A0A077Z626_TRITR Loading...

InaF-motif domain containing protein

AlphaFold DB , UniProt , Accession A0A077Z626, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 73 aa.

						>A0A077Z626_TRITR|A0A077Z626
MEFAQAASLSQRRLNVKCHFFRILLLWIRFATVIGYICSVCLPAIALSIYYIGFWDPQYKEKVDVFLNFLIFF
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	79.2	Confident	86.4	Confident	205 Å²	205	112.8 Å²	112.8	100%	1.01	62%	0.623	S	S	*	*				0	-42.8	0	-71.9	-177.5	-80.1	0	0	111.5	F3 A4	M1-F3 VanDerWaalsContact C-N 3.35Å; M1-F3 PolarHBondContact O-N 3.1Å; M1-A4 PolarHBondContact O-N 3.01Å; M1-A4 VanDerWaalsContact O-N 3.1Å
2	E	85.8	Confident	86.2	Confident	146 Å²	146	119.4 Å²	119.4	68%	0.682	63%	0.632	S	S	*	*	H	α-helix	trans	-45.4	-44.6	176.3	-60.8	-62.7	101.3	0	0	116.2	A4 Q5 A6	E2-A4 VanDerWaalsContact C-N 3.28Å; E2-A4 PolarHBondContact O-N 3.21Å; E2-Q5 PolarHBondContact O-N 3.5Å; E2-A6 PolarHBondContact O-N 3.29Å
3	F	84.3	Confident	86	Confident	188 Å²	188	125.2 Å²	125.2	83%	0.825	64%	0.64	S	S	*	*	H	α-helix	trans	-62.5	-30.8	-178.4	-66.1	-74.6	0	0	0	114	M1 A6 A7	M1-F3 VanDerWaalsContact C-N 3.35Å; M1-F3 PolarHBondContact O-N 3.1Å; F3-A6 PolarHBondContact O-N 3.24Å; F3-A7 PolarHBondContact O-N 2.85Å; F3-A7 VanDerWaalsContact O-N 3.16Å
4	A	90.1	Very high	85.7	Confident	70 Å²	70	123.4 Å²	123.4	58%	0.579	63%	0.632	S	S	*	*	H	α-helix	trans	-71.1	-35.4	178.1	0	0	0	0	0	111.8	M1 E2 S8	M1-A4 PolarHBondContact O-N 3.01Å; M1-A4 VanDerWaalsContact O-N 3.1Å; E2-A4 VanDerWaalsContact C-N 3.28Å; E2-A4 PolarHBondContact O-N 3.21Å; A4-S8 PolarHBondContact O-N 3.31Å; A4-S8 PolarHBondContact O-OG 3.02Å
5	Q	90.2	Very high	85.6	Confident	115 Å²	115	122.8 Å²	122.8	54%	0.537	63%	0.63	S	S	.	*	H	α-helix	trans	-67.7	-41.5	174.9	-71.9	171.7	-95.2	0	0	111.1	E2 A7 S8 L9	E2-Q5 PolarHBondContact O-N 3.5Å; Q5-A7 PolarHBondContact O-N 3.05Å; Q5-S8 PolarHBondContact O-N 3.2Å; Q5-S8 PolarHBondContact O-OG 3.47Å; Q5-L9 WeakPolarHBondContact O-CG 3.25Å; Q5-L9 PolarHBondContact O-N 2.81Å; Q5-L9 VanDerWaalsContact O-N 3.12Å
6	A	90.1	Very high	85.5	Confident	60 Å²	60	121.6 Å²	121.6	50%	0.496	63%	0.63	S	S	.	*	H	α-helix	trans	-62.4	-43.1	176.7	0	0	0	0	0	113.1	E2 F3 L9 S10	E2-A6 PolarHBondContact O-N 3.29Å; F3-A6 PolarHBondContact O-N 3.24Å; A6-L9 PolarHBondContact O-N 3.11Å; A6-S10 PolarHBondContact O-N 3.23Å
7	A	88.2	Confident	85.3	Confident	61 Å²	61	123.3 Å²	123.3	50%	0.504	63%	0.631	S	S	.	*	H	α-helix	trans	-64	-42.2	178.6	0	0	0	0	0	112.4	F3 Q5 S10 Q11	F3-A7 PolarHBondContact O-N 2.85Å; F3-A7 VanDerWaalsContact O-N 3.16Å; Q5-A7 PolarHBondContact O-N 3.05Å; A7-S10 PolarHBondContact O-N 3.35Å; A7-Q11 WeakPolarHBondContact O-CB 3.32Å; A7-Q11 PolarHBondContact O-N 3.44Å
8	S	87.3	Confident	85	Confident	65 Å²	65	120.9 Å²	120.9	46%	0.455	63%	0.627	S	S	.	*	H	α-helix	trans	-67.8	-36.2	178.5	64.4	0	0	0	0	113.5	A4 Q5 Q11 R12	A4-S8 PolarHBondContact O-N 3.31Å; A4-S8 PolarHBondContact O-OG 3.02Å; Q5-S8 PolarHBondContact O-N 3.2Å; Q5-S8 PolarHBondContact O-OG 3.47Å; S8-Q11 PolarHBondContact O-N 3.37Å; S8-R12 PolarHBondContact O-N 2.87Å
9	L	85.9	Confident	84.9	Confident	114 Å²	114	120.6 Å²	120.6	60%	0.597	62%	0.622	S	S	*	*	H	α-helix	trans	-65.7	-43	172.8	-71.5	175	0	0	0	111.4	Q5 A6 R12 R13	Q5-L9 WeakPolarHBondContact O-CG 3.25Å; Q5-L9 PolarHBondContact O-N 2.81Å; Q5-L9 VanDerWaalsContact O-N 3.12Å; A6-L9 PolarHBondContact O-N 3.11Å; L9-R12 PolarHBondContact O-N 3.48Å; L9-R13 WeakPolarHBondContact O-CG 3.35Å; L9-R13 PolarHBondContact O-N 2.93Å
10	S	84.8	Confident	84.9	Confident	69 Å²	69	121 Å²	121	48%	0.483	62%	0.619	S	S	.	*	H	α-helix	trans	-60.9	-45	175.2	-172.2	0	0	0	0	111.6	A6 A7 R12 R13 L14	A6-S10 PolarHBondContact O-N 3.23Å; A7-S10 PolarHBondContact O-N 3.35Å; S10-R12 PolarHBondContact O-N 2.82Å; S10-R13 PolarHBondContact O-N 3.49Å; S10-R13 VanDerWaalsContact O-N 3.16Å; S10-L14 WeakPolarHBondContact O-CG 3.32Å; S10-L14 PolarHBondContact O-N 3.2Å
11	Q	84.7	Confident	84.8	Confident	148 Å²	148	121.3 Å²	121.3	69%	0.692	62%	0.616	S	S	*	*	H	α-helix	trans	-65.2	-38.8	178.8	-163	142.2	-72.3	0	0	112.4	A7 S8 L14 N15	A7-Q11 WeakPolarHBondContact O-CB 3.32Å; A7-Q11 PolarHBondContact O-N 3.44Å; S8-Q11 PolarHBondContact O-N 3.37Å; Q11-L14 PolarHBondContact O-N 3.22Å; Q11-N15 PolarHBondContact O-N 3.39Å
