaticContact CE2-CD2 3.36Å; Y36-F54 HydrophobicContact CE2-CD2 3.36Å; Y36-F54 AromaticContact CE2-CE2 3.49Å; Y36-F54 HydrophobicContact CE2-CE2 3.49Å; Y36-F54 VanDerWaalsContact CE2-CE2 3.49Å; Y36-F54 HydrophobicContact CG-CD2 4.26Å; Y36-F54 AromaticContact CZ-CD2 3.18Å; Y36-F54 AromaticContact CZ-CE2 3.57Å; Y36-F54 WeakPolarHBondContact OH-CD2 3.32Å; Y36-F54 WeakPolarHBondContact OH-CE2 3.32Å; F54-V56 HydrophobicContact CD1-CG2 4.01Å; F54-V56 HydrophobicContact CE1-CG2 3.51Å; F54-V56 HydrophobicContact CZ-CG2 4.35Å
55	N	60.9	Low	62.9	Low	92 Å²	92	91.1 Å²	91.1	49%	0.492	53%	0.527	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.3	116.8	174.7	-74.1	-40.5	0	0	0	109	G34 D35 V57	G34-N55 CarbonylContact C-O 3.39Å; G34-N55 WeakPolarHBondContact CA-O 3.25Å; D35-N55 PolarHBondContact N-O 3.21Å; D35-N55 PolarHBondContact O-N 2.76Å; N55-V57 PolarHBondContact O-N 3.06Å
56	V	62.2	Low	61.8	Low	78 Å²	78	91.1 Å²	91.1	47%	0.473	52%	0.52	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-69.7	113.5	172.6	177.5	0	0	0	0	108.8	V32 F54 V59	V32-V56 HydrophobicContact CG1-CB 4.23Å; V32-V56 HydrophobicContact CG1-CG1 3.68Å; V32-V56 HydrophobicContact CG1-CG2 3.65Å; F54-V56 HydrophobicContact CD1-CG2 4.01Å; F54-V56 HydrophobicContact CE1-CG2 3.51Å; F54-V56 HydrophobicContact CZ-CG2 4.35Å; V56-V59 HydrophobicContact CG1-CG2 3.45Å; V56-V59 VanDerWaalsContact CG1-CG2 3.45Å
57	V	62.1	Low	60.9	Low	89 Å²	89	89.7 Å²	89.7	54%	0.539	52%	0.52	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.3	-29.6	177.6	-150.1	0	0	0	0	111.1	L33 D35 N55	L33-V57 PolarHBondContact O-N 3.08Å; D35-V57 HydrophobicContact CB-CG2 4.25Å; D35-V57 VanDerWaalsContact OD2-CG2 3.22Å; D35-V57 WeakPolarHBondContact OD2-CG2 3.45Å; N55-V57 PolarHBondContact O-N 3.06Å
58	S	58.4	Low	60	Low	53 Å²	53	87.3 Å²	87.3	37%	0.371	52%	0.523	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-157.5	145	-178.6	161.9	0	0	0	0	111.6	L33	L33-S58 PolarHBondContact N-O 2.89Å; L33-S58 PolarHBondContact O-N 2.77Å; L33-S58 VanDerWaalsContact O-N 3.12Å
59	V	59.8	Low	59.6	Low	76 Å²	76	86.9 Å²	86.9	46%	0.461	53%	0.534	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.1	109.2	171.7	-175.2	0	0	0	0	108.2	R30 I31 V32 V56	R30-V59 HydrophobicContact CB-CG1 4.06Å; R30-V59 HydrophobicContact CG-CG1 4.18Å; I31-V59 WeakPolarHBondContact O-CA 3.36Å; V32-V59 HydrophobicContact CG1-CG2 4.43Å; V32-V59 HydrophobicContact CG2-CG1 4.44Å; V32-V59 HydrophobicContact CG2-CG2 4.4Å; V56-V59 HydrophobicContact CG1-CG2 3.45Å; V56-V59 VanDerWaalsContact CG1-CG2 3.45Å
60	A	51.5	Low	58.8	Low	46 Å²	46	85.9 Å²	85.9	38%	0.38	54%	0.536	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.4	132.4	172.5	0	0	0	0	0	109.5	R30 I31	R30-A60 CarbonylContact C-O 3.57Å; R30-A60 VanDerWaalsContact CA-O 3.25Å; R30-A60 WeakPolarHBondContact CA-O 3.26Å; I31-A60 PolarHBondContact N-O 2.77Å; I31-A60 PolarHBondContact O-N 3.08Å
61	K	53.8	Low	58.5	Low	156 Å²	156	82.7 Å²	82.7	68%	0.678	53%	0.532	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-90.2	118.8	171.5	-161.3	-177.2	-179.6	-173	0	107.9	T29 R30	T29-K61 CarbonylContact O-C 3.56Å; T29-K61 WeakPolarHBondContact O-CA 2.97Å; R30-K61 HydrophobicContact CG-CB 4.42Å; R30-K61 HydrophobicContact CG-CG 4.19Å
62	G	51.1	Low	58	Low	109 Å²	109	81.7 Å²	81.7	100%	1.124	53%	0.53	S	S	*	.			trans	-71.7	0	168.5	0	0	0	0	0	112	T29	T29-G62 PolarHBondContact O-N 2.92Å

Retrieved 62 of 62 residues in 17.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).