A0A077Z650_TRITR Loading...

Protein lin 52

AlphaFold DB , UniProt , Accession A0A077Z650, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 143 aa.

						>A0A077Z650_TRITR|A0A077Z650
MDLYPCDEDLNRKSPDLWPEKLPTVCDAADKFLKTVNEQNVYESIHLEPEDISFMNELGKLTPDQVMDQIKKMQQTAYNLGRIEQQELRRGALLRVLEDMLEPSESIPHEESVEKDHPMDSAPTDSTAEEPSTPSTEAVANCK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	56.4	Low	71.7	Confident	225 Å²	225	152.6 Å²	152.6	100%	1.108	79%	0.793	S	S	*	*				0	94.9	0	-82	-138.8	174.7	0	0	105	L3	M1-L3 PolarHBondContact O-N 2.86Å; M1-L3 VanDerWaalsContact O-N 3.09Å
2	D	68.6	Low	71.9	Confident	158 Å²	158	156.1 Å²	156.1	85%	0.845	79%	0.788	S	S	*	*			trans	-74.6	102.9	-177.8	-55.8	-34.5	0	0	0	106.1	Y4	D2-Y4 PolarHBondContact O-N 3.11Å
3	L	67.7	Low	72.1	Confident	157 Å²	157	158.7 Å²	158.7	82%	0.822	79%	0.791	S	S	*	*			trans	-59.2	109.6	168.1	-87.7	86.4	0	0	0	105.7	M1 P5	M1-L3 PolarHBondContact O-N 2.86Å; M1-L3 VanDerWaalsContact O-N 3.09Å; L3-P5 WeakPolarHBondContact O-CD 3.46Å
4	Y	72.1	Confident	71.9	Confident	215 Å²	215	155.1 Å²	155.1	84%	0.843	79%	0.789	S	S	*	*			trans	-52.3	115.3	166.5	-105.8	-101	0	0	0	107	D2 C6	D2-Y4 PolarHBondContact O-N 3.11Å; Y4-C6 PolarHBondContact O-N 2.84Å; Y4-C6 VanDerWaalsContact O-N 3.17Å
5	P	75.9	Confident	71.6	Confident	100 Å²	100	151.5 Å²	151.5	65%	0.649	78%	0.78	S	S	*	*			trans	-58.9	124	171.5	-17	30.6	0	0	0	106.7	L3 D7	L3-P5 WeakPolarHBondContact O-CD 3.46Å; P5-D7 PolarHBondContact O-N 3.01Å
6	C	74.2	Confident	71.3	Confident	121 Å²	121	148.2 Å²	148.2	82%	0.818	76%	0.764	S	S	*	*			trans	-67.6	92.6	166.5	-64.3	0	0	0	0	106.8	Y4 E8	Y4-C6 PolarHBondContact O-N 2.84Å; Y4-C6 VanDerWaalsContact O-N 3.17Å; C6-E8 PolarHBondContact O-N 3.43Å
7	D	73.6	Confident	70.8	Confident	160 Å²	160	148.3 Å²	148.3	86%	0.856	77%	0.765	S	S	*	*			trans	-73	64.1	165.2	-82.2	-30.4	0	0	0	108.6	P5	P5-D7 PolarHBondContact O-N 3.01Å
8	E	77.9	Confident	70.4	Confident	149 Å²	149	148.4 Å²	148.4	70%	0.696	76%	0.755	S	S	*	*			trans	-86	106.6	167	-175.5	177	-170.8	0	0	107.9	C6 L10	C6-E8 PolarHBondContact O-N 3.43Å; E8-L10 PolarHBondContact O-N 3.17Å; E8-L10 VanDerWaalsContact O-N 3.1Å