12	R	83.3	Confident	85	Confident	192 Å²	192	120.2 Å²	120.2	73%	0.725	60%	0.601	S	S	*	*	H	α-helix	trans	-61.7	-43.7	171.4	-79.2	-161.4	-164.2	-140	6.8	111.9	S8 L9 S10 L14 N15 V16	S8-R12 PolarHBondContact O-N 2.87Å; L9-R12 PolarHBondContact O-N 3.48Å; S10-R12 PolarHBondContact O-N 2.82Å; R12-L14 VanDerWaalsContact C-N 3.3Å; R12-L14 PolarHBondContact O-N 3.3Å; R12-N15 PolarHBondContact O-N 3.29Å; R12-V16 WeakPolarHBondContact O-CG2 3.49Å; R12-V16 PolarHBondContact O-N 3.27Å
13	R	83.6	Confident	85	Confident	195 Å²	195	116.6 Å²	116.6	74%	0.736	59%	0.585	S	S	*	*	H	α-helix	trans	-63.2	-38	179.9	-66.1	-84	-85.4	-150	-3.7	111.4	L9 S10 K17	L9-R13 WeakPolarHBondContact O-CG 3.35Å; L9-R13 PolarHBondContact O-N 2.93Å; S10-R13 PolarHBondContact O-N 3.49Å; S10-R13 VanDerWaalsContact O-N 3.16Å; R13-K17 WeakPolarHBondContact O-CG 3.47Å; R13-K17 PolarHBondContact O-N 2.98Å; R13-K17 VanDerWaalsContact O-N 3.13Å
14	L	82	Confident	85	Confident	100 Å²	100	111.5 Å²	111.5	52%	0.524	57%	0.566	S	S	.	*	H	α-helix	trans	-66.9	-44.1	174.4	-70.3	170.8	0	0	0	112	S10 Q11 R12 V16 K17 C18	S10-L14 WeakPolarHBondContact O-CG 3.32Å; S10-L14 PolarHBondContact O-N 3.2Å; Q11-L14 PolarHBondContact O-N 3.22Å; R12-L14 VanDerWaalsContact C-N 3.3Å; R12-L14 PolarHBondContact O-N 3.3Å; L14-V16 PolarHBondContact O-N 2.9Å; L14-K17 PolarHBondContact O-N 3.46Å; L14-C18 WeakPolarHBondContact O-CB 3.23Å; L14-C18 PolarHBondContact O-N 2.84Å; L14-C18 PolarHBondContact O-SG 3.5Å; L14-C18 VanDerWaalsContact O-SG 3.38Å
15	N	84	Confident	84.7	Confident	114 Å²	114	112.4 Å²	112.4	61%	0.61	56%	0.56	S	S	*	*	H	α-helix	trans	-64.3	-39.7	179.7	-157.8	4.3	0	0	0	112.1	Q11 R12 C18 H19	Q11-N15 PolarHBondContact O-N 3.39Å; R12-N15 PolarHBondContact O-N 3.29Å; N15-C18 PolarHBondContact O-N 3.15Å; N15-H19 WeakPolarHBondContact O-CB 3.47Å; N15-H19 PolarHBondContact O-N 3.45Å
16	V	83.7	Confident	84.5	Confident	103 Å²	103	111.4 Å²	111.4	62%	0.624	56%	0.559	S	S	*	*	H	α-helix	trans	-64.6	-42.7	175	176.1	0	0	0	0	111.6	R12 L14 H19 F20	R12-V16 WeakPolarHBondContact O-CG2 3.49Å; R12-V16 PolarHBondContact O-N 3.27Å; L14-V16 PolarHBondContact O-N 2.9Å; V16-H19 PolarHBondContact O-N 3.35Å; V16-F20 WeakPolarHBondContact O-CB 3.36Å; V16-F20 PolarHBondContact O-N 2.86Å
17	K	83.2	Confident	84.5	Confident	151 Å²	151	117.4 Å²	117.4	66%	0.657	57%	0.568	S	S	*	*	H	α-helix	trans	-62.4	-44.7	175.1	-80.9	-178.2	171.5	-178	0	111.9	R13 L14 F20 F21	R13-K17 WeakPolarHBondContact O-CG 3.47Å; R13-K17 PolarHBondContact O-N 2.98Å; R13-K17 VanDerWaalsContact O-N 3.13Å; L14-K17 PolarHBondContact O-N 3.46Å; K17-F20 PolarHBondContact O-N 3.28Å; K17-F21 WeakPolarHBondContact O-CB 3.06Å; K17-F21 PolarHBondContact O-N 3.28Å
18	C	78.8	Confident	84.7	Confident	81 Å²	81	119 Å²	119	55%	0.547	57%	0.568	S	S	.	*	H	α-helix	trans	-62.9	-41.6	177.2	-74.5	0	0	0	0	112	L14 N15 F21 R22	L14-C18 WeakPolarHBondContact O-CB 3.23Å; L14-C18 PolarHBondContact O-N 2.84Å; L14-C18 PolarHBondContact O-SG 3.5Å; L14-C18 VanDerWaalsContact O-SG 3.38Å; N15-C18 PolarHBondContact O-N 3.15Å; C18-F21 PolarHBondContact O-N 3.34Å; C18-R22 WeakPolarHBondContact O-CB 3.34Å; C18-R22 PolarHBondContact O-N 2.83Å
19	H	84.4	Confident	84.7	Confident	115 Å²	115	124.2 Å²	124.2	53%	0.532	58%	0.577	S	S	.	*	H	α-helix	trans	-64.7	-43	177.4	-162.1	-78.3	0	0	0	111.6	N15 V16 R22 I23	N15-H19 WeakPolarHBondContact O-CB 3.47Å; N15-H19 PolarHBondContact O-N 3.45Å; V16-H19 PolarHBondContact O-N 3.35Å; H19-R22 PolarHBondContact O-N 2.83Å; H19-I23 WeakPolarHBondContact O-CG1 3.32Å; H19-I23 PolarHBondContact O-N 3.27Å
20	F	84.4	Confident	85	Confident	128 Å²	128	125.3 Å²	125.3	56%	0.561	58%	0.578	S	S	*	*	H	α-helix	trans	-62.9	-44.5	175.3	-175.2	-107.8	0	0	0	112.1	V16 K17 R22 I23 L24	V16-F20 WeakPolarHBondContact O-CB 3.36Å; V16-F20 PolarHBondContact O-N 2.86Å; K17-F20 PolarHBondContact O-N 3.28Å; F20-R22 VanDerWaalsContact C-N 3.34Å; F20-R22 PolarHBondContact O-N 3.37Å; F20-I23 PolarHBondContact O-N 2.98Å; F20-L24 HydrophobicContact CD1-CD1 3.82Å; F20-L24 HydrophobicContact CD1-CG 4.36Å; F20-L24 HydrophobicContact CE1-CD1 3.47Å; F20-L24 VanDerWaalsContact CE1-CD1 3.47Å; F20-L24 HydrophobicContact CE1-CD2 4.47Å; F20-L24 HydrophobicContact CE1-CG 4.06Å; F20-L24 HydrophobicContact CZ-CD1 4.11Å; F20-L24 HydrophobicContact CZ-CD2 4.28Å; F20-L24 HydrophobicContact CZ-CG 4.27Å; F20-L24 PolarHBondContact O-N 3.18Å
21	F	82.8	Confident	85.4	Confident	127 Å²	127	124.6 Å²	124.6	56%	0.557	58%	0.575	S	S	*	*	H	α-helix	trans	-62	-39.3	177.1	-171.5	-105.1	0	0	0	112.7	K17 C18 I23 L24 L25	K17-F21 WeakPolarHBondContact O-CB 3.06Å; K17-F21 PolarHBondContact O-N 3.28Å; C18-F21 PolarHBondContact O-N 3.34Å; F21-I23 VanDerWaalsContact C-N 3.33Å; F21-I23 PolarHBondContact O-N 3.18Å; F21-L24 PolarHBondContact O-N 3.04Å; F21-L25 HydrophobicContact CD1-CD1 3.91Å; F21-L25 HydrophobicContact CD1-CG 4.36Å; F21-L25 HydrophobicContact CE1-CD1 3.59Å; F21-L25 HydrophobicContact CE1-CD2 4.44Å; F21-L25 HydrophobicContact CE1-CG 4.07Å; F21-L25 HydrophobicContact CZ-CD1 4.29Å; F21-L25 HydrophobicContact CZ-CD2 4.35Å; F21-L25 HydrophobicContact CZ-CG 4.36Å; F21-L25 WeakPolarHBondContact O-CG 3.05Å; F21-L25 PolarHBondContact O-N 2.82Å
22	R	82.9	Confident	85.8	Confident	183 Å²	183	121.7 Å²	121.7	69%	0.691	57%	0.568	S	S	*	*	H	α-helix	trans	-62.3	-39.5	176	-171.7	-177.3	-66.8	-95.3	1.6	112.2	C18 H19 F20 L26	C18-R22 WeakPolarHBondContact O-CB 3.34Å; C18-R22 PolarHBondContact O-N 2.83Å; H19-R22 PolarHBondContact O-N 2.83Å; F20-R22 VanDerWaalsContact C-N 3.34Å; F20-R22 PolarHBondContact O-N 3.37Å; R22-L26 PolarHBondContact O-N 3.27Å
23	I	86.8	Confident	86.3	Confident	69 Å²	69	116.7 Å²	116.7	35%	0.354	56%	0.559	S	S	.	*	H	α-helix	trans	-65	-49.9	175.5	-67	163.8	0	0	0	109.4	H19 F20 F21 L25 L26 W27	H19-I23 WeakPolarHBondContact O-CG1 3.32Å; H19-I23 PolarHBondContact O-N 3.27Å; F20-I23 PolarHBondContact O-N 2.98Å; F21-I23 VanDerWaalsContact C-N 3.33Å; F21-I23 PolarHBondContact O-N 3.18Å; I23-L25 PolarHBondContact O-N 3.44Å; I23-L26 WeakPolarHBondContact O-CB 3.36Å; I23-L26 PolarHBondContact O-N 2.84Å; I23-W27 VanDerWaalsContact O-CD1 3.25Å; I23-W27 PolarHBondContact O-N 3.31Å
24	L	84.9	Confident	86.8	Confident	82 Å²	82	112.3 Å²	112.3	43%	0.429	55%	0.549	S	S	.	.	H	α-helix	trans	-53.9	-39.1	178.6	-72.4	176.3	0	0	0	113.1	F20 F21 L26 W27 I28	F20-L24 HydrophobicContact CD1-CD1 3.82Å; F20-L24 HydrophobicContact CD1-CG 4.36Å; F20-L24 HydrophobicContact CE1-CD1 3.47Å; F20-L24 VanDerWaalsContact CE1-CD1 3.47Å; F20-L24 HydrophobicContact CE1-CD2 4.47Å; F20-L24 HydrophobicContact CE1-CG 4.06Å; F20-L24 HydrophobicContact CZ-CD1 4.11Å; F20-L24 HydrophobicContact CZ-CD2 4.28Å; F20-L24 HydrophobicContact CZ-CG 4.27Å; F20-L24 PolarHBondContact O-N 3.18Å; F21-L24 PolarHBondContact O-N 3.04Å; L24-L26 VanDerWaalsContact C-N 3.29Å; L24-L26 PolarHBondContact O-N 3.43Å; L24-W27 PolarHBondContact O-N 3.22Å; L24-I28 PolarHBondContact O-N 3.15Å
25	L	83.1	Confident	87.4	Confident	88 Å²	88	109.4 Å²	109.4	46%	0.461	54%	0.543	S	S	.	.	H	α-helix	trans	-65.4	-26.8	177	-74.3	175.9	0	0	0	114	F21 I23 I28 R29	F21-L25 HydrophobicContact CD1-CD1 3.91Å; F21-L25 HydrophobicContact CD1-CG 4.36Å; F21-L25 HydrophobicContact CE1-CD1 3.59Å; F21-L25 HydrophobicContact CE1-CD2 4.44Å; F21-L25 HydrophobicContact CE1-CG 4.07Å; F21-L25 HydrophobicContact CZ-CD1 4.29Å; F21-L25 HydrophobicContact CZ-CD2 4.35Å; F21-L25 HydrophobicContact CZ-CG 4.36Å; F21-L25 WeakPolarHBondContact O-CG 3.05Å; F21-L25 PolarHBondContact O-N 2.82Å; I23-L25 PolarHBondContact O-N 3.44Å; L25-I28 HydrophobicContact CD2-CG2 4.45Å; L25-I28 VanDerWaalsContact O-CG2 3.23Å; L25-I28 WeakPolarHBondContact O-CG2 2.9Å; L25-R29 WeakPolarHBondContact O-CG 3.16Å
26	L	86.2	Confident	87.9	Confident	95 Å²	95	111.9 Å²	111.9	50%	0.497	55%	0.545	S	S	.	.	H	α-helix	trans	-76.6	-44.1	172.8	-69.8	166.8	0	0	0	110.5	R22 I23 L24 I28 R29 F30	R22-L26 PolarHBondContact O-N 3.27Å; I23-L26 WeakPolarHBondContact O-CB 3.36Å; I23-L26 PolarHBondContact O-N 2.84Å; L24-L26 VanDerWaalsContact C-N 3.29Å; L24-L26 PolarHBondContact O-N 3.43Å; L26-I28 PolarHBondContact O-N 3.02Å; L26-R29 WeakPolarHBondContact O-CB 3.33Å; L26-R29 PolarHBondContact O-N 3.34Å; L26-F30 WeakPolarHBondContact O-CD2 3.42Å; L26-F30 PolarHBondContact O-N 3.24Å
27	W	90.2	Very high	88.4	Confident	185 Å²	185	111.2 Å²	111.2	70%	0.701	54%	0.537	S	S	*	.	H	α-helix	trans	-61.1	-41.9	178.5	-77.8	88.6	0	0	0	112.6	I23 L24 R29 F30 A31	I23-W27 VanDerWaalsContact O-CD1 3.25Å; I23-W27 PolarHBondContact O-N 3.31Å; L24-W27 PolarHBondContact O-N 3.22Å; W27-R29 VanDerWaalsContact C-N 3.29Å; W27-R29 PolarHBondContact O-N 3.45Å; W27-F30 PolarHBondContact O-N 3.46Å; W27-A31 PolarHBondContact O-N 3.3Å
28	I	91.3	Very high	88.8	Confident	96 Å²	96	107.1 Å²	107.1	49%	0.492	53%	0.526	S	S	.	.	H	α-helix	trans	-63.4	-34.4	177.4	-168.1	64.3	0	0	0	112.1	L24 L25 L26 F30 A31 T32	L24-I28 PolarHBondContact O-N 3.15Å; L25-I28 HydrophobicContact CD2-CG2 4.45Å; L25-I28 VanDerWaalsContact O-CG2 3.23Å; L25-I28 WeakPolarHBondContact O-CG2 2.9Å; L26-I28 PolarHBondContact O-N 3.02Å; I28-F30 PolarHBondContact O-N 3.03Å; I28-A31 PolarHBondContact O-N 3.28Å; I28-T32 WeakPolarHBondContact O-CG2 3.33Å; I28-T32 PolarHBondContact O-N 2.93Å; I28-T32 PolarHBondContact O-OG1 3.49Å