9	D	76.9	Confident	70	Confident	102 Å²	102	146.7 Å²	146.7	55%	0.545	75%	0.754	S	S	.	*			trans	-73.9	100.9	171.5	-170.2	0.7	0	0	0	109.6	N11 R12	D9-N11 PolarHBondContact O-N 3.29Å; D9-N11 VanDerWaalsContact O-N 3.13Å; D9-N11 WeakPolarHBondContact OD1-CA 3.47Å; D9-N11 VanDerWaalsContact OD1-CB 3.32Å; D9-N11 WeakPolarHBondContact OD1-CB 3.33Å; D9-N11 PolarHBondContact OD1-N 3.07Å; D9-N11 PolarHBondContact OD1-ND2 2.82Å; D9-R12 VanDerWaalsContact O-CB 3.27Å; D9-R12 WeakPolarHBondContact O-CB 3.48Å; D9-R12 PolarHBondContact O-N 3.43Å
10	L	71.8	Confident	69.7	Low	159 Å²	159	146.5 Å²	146.5	83%	0.832	75%	0.75	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60.7	-15.7	173.3	-76.4	157.4	0	0	0	112.7	E8 R12	E8-L10 PolarHBondContact O-N 3.17Å; E8-L10 VanDerWaalsContact O-N 3.1Å; L10-R12 VanDerWaalsContact C-N 3.32Å
11	N	73.8	Confident	69.4	Low	133 Å²	133	145.4 Å²	145.4	71%	0.711	74%	0.74	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.5	9.7	173.2	-57.1	-70.1	0	0	0	113	D9 K13	D9-N11 PolarHBondContact O-N 3.29Å; D9-N11 VanDerWaalsContact O-N 3.13Å; D9-N11 WeakPolarHBondContact OD1-CA 3.47Å; D9-N11 VanDerWaalsContact OD1-CB 3.32Å; D9-N11 WeakPolarHBondContact OD1-CB 3.33Å; D9-N11 PolarHBondContact OD1-N 3.07Å; D9-N11 PolarHBondContact OD1-ND2 2.82Å; N11-K13 PolarHBondContact O-N 3.45Å
12	R	73.7	Confident	69.8	Low	194 Å²	194	138 Å²	138	73%	0.732	70%	0.704	S	S	*	*			trans	-62.8	91.9	170.4	-170.2	-179.4	91.8	-151.6	5.8	108.8	D9 L10 S14	D9-R12 VanDerWaalsContact O-CB 3.27Å; D9-R12 WeakPolarHBondContact O-CB 3.48Å; D9-R12 PolarHBondContact O-N 3.43Å; L10-R12 VanDerWaalsContact C-N 3.32Å; R12-S14 PolarHBondContact O-N 3.2Å
13	K	74.1	Confident	69.4	Low	190 Å²	190	134.6 Å²	134.6	83%	0.826	69%	0.691	S	S	*	*	P	Polyproline II helix	trans	-54	134.8	166.7	-63.5	-174.6	-179	-175.2	0	107	N11	N11-K13 PolarHBondContact O-N 3.45Å
14	S	70	Confident	69.3	Low	108 Å²	108	132.3 Å²	132.3	76%	0.755	68%	0.684	S	S	*	*	P	Polyproline II helix	trans	-47.2	136.2	173.9	-58.6	0	0	0	0	109.1	R12	R12-S14 PolarHBondContact O-N 3.2Å
15	P	67.8	Low	69.1	Low	102 Å²	102	125.1 Å²	125.1	66%	0.662	66%	0.662	S	S	*	*	P	Polyproline II helix	trans	-50.1	146.1	173.6	-23.6	32.2	0	0	0	110.1	L17	P15-L17 PolarHBondContact O-N 2.84Å
16	D	66.2	Low	68.7	Low	98 Å²	98	122.3 Å²	122.3	52%	0.524	64%	0.644	S	S	.	*			trans	-59.6	111.4	171.6	-163	7.3	0	0	0	107.4	W18 K21	D16-W18 PolarHBondContact O-N 3.45Å; D16-W18 VanDerWaalsContact O-N 3.14Å; D16-K21 IonicContact OD1-NZ 2.75Å; D16-K21 PolarHBondContact OD1-NZ 3.18Å; D16-K21 IonicContact OD2-NZ 2.88Å; D16-K21 PolarHBondContact OD2-NZ 3.03Å