29	R	87.6	Confident	89.4	Confident	174 Å²	174	107.1 Å²	107.1	66%	0.657	53%	0.527	S	S	*	.	H	α-helix	trans	-62.8	-43.6	175.8	-72.1	176.3	70.9	164.2	4.3	111.3	L25 L26 W27 T32 V33	L25-R29 WeakPolarHBondContact O-CG 3.16Å; L26-R29 WeakPolarHBondContact O-CB 3.33Å; L26-R29 PolarHBondContact O-N 3.34Å; W27-R29 VanDerWaalsContact C-N 3.29Å; W27-R29 PolarHBondContact O-N 3.45Å; R29-T32 PolarHBondContact O-N 3Å; R29-T32 PolarHBondContact O-OG1 2.97Å; R29-V33 WeakPolarHBondContact O-CG2 3.4Å; R29-V33 PolarHBondContact O-N 3.25Å
30	F	92.3	Very high	89.8	Confident	137 Å²	137	105 Å²	105	60%	0.601	52%	0.523	S	S	*	.	H	α-helix	trans	-65	-43.6	175.3	-69.2	-71.2	0	0	0	111.5	L26 W27 I28 T32 V33 I34	L26-F30 WeakPolarHBondContact O-CD2 3.42Å; L26-F30 PolarHBondContact O-N 3.24Å; W27-F30 PolarHBondContact O-N 3.46Å; I28-F30 PolarHBondContact O-N 3.03Å; F30-T32 VanDerWaalsContact C-N 3.32Å; F30-T32 PolarHBondContact O-N 3.39Å; F30-V33 PolarHBondContact O-N 3.15Å; F30-V33 VanDerWaalsContact O-N 3.15Å; F30-I34 WeakPolarHBondContact O-CG1 3.17Å; F30-I34 PolarHBondContact O-N 3.37Å
31	A	92.8	Very high	90.2	Very high	53 Å²	53	101.7 Å²	101.7	44%	0.438	52%	0.515	S	S	.	.	H	α-helix	trans	-60	-40.7	178.5	0	0	0	0	0	112.5	W27 I28 V33 I34 G35	W27-A31 PolarHBondContact O-N 3.3Å; I28-A31 PolarHBondContact O-N 3.28Å; A31-V33 VanDerWaalsContact C-N 3.34Å; A31-V33 PolarHBondContact O-N 3.48Å; A31-I34 PolarHBondContact O-N 2.81Å; A31-G35 PolarHBondContact O-N 3.46Å
32	T	93.5	Very high	90.4	Very high	88 Å²	88	101.3 Å²	101.3	54%	0.54	52%	0.518	S	S	.	.	H	α-helix	trans	-65.7	-36.7	176.6	50.9	0	0	0	0	112.7	I28 R29 F30 Y36	I28-T32 WeakPolarHBondContact O-CG2 3.33Å; I28-T32 PolarHBondContact O-N 2.93Å; I28-T32 PolarHBondContact O-OG1 3.49Å; R29-T32 PolarHBondContact O-N 3Å; R29-T32 PolarHBondContact O-OG1 2.97Å; F30-T32 VanDerWaalsContact C-N 3.32Å; F30-T32 PolarHBondContact O-N 3.39Å; T32-Y36 WeakPolarHBondContact O-CB 3.44Å; T32-Y36 PolarHBondContact O-N 3.4Å
33	V	94.2	Very high	90.8	Very high	86 Å²	86	95.6 Å²	95.6	52%	0.521	51%	0.505	S	S	.	.	H	α-helix	trans	-69.1	-46.3	177.8	172.9	0	0	0	0	110.2	R29 F30 A31 G35 Y36 I37	R29-V33 WeakPolarHBondContact O-CG2 3.4Å; R29-V33 PolarHBondContact O-N 3.25Å; F30-V33 PolarHBondContact O-N 3.15Å; F30-V33 VanDerWaalsContact O-N 3.15Å; A31-V33 VanDerWaalsContact C-N 3.34Å; A31-V33 PolarHBondContact O-N 3.48Å; V33-G35 VanDerWaalsContact C-N 3.35Å; V33-G35 PolarHBondContact O-N 3.21Å; V33-Y36 PolarHBondContact O-N 3.47Å; V33-I37 HydrophobicContact CG1-CD1 3.91Å; V33-I37 VanDerWaalsContact O-CG1 3.27Å; V33-I37 WeakPolarHBondContact O-CG1 3.4Å; V33-I37 PolarHBondContact O-N 2.92Å
34	I	94.1	Very high	91	Very high	104 Å²	104	95.1 Å²	95.1	53%	0.533	51%	0.511	S	S	.	.	H	α-helix	trans	-61.8	-45.4	176.2	-63.9	170.5	0	0	0	110.2	F30 A31 Y36 I37 C38	F30-I34 WeakPolarHBondContact O-CG1 3.17Å; F30-I34 PolarHBondContact O-N 3.37Å; A31-I34 PolarHBondContact O-N 2.81Å; I34-Y36 VanDerWaalsContact C-N 3.31Å; I34-Y36 PolarHBondContact O-N 3.24Å; I34-I37 PolarHBondContact O-N 3.48Å; I34-C38 WeakPolarHBondContact O-CB 3.23Å; I34-C38 PolarHBondContact O-N 3.27Å; I34-C38 PolarHBondContact O-SG 2.94Å
35	G	94.3	Very high	91.1	Very high	39 Å²	39	95.6 Å²	95.6	40%	0.402	51%	0.513	S	S	.	.	H	α-helix	trans	-60.1	-39.5	177.2	0	0	0	0	0	112.7	A31 V33 S39	A31-G35 PolarHBondContact O-N 3.46Å; V33-G35 VanDerWaalsContact C-N 3.35Å; V33-G35 PolarHBondContact O-N 3.21Å; G35-S39 WeakPolarHBondContact O-CB 3.36Å; G35-S39 PolarHBondContact O-N 2.93Å
36	Y	94.8	Very high	91.3	Very high	165 Å²	165	94 Å²	94	65%	0.647	51%	0.513	S	S	*	.	H	α-helix	trans	-64.5	-47.5	173.8	177.7	-100.5	0	0	0	111.8	T32 V33 I34 C38 S39 V40	T32-Y36 WeakPolarHBondContact O-CB 3.44Å; T32-Y36 PolarHBondContact O-N 3.4Å; V33-Y36 PolarHBondContact O-N 3.47Å; I34-Y36 VanDerWaalsContact C-N 3.31Å; I34-Y36 PolarHBondContact O-N 3.24Å; Y36-C38 VanDerWaalsContact C-N 3.34Å; Y36-C38 PolarHBondContact O-N 2.8Å; Y36-S39 PolarHBondContact O-N 3.28Å; Y36-V40 HydrophobicContact CD2-CG2 4.31Å; Y36-V40 HydrophobicContact CE1-CG2 4.16Å; Y36-V40 HydrophobicContact CE2-CG2 3.91Å; Y36-V40 WeakPolarHBondContact O-CG2 3.47Å; Y36-V40 PolarHBondContact O-N 3.49Å