17	L	62.3	Low	68.6	Low	150 Å²	150	121.5 Å²	121.5	79%	0.785	63%	0.632	S	S	*	*	S	Bend	trans	-58.8	-28.2	-175.7	-78.2	161.1	0	0	0	111	P15	P15-L17 PolarHBondContact O-N 2.84Å
18	W	64.1	Low	68.5	Low	151 Å²	151	115.5 Å²	115.5	57%	0.572	61%	0.605	S	S	*	*			trans	-138.3	91.8	-178.4	-52.4	95.2	0	0	0	108.4	D16 E20	D16-W18 PolarHBondContact O-N 3.45Å; D16-W18 VanDerWaalsContact O-N 3.14Å; W18-E20 PolarHBondContact O-N 3.15Å
19	P	63.2	Low	68.2	Low	115 Å²	115	110.6 Å²	110.6	75%	0.747	59%	0.59	S	S	*	*	S	Bend	trans	-60.4	-30	175.9	24.1	-32.4	0	0	0	111.1
20	E	63	Low	68	Low	143 Å²	143	109.9 Å²	109.9	67%	0.668	59%	0.586	S	S	*	*	S	Bend	trans	-80.9	119.4	170.6	-167.5	176.8	177.1	0	0	110.3	W18 L22	W18-E20 PolarHBondContact O-N 3.15Å; E20-L22 PolarHBondContact O-N 2.85Å
21	K	63.2	Low	68	Low	124 Å²	124	109.2 Å²	109.2	54%	0.539	58%	0.576	S	S	.	*			trans	-76.8	89.9	176.1	-58.6	-61.3	169	-148.2	0	109.1	D16 P23	D16-K21 IonicContact OD1-NZ 2.75Å; D16-K21 PolarHBondContact OD1-NZ 3.18Å; D16-K21 IonicContact OD2-NZ 2.88Å; D16-K21 PolarHBondContact OD2-NZ 3.03Å; K21-P23 VanDerWaalsContact O-CD 3.26Å; K21-P23 WeakPolarHBondContact O-CD 3.23Å
22	L	64.8	Low	67.8	Low	69 Å²	69	109.9 Å²	109.9	36%	0.361	57%	0.573	S	S	.	*			trans	-69.6	112.8	167.8	-66.5	174.2	0	0	0	108.1	E20 T24 V25 C26	E20-L22 PolarHBondContact O-N 2.85Å; L22-T24 PolarHBondContact O-N 2.87Å; L22-V25 HydrophobicContact CB-CB 4.08Å; L22-V25 HydrophobicContact CB-CG2 3.83Å; L22-V25 HydrophobicContact CD1-CG2 3.99Å; L22-V25 PolarHBondContact O-N 3.26Å; L22-C26 PolarHBondContact O-N 3.13Å
23	P	61.8	Low	67.7	Low	86 Å²	86	106.5 Å²	106.5	56%	0.558	57%	0.569	S	S	*	*	H	α-helix	trans	-51.8	-37.6	-171.1	-26.6	33.6	0	0	0	113	K21	K21-P23 VanDerWaalsContact O-CD 3.26Å; K21-P23 WeakPolarHBondContact O-CD 3.23Å
24	T	65.6	Low	67.5	Low	110 Å²	110	104 Å²	104	68%	0.675	56%	0.558	S	S	*	*	H	α-helix	trans	-75.8	-36	-178.6	-46.4	0	0	0	0	113.7	L22 A28	L22-T24 PolarHBondContact O-N 2.87Å; T24-A28 WeakPolarHBondContact O-CB 3.4Å; T24-A28 PolarHBondContact O-N 3.44Å; T24-A28 VanDerWaalsContact O-N 3.15Å
25	V	66.7	Low	67.3	Low	64 Å²	64	102.1 Å²	102.1	39%	0.388	54%	0.542	S	S	.	.	H	α-helix	trans	-76.4	-41.8	-173.6	-178.2	0	0	0	0	110.5	L22 A29	L22-V25 HydrophobicContact CB-CB 4.08Å; L22-V25 HydrophobicContact CB-CG2 3.83Å; L22-V25 HydrophobicContact CD1-CG2 3.99Å; L22-V25 PolarHBondContact O-N 3.26Å; V25-A29 WeakPolarHBondContact O-CB 3.24Å; V25-A29 PolarHBondContact O-N 3.48Å