37	I	94	Very high	91.3	Very high	90 Å²	90	94.2 Å²	94.2	46%	0.462	51%	0.513	S	S	.	.	H	α-helix	trans	-57.6	-49.7	176.6	-65.5	162.8	0	0	0	109.6	V33 I34 S39 V40 C41	V33-I37 HydrophobicContact CG1-CD1 3.91Å; V33-I37 VanDerWaalsContact O-CG1 3.27Å; V33-I37 WeakPolarHBondContact O-CG1 3.4Å; V33-I37 PolarHBondContact O-N 2.92Å; I34-I37 PolarHBondContact O-N 3.48Å; I37-S39 PolarHBondContact O-N 2.96Å; I37-V40 PolarHBondContact O-N 3.22Å; I37-C41 VanDerWaalsContact O-CB 3.25Å; I37-C41 WeakPolarHBondContact O-CB 3.44Å; I37-C41 PolarHBondContact O-N 3.37Å; I37-C41 PolarHBondContact O-SG 3.38Å
38	C	92	Very high	91.1	Very high	64 Å²	64	87.6 Å²	87.6	43%	0.432	50%	0.495	S	S	.	.	H	α-helix	trans	-60.6	-44.3	177	-67	0	0	0	0	112.2	I34 Y36 V40 C41 L42	I34-C38 WeakPolarHBondContact O-CB 3.23Å; I34-C38 PolarHBondContact O-N 3.27Å; I34-C38 PolarHBondContact O-SG 2.94Å; Y36-C38 VanDerWaalsContact C-N 3.34Å; Y36-C38 PolarHBondContact O-N 2.8Å; C38-V40 PolarHBondContact O-N 3.31Å; C38-C41 PolarHBondContact O-N 3.18Å; C38-L42 WeakPolarHBondContact O-CB 3.21Å; C38-L42 VanDerWaalsContact O-CG 3.23Å; C38-L42 WeakPolarHBondContact O-CG 3.25Å; C38-L42 PolarHBondContact O-N 3.43Å
39	S	91.7	Very high	90.7	Very high	81 Å²	81	87.7 Å²	87.7	57%	0.566	50%	0.496	S	S	*	.	H	α-helix	trans	-66.7	-24.4	-179.2	-172.2	0	0	0	0	113.3	G35 Y36 I37 P43	G35-S39 WeakPolarHBondContact O-CB 3.36Å; G35-S39 PolarHBondContact O-N 2.93Å; Y36-S39 PolarHBondContact O-N 3.28Å; I37-S39 PolarHBondContact O-N 2.96Å; S39-P43 WeakPolarHBondContact O-CD 3.27Å; S39-P43 WeakPolarHBondContact O-CG 3.47Å
40	V	92.9	Very high	90.4	Very high	72 Å²	72	85.8 Å²	85.8	44%	0.436	49%	0.49	S	S	.	.	H	α-helix	trans	-91.1	-37.3	175.2	175.7	0	0	0	0	111.1	Y36 I37 C38 P43 A44	Y36-V40 HydrophobicContact CD2-CG2 4.31Å; Y36-V40 HydrophobicContact CE1-CG2 4.16Å; Y36-V40 HydrophobicContact CE2-CG2 3.91Å; Y36-V40 WeakPolarHBondContact O-CG2 3.47Å; Y36-V40 PolarHBondContact O-N 3.49Å; I37-V40 PolarHBondContact O-N 3.22Å; C38-V40 PolarHBondContact O-N 3.31Å; V40-P43 WeakPolarHBondContact O-CD 3.45Å; V40-P43 WeakPolarHBondContact O-CG 3.48Å; V40-A44 WeakPolarHBondContact O-CB 3.47Å; V40-A44 PolarHBondContact O-N 2.98Å
41	C	91.7	Very high	89.7	Confident	58 Å²	58	86.2 Å²	86.2	39%	0.392	49%	0.488	S	S	.	.	H	α-helix	trans	-68.4	-39.3	177.8	-69.6	0	0	0	0	112.4	I37 C38 A44 I45	I37-C41 VanDerWaalsContact O-CB 3.25Å; I37-C41 WeakPolarHBondContact O-CB 3.44Å; I37-C41 PolarHBondContact O-N 3.37Å; I37-C41 PolarHBondContact O-SG 3.38Å; C38-C41 PolarHBondContact O-N 3.18Å; C41-A44 PolarHBondContact O-N 3.4Å; C41-I45 HydrophobicContact CB-CD1 4.47Å; C41-I45 WeakPolarHBondContact O-CB 3.4Å; C41-I45 WeakPolarHBondContact O-CD1 3.38Å; C41-I45 WeakPolarHBondContact O-CG1 3.4Å; C41-I45 PolarHBondContact O-N 3.44Å
42	L	87.2	Confident	88.8	Confident	118 Å²	118	83.9 Å²	83.9	62%	0.618	47%	0.468	S	S	*	.	H	α-helix	trans	-56.8	-54	178.2	-77	172.9	0	0	0	113.4	C38 A44 I45 A46	C38-L42 WeakPolarHBondContact O-CB 3.21Å; C38-L42 VanDerWaalsContact O-CG 3.23Å; C38-L42 WeakPolarHBondContact O-CG 3.25Å; C38-L42 PolarHBondContact O-N 3.43Å; L42-A44 VanDerWaalsContact C-N 3.32Å; L42-A44 PolarHBondContact O-N 3.42Å; L42-I45 PolarHBondContact O-N 3.3Å; L42-A46 WeakPolarHBondContact O-CB 3.44Å; L42-A46 PolarHBondContact O-N 3.06Å
43	P	91	Very high	87.6	Confident	64 Å²	64	82.3 Å²	82.3	42%	0.416	47%	0.47	S	S	.	.	H	α-helix	trans	-67.3	-31.8	177	25.4	-33.4	0	0	0	112.4	S39 V40 A46 L47	S39-P43 WeakPolarHBondContact O-CD 3.27Å; S39-P43 WeakPolarHBondContact O-CG 3.47Å; V40-P43 WeakPolarHBondContact O-CD 3.45Å; V40-P43 WeakPolarHBondContact O-CG 3.48Å; P43-A46 PolarHBondContact O-N 2.93Å; P43-L47 WeakPolarHBondContact O-CB 3.36Å; P43-L47 WeakPolarHBondContact O-CG 3.27Å; P43-L47 PolarHBondContact O-N 3.18Å
44	A	92.1	Very high	86.3	Confident	58 Å²	58	85.5 Å²	85.5	48%	0.479	48%	0.477	S	S	.	.	H	α-helix	trans	-63.7	-43.4	174.6	0	0	0	0	0	111.9	V40 C41 L42 L47 S48	V40-A44 WeakPolarHBondContact O-CB 3.47Å; V40-A44 PolarHBondContact O-N 2.98Å; C41-A44 PolarHBondContact O-N 3.4Å; L42-A44 VanDerWaalsContact C-N 3.32Å; L42-A44 PolarHBondContact O-N 3.42Å; A44-L47 PolarHBondContact O-N 3.18Å; A44-S48 PolarHBondContact O-N 2.89Å
45	I	86.8	Confident	85	Confident	92 Å²	92	90 Å²	90	47%	0.472	49%	0.487	S	S	.	.	H	α-helix	trans	-67	-43.4	175.1	-65	162	0	0	0	110.1	C41 L42 L47 S48 I49	C41-I45 HydrophobicContact CB-CD1 4.47Å; C41-I45 WeakPolarHBondContact O-CB 3.4Å; C41-I45 WeakPolarHBondContact O-CD1 3.38Å; C41-I45 WeakPolarHBondContact O-CG1 3.4Å; C41-I45 PolarHBondContact O-N 3.44Å; L42-I45 PolarHBondContact O-N 3.3Å; I45-L47 VanDerWaalsContact C-N 3.34Å; I45-L47 PolarHBondContact O-N 3.37Å; I45-S48 WeakPolarHBondContact O-CB 3.34Å; I45-S48 PolarHBondContact O-N 3.03Å; I45-I49 HydrophobicContact CG2-CD1 3.92Å; I45-I49 WeakPolarHBondContact O-CG1 3.45Å; I45-I49 PolarHBondContact O-N 3.38Å
46	A	86.9	Confident	83.8	Confident	56 Å²	56	92 Å²	92	46%	0.463	49%	0.489	S	S	.	.	H	α-helix	trans	-61.2	-42.2	177.2	0	0	0	0	0	111.9	L42 P43 I49 Y50	L42-A46 WeakPolarHBondContact O-CB 3.44Å; L42-A46 PolarHBondContact O-N 3.06Å; P43-A46 PolarHBondContact O-N 2.93Å; A46-I49 PolarHBondContact O-N 3.5Å; A46-Y50 WeakPolarHBondContact O-CB 3.47Å; A46-Y50 PolarHBondContact O-N 3.22Å
47	L	86.8	Confident	82.4	Confident	98 Å²	98	89 Å²	89	51%	0.513	49%	0.489	S	S	.	.	H	α-helix	trans	-62.8	-43.4	174.1	-86.6	168.8	0	0	0	111.6	P43 A44 I45 I49 Y50 Y51	P43-L47 WeakPolarHBondContact O-CB 3.36Å; P43-L47 WeakPolarHBondContact O-CG 3.27Å; P43-L47 PolarHBondContact O-N 3.18Å; A44-L47 PolarHBondContact O-N 3.18Å; I45-L47 VanDerWaalsContact C-N 3.34Å; I45-L47 PolarHBondContact O-N 3.37Å; L47-I49 PolarHBondContact O-N 3.41Å; L47-Y50 WeakPolarHBondContact O-CB 3.37Å; L47-Y50 PolarHBondContact O-N 2.97Å; L47-Y51 HydrophobicContact CD2-CE2 4.24Å; L47-Y51 VanDerWaalsContact O-CD2 3.23Å; L47-Y51 WeakPolarHBondContact O-CD2 3.46Å; L47-Y51 PolarHBondContact O-N 3.45Å
48	S	85.2	Confident	81.2	Confident	46 Å²	46	92 Å²	92	32%	0.322	50%	0.502	S	S	.	.	H	α-helix	trans	-54.5	-54.8	174.3	-173.6	0	0	0	0	110	A44 I45 Y50 Y51 I52	A44-S48 PolarHBondContact O-N 2.89Å; I45-S48 WeakPolarHBondContact O-CB 3.34Å; I45-S48 PolarHBondContact O-N 3.03Å; S48-Y50 VanDerWaalsContact C-N 3.29Å; S48-Y50 PolarHBondContact O-N 3.4Å; S48-Y51 PolarHBondContact O-N 3.16Å; S48-I52 VanDerWaalsContact C-CD1 3.46Å; S48-I52 WeakPolarHBondContact O-CD1 3.23Å; S48-I52 WeakPolarHBondContact O-CG1 3.37Å; S48-I52 PolarHBondContact O-N 3.39Å; S48-I52 WeakPolarHBondContact OG-CD1 3.35Å
49	I	82.5	Confident	79.7	Confident	98 Å²	98	95.2 Å²	95.2	50%	0.503	51%	0.505	S	S	.	.	H	α-helix	trans	-59.2	-39.9	179.2	-63.6	166.8	0	0	0	111.7	I45 A46 L47 I52 G53	I45-I49 HydrophobicContact CG2-CD1 3.92Å; I45-I49 WeakPolarHBondContact O-CG1 3.45Å; I45-I49 PolarHBondContact O-N 3.38Å; A46-I49 PolarHBondContact O-N 3.5Å; L47-I49 PolarHBondContact O-N 3.41Å; I49-I52 PolarHBondContact O-N 2.9Å; I49-G53 PolarHBondContact O-N 3.21Å
50	Y	81.9	Confident	78.4	Confident	135 Å²	135	96.3 Å²	96.3	53%	0.529	50%	0.5	S	S	.	.	H	α-helix	trans	-60.5	-47.9	178.2	179	-100.9	0	0	0	111.9	A46 L47 S48 I52 G53 F54	A46-Y50 WeakPolarHBondContact O-CB 3.47Å; A46-Y50 PolarHBondContact O-N 3.22Å; L47-Y50 WeakPolarHBondContact O-CB 3.37Å; L47-Y50 PolarHBondContact O-N 2.97Å; S48-Y50 VanDerWaalsContact C-N 3.29Å; S48-Y50 PolarHBondContact O-N 3.4Å; Y50-I52 VanDerWaalsContact C-N 3.35Å; Y50-I52 PolarHBondContact O-N 3.42Å; Y50-G53 PolarHBondContact O-N 3.13Å; Y50-F54 HydrophobicContact CE2-CB 4.43Å; Y50-F54 VanDerWaalsContact O-CB 3.32Å; Y50-F54 WeakPolarHBondContact O-CB 3.11Å; Y50-F54 PolarHBondContact O-N 3.27Å
51	Y	78.2	Confident	77.1	Confident	145 Å²	145	100.1 Å²	100.1	57%	0.569	51%	0.513	S	S	*	.	H	α-helix	trans	-64.3	-39.9	177.1	-81.5	-70.3	0	0	0	112.3	L47 S48 W55	L47-Y51 HydrophobicContact CD2-CE2 4.24Å; L47-Y51 VanDerWaalsContact O-CD2 3.23Å; L47-Y51 WeakPolarHBondContact O-CD2 3.46Å; L47-Y51 PolarHBondContact O-N 3.45Å; S48-Y51 PolarHBondContact O-N 3.16Å; Y51-W55 VanDerWaalsContact O-CB 3.25Å; Y51-W55 WeakPolarHBondContact O-CB 3.48Å; Y51-W55 PolarHBondContact O-N 2.96Å; Y51-W55 VanDerWaalsContact O-N 3.1Å
52	I	72.1	Confident	75.9	Confident	4 Å²	4	104.5 Å²	104.5	2%	0.021	53%	0.526	C	S	.	.	H	α-helix	trans	-70.2	-40.1	-179.2	-59.2	155.7	0	0	0	112.1	S48 I49 Y50 D56 Y59 K60 V63	S48-I52 VanDerWaalsContact C-CD1 3.46Å; S48-I52 WeakPolarHBondContact O-CD1 3.23Å; S48-I52 WeakPolarHBondContact O-CG1 3.37Å; S48-I52 PolarHBondContact O-N 3.39Å; S48-I52 WeakPolarHBondContact OG-CD1 3.35Å; I49-I52 PolarHBondContact O-N 2.9Å; Y50-I52 VanDerWaalsContact C-N 3.35Å; Y50-I52 PolarHBondContact O-N 3.42Å; I52-D56 CarbonylContact O-C 3.59Å; I52-D56 VanDerWaalsContact O-O 3.14Å; I52-Y59 HydrophobicContact CD1-CD1 4.05Å; I52-Y59 HydrophobicContact CD1-CE1 4.42Å; I52-Y59 HydrophobicContact CG1-CD1 3.45Å; I52-Y59 VanDerWaalsContact CG1-CD1 3.45Å; I52-Y59 HydrophobicContact CG1-CE1 4.12Å; I52-Y59 HydrophobicContact CG1-CG 4.1Å; I52-K60 HydrophobicContact CG2-CB 4.29Å; I52-K60 HydrophobicContact CG2-CD 3.49Å; I52-K60 VanDerWaalsContact CG2-CD 3.49Å; I52-K60 HydrophobicContact CG2-CG 3.63Å; I52-V63 HydrophobicContact CD1-CB 4.08Å; I52-V63 HydrophobicContact CD1-CG1 4.05Å; I52-V63 HydrophobicContact CD1-CG2 3.24Å; I52-V63 HydrophobicContact CG1-CG2 3.98Å
53	G	69.1	Low	75	Confident	55 Å²	55	100.2 Å²	100.2	57%	0.567	50%	0.504	S	S	*	.	H	α-helix	trans	-82.5	-33.6	-173.6	0	0	0	0	0	113.3	I49 Y50	I49-G53 PolarHBondContact O-N 3.21Å; Y50-G53 PolarHBondContact O-N 3.13Å
54	F	68.1	Low	74	Confident	153 Å²	153	101.7 Å²	101.7	67%	0.671	51%	0.509	S	S	*	.	H	α-helix	trans	-104.7	-30	-173	-163.8	-99.5	0	0	0	113.7	Y50	Y50-F54 HydrophobicContact CE2-CB 4.43Å; Y50-F54 VanDerWaalsContact O-CB 3.32Å; Y50-F54 WeakPolarHBondContact O-CB 3.11Å; Y50-F54 PolarHBondContact O-N 3.27Å
55	W	66.5	Low	72.9	Confident	199 Å²	199	104 Å²	104	75%	0.754	52%	0.516	S	S	*	.	T	Hydrogen-bonded Turn	trans	-99.9	-38.7	-172.1	-154.9	-85.1	0	0	0	114	Y51	Y51-W55 VanDerWaalsContact O-CB 3.25Å; Y51-W55 WeakPolarHBondContact O-CB 3.48Å; Y51-W55 PolarHBondContact O-N 2.96Å; Y51-W55 VanDerWaalsContact O-N 3.1Å
56	D	67.5	Low	72.1	Confident	81 Å²	81	106 Å²	106	43%	0.433	52%	0.522	S	S	.	.			trans	-162.4	117.2	176.4	-139.7	-45.4	0	0	0	113.8	I52 Q58 Y59	I52-D56 CarbonylContact O-C 3.59Å; I52-D56 VanDerWaalsContact O-O 3.14Å; D56-Q58 PolarHBondContact O-N 3.38Å; D56-Y59 PolarHBondContact O-N 3.44Å
57	P	67	Low	71.5	Confident	102 Å²	102	107.8 Å²	107.8	66%	0.662	52%	0.523	S	S	*	.	G	3₁₀ helix	trans	-65	-21.3	-175.2	25.8	-35.5	0	0	0	114.4	Y59 K60	P57-Y59 PolarHBondContact O-N 2.9Å; P57-Y59 VanDerWaalsContact O-N 3.11Å; P57-K60 WeakPolarHBondContact O-CB 3.41Å; P57-K60 WeakPolarHBondContact O-CG 3.47Å; P57-K60 PolarHBondContact O-N 3.01Å
58	Q	68.3	Low	71.1	Confident	153 Å²	153	108.5 Å²	108.5	72%	0.715	53%	0.527	S	S	*	.	G	3₁₀ helix	trans	-64.7	-11.7	178.1	-87.2	173.1	-49.3	0	0	113.9	D56	D56-Q58 PolarHBondContact O-N 3.38Å
59	Y	61	Low	70.6	Confident	131 Å²	131	113.2 Å²	113.2	51%	0.514	54%	0.542	S	S	.	.	G	3₁₀ helix	trans	-81.2	-17.2	178.2	-152.6	-79.5	0	0	0	113.1	I52 D56 P57 E61 K62 V63	I52-Y59 HydrophobicContact CD1-CD1 4.05Å; I52-Y59 HydrophobicContact CD1-CE1 4.42Å; I52-Y59 HydrophobicContact CG1-CD1 3.45Å; I52-Y59 VanDerWaalsContact CG1-CD1 3.45Å; I52-Y59 HydrophobicContact CG1-CE1 4.12Å; I52-Y59 HydrophobicContact CG1-CG 4.1Å; D56-Y59 PolarHBondContact O-N 3.44Å; P57-Y59 PolarHBondContact O-N 2.9Å; P57-Y59 VanDerWaalsContact O-N 3.11Å; Y59-E61 VanDerWaalsContact C-N 3.32Å; Y59-E61 PolarHBondContact O-N 3.35Å; Y59-K62 PolarHBondContact O-N 3.39Å; Y59-V63 HydrophobicContact CD1-CG2 3.39Å; Y59-V63 HydrophobicContact CE1-CG2 3.48Å; Y59-V63 VanDerWaalsContact CE1-CG2 3.48Å; Y59-V63 WeakPolarHBondContact O-CG2 3.43Å; Y59-V63 PolarHBondContact O-N 2.93Å
60	K	63.1	Low	70	Confident	105 Å²	105	113.8 Å²	113.8	46%	0.457	55%	0.546	S	S	.	.	H	α-helix	trans	-52.6	-47.3	-180	-69.8	-79.3	-175.7	178.4	0	112.2	I52 P57 K62 V63 D64	I52-K60 HydrophobicContact CG2-CB 4.29Å; I52-K60 HydrophobicContact CG2-CD 3.49Å; I52-K60 VanDerWaalsContact CG2-CD 3.49Å; I52-K60 HydrophobicContact CG2-CG 3.63Å; P57-K60 WeakPolarHBondContact O-CB 3.41Å; P57-K60 WeakPolarHBondContact O-CG 3.47Å; P57-K60 PolarHBondContact O-N 3.01Å; K60-K62 VanDerWaalsContact C-N 3.32Å; K60-K62 PolarHBondContact O-N 2.98Å; K60-V63 PolarHBondContact O-N 3.26Å; K60-D64 PolarHBondContact O-N 3.47Å
61	E	66.5	Low	69.7	Low	152 Å²	152	113.6 Å²	113.6	71%	0.71	55%	0.553	S	S	*	*	H	α-helix	trans	-62.1	-36.1	-176.3	-66	-172.5	73.2	0	0	113.2	Y59 V63 V65	Y59-E61 VanDerWaalsContact C-N 3.32Å; Y59-E61 PolarHBondContact O-N 3.35Å; E61-V63 VanDerWaalsContact C-N 3.33Å; E61-V63 PolarHBondContact O-N 3.16Å; E61-V65 WeakPolarHBondContact O-CG2 3.45Å
62	K	66.8	Low	69.4	Low	150 Å²	150	116.2 Å²	116.2	65%	0.652	57%	0.567	S	S	*	*	H	α-helix	trans	-72.8	-30.2	-179.2	-65.9	-175.4	-179.2	-176.5	0	112.4	Y59 K60 F66	Y59-K62 PolarHBondContact O-N 3.39Å; K60-K62 VanDerWaalsContact C-N 3.32Å; K60-K62 PolarHBondContact O-N 2.98Å; K62-F66 PolarHBondContact O-N 3Å
63	V	67.4	Low	68.8	Low	27 Å²	27	126.8 Å²	126.8	16%	0.164	61%	0.613	C	S	.	*	H	α-helix	trans	-78	-39.7	-175.2	177.2	0	0	0	0	110.6	I52 Y59 K60 E61 V65 F66 L67	I52-V63 HydrophobicContact CD1-CB 4.08Å; I52-V63 HydrophobicContact CD1-CG1 4.05Å; I52-V63 HydrophobicContact CD1-CG2 3.24Å; I52-V63 HydrophobicContact CG1-CG2 3.98Å; Y59-V63 HydrophobicContact CD1-CG2 3.39Å; Y59-V63 HydrophobicContact CE1-CG2 3.48Å; Y59-V63 VanDerWaalsContact CE1-CG2 3.48Å; Y59-V63 WeakPolarHBondContact O-CG2 3.43Å; Y59-V63 PolarHBondContact O-N 2.93Å; K60-V63 PolarHBondContact O-N 3.26Å; E61-V63 VanDerWaalsContact C-N 3.33Å; E61-V63 PolarHBondContact O-N 3.16Å; V63-V65 PolarHBondContact O-N 3.49Å; V63-F66 PolarHBondContact O-N 3.48Å; V63-F66 VanDerWaalsContact O-N 3.15Å; V63-L67 WeakPolarHBondContact O-CB 3.48Å; V63-L67 PolarHBondContact O-N 3.2Å
64	D	69.3	Low	68.8	Low	96 Å²	96	130.4 Å²	130.4	51%	0.513	62%	0.616	S	S	.	*	H	α-helix	trans	-59.7	-37.9	175	-67.9	-34.4	0	0	0	111.2	K60 N68	K60-D64 PolarHBondContact O-N 3.47Å; D64-N68 WeakPolarHBondContact O-CB 3.38Å; D64-N68 PolarHBondContact O-N 3.05Å; D64-N68 PolarHBondContact O-ND2 3.45Å
65	V	69.2	Low	68.8	Low	105 Å²	105	129.2 Å²	129.2	64%	0.636	61%	0.613	S	S	*	*	H	α-helix	trans	-65.6	-45.3	174.4	177.4	0	0	0	0	111.5	E61 V63 N68 F69	E61-V65 WeakPolarHBondContact O-CG2 3.45Å; V63-V65 PolarHBondContact O-N 3.49Å; V65-N68 PolarHBondContact O-N 3.21Å; V65-F69 WeakPolarHBondContact O-CB 3.45Å; V65-F69 PolarHBondContact O-N 3.18Å
66	F	71.4	Confident	68.9	Low	136 Å²	136	125.3 Å²	125.3	60%	0.596	61%	0.605	S	S	*	*	H	α-helix	trans	-66.6	-39.6	179.5	-167	-93.6	0	0	0	112.4	K62 V63 F69 L70	K62-F66 PolarHBondContact O-N 3Å; V63-F66 PolarHBondContact O-N 3.48Å; V63-F66 VanDerWaalsContact O-N 3.15Å; F66-F69 PolarHBondContact O-N 3.12Å; F66-L70 HydrophobicContact CE1-CD1 3.8Å; F66-L70 HydrophobicContact CZ-CD1 4.37Å; F66-L70 WeakPolarHBondContact O-CB 3.33Å; F66-L70 PolarHBondContact O-N 2.91Å
67	L	74.3	Confident	69	Low	92 Å²	92	127.9 Å²	127.9	48%	0.482	62%	0.615	S	S	.	*	H	α-helix	trans	-64.8	-44.4	176.7	-132.7	93.2	0	0	0	111.3	V63 F69 L70 I71	V63-L67 WeakPolarHBondContact O-CB 3.48Å; V63-L67 PolarHBondContact O-N 3.2Å; L67-F69 VanDerWaalsContact C-N 3.31Å; L67-F69 PolarHBondContact O-N 3.31Å; L67-L70 PolarHBondContact O-N 3.01Å; L67-I71 HydrophobicContact CD2-CD1 4.26Å; L67-I71 WeakPolarHBondContact O-CD1 3.14Å; L67-I71 VanDerWaalsContact O-CG1 3.27Å; L67-I71 WeakPolarHBondContact O-CG1 3.43Å; L67-I71 PolarHBondContact O-N 3.42Å
68	N	77.3	Confident	69.1	Low	113 Å²	113	129.5 Å²	129.5	60%	0.604	61%	0.612	S	S	*	*	H	α-helix	trans	-61.9	-39.7	175.4	-86.8	-77.9	0	0	0	111.8	D64 V65 F72	D64-N68 WeakPolarHBondContact O-CB 3.38Å; D64-N68 PolarHBondContact O-N 3.05Å; D64-N68 PolarHBondContact O-ND2 3.45Å; V65-N68 PolarHBondContact O-N 3.21Å; N68-F72 PolarHBondContact O-N 3.19Å
69	F	74.7	Confident	69.2	Low	145 Å²	145	127.9 Å²	127.9	64%	0.636	61%	0.605	S	S	*	*	H	α-helix	trans	-63.8	-41.8	176.6	-173.1	-97.9	0	0	0	112.3	V65 F66 L67 F72 F73	V65-F69 WeakPolarHBondContact O-CB 3.45Å; V65-F69 PolarHBondContact O-N 3.18Å; F66-F69 PolarHBondContact O-N 3.12Å; L67-F69 VanDerWaalsContact C-N 3.31Å; L67-F69 PolarHBondContact O-N 3.31Å; F69-F72 PolarHBondContact O-N 3.26Å; F69-F73 PolarHBondContact O-N 3.1Å
70	L	70.4	Confident	69.8	Low	111 Å²	111	127.7 Å²	127.7	58%	0.581	61%	0.612	S	S	*	*	H	α-helix	trans	-75.1	-25.3	-178	-156.9	143.2	0	0	0	113.2	F66 L67	F66-L70 HydrophobicContact CE1-CD1 3.8Å; F66-L70 HydrophobicContact CZ-CD1 4.37Å; F66-L70 WeakPolarHBondContact O-CB 3.33Å; F66-L70 PolarHBondContact O-N 2.91Å; L67-L70 PolarHBondContact O-N 3.01Å
71	I	76.3	Confident	70.3	Confident	130 Å²	130	129.5 Å²	129.5	67%	0.667	62%	0.624	S	S	*	*	H	α-helix	trans	-78.7	-29.1	175.6	-70.2	165	0	0	0	111.6	L67	L67-I71 HydrophobicContact CD2-CD1 4.26Å; L67-I71 WeakPolarHBondContact O-CD1 3.14Å; L67-I71 VanDerWaalsContact O-CG1 3.27Å; L67-I71 WeakPolarHBondContact O-CG1 3.43Å; L67-I71 PolarHBondContact O-N 3.42Å
72	F	70.9	Confident	70.6	Confident	200 Å²	200	127.6 Å²	127.6	88%	0.877	62%	0.617	S	S	*	*	H	α-helix	trans	-87.9	-10.3	-177.4	-151.3	-92.6	0	0	0	113.7	N68 F69	N68-F72 PolarHBondContact O-N 3.19Å; F69-F72 PolarHBondContact O-N 3.26Å
73	F	59.2	Low	71	Confident	226 Å²	226	125.5 Å²	125.5	99%	0.991	61%	0.613	S	S	*	*			trans	-111.9	0	179.1	-164.6	-87	0	0	0	111.2	F69	F69-F73 PolarHBondContact O-N 3.1Å

Retrieved 73 of 73 residues in 20.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).