26	C	68	Low	67	Low	41 Å²	41	102 Å²	102	28%	0.277	54%	0.539	S	S	.	.	H	α-helix	trans	-65.1	-47.7	179	-65.6	0	0	0	0	111.6	L22 A28 A29 D30	L22-C26 PolarHBondContact O-N 3.13Å; C26-A28 VanDerWaalsContact C-N 3.32Å; C26-A28 PolarHBondContact O-N 3.4Å; C26-A29 PolarHBondContact O-N 2.86Å; C26-D30 PolarHBondContact O-N 3.42Å
27	D	72.6	Confident	66.9	Low	103 Å²	103	104.2 Å²	104.2	55%	0.551	55%	0.551	S	S	*	*	H	α-helix	trans	-64.7	-37.7	179.8	-73.4	-11.1	0	0	0	112.3	K31	D27-K31 WeakPolarHBondContact O-CB 3.01Å; D27-K31 WeakPolarHBondContact O-CG 2.9Å; D27-K31 PolarHBondContact O-N 3.07Å
28	A	72	Confident	67	Low	35 Å²	35	104.9 Å²	104.9	29%	0.289	55%	0.55	S	S	.	*	H	α-helix	trans	-64.4	-50	173.7	0	0	0	0	0	110.7	T24 C26 D30 K31 F32	T24-A28 WeakPolarHBondContact O-CB 3.4Å; T24-A28 PolarHBondContact O-N 3.44Å; T24-A28 VanDerWaalsContact O-N 3.15Å; C26-A28 VanDerWaalsContact C-N 3.32Å; C26-A28 PolarHBondContact O-N 3.4Å; A28-D30 VanDerWaalsContact C-N 3.33Å; A28-D30 PolarHBondContact O-N 2.91Å; A28-K31 PolarHBondContact O-N 3.18Å; A28-K31 VanDerWaalsContact O-N 3.16Å; A28-F32 HydrophobicContact CB-CD2 4.34Å; A28-F32 HydrophobicContact CB-CE2 4.35Å; A28-F32 WeakPolarHBondContact O-CD2 3.41Å; A28-F32 PolarHBondContact O-N 2.91Å
29	A	71.3	Confident	66.8	Low	46 Å²	46	103.6 Å²	103.6	38%	0.38	55%	0.55	S	S	.	*	H	α-helix	trans	-56.8	-46	179.5	0	0	0	0	0	111.6	V25 C26 K31 F32 L33	V25-A29 WeakPolarHBondContact O-CB 3.24Å; V25-A29 PolarHBondContact O-N 3.48Å; C26-A29 PolarHBondContact O-N 2.86Å; A29-K31 PolarHBondContact O-N 2.94Å; A29-F32 PolarHBondContact O-N 3.2Å; A29-L33 WeakPolarHBondContact O-CB 3.18Å; A29-L33 VanDerWaalsContact O-CG 3.25Å; A29-L33 WeakPolarHBondContact O-CG 2.88Å; A29-L33 PolarHBondContact O-N 3.46Å
30	D	72	Confident	66.6	Low	87 Å²	87	103.3 Å²	103.3	47%	0.465	54%	0.542	S	S	.	.	H	α-helix	trans	-63.7	-40.9	177.4	-79.6	-12.5	0	0	0	112.5	C26 A28 K34	C26-D30 PolarHBondContact O-N 3.42Å; A28-D30 VanDerWaalsContact C-N 3.33Å; A28-D30 PolarHBondContact O-N 2.91Å; D30-K34 WeakPolarHBondContact O-CB 3.43Å; D30-K34 WeakPolarHBondContact O-CG 3.39Å; D30-K34 PolarHBondContact O-N 2.92Å
31	K	72	Confident	66.5	Low	145 Å²	145	100.5 Å²	100.5	63%	0.63	54%	0.535	S	S	*	.	H	α-helix	trans	-63.3	-43.8	174.5	-80.4	172	-178.3	-78.7	0	111.7	D27 A28 A29 K34 T35	D27-K31 WeakPolarHBondContact O-CB 3.01Å; D27-K31 WeakPolarHBondContact O-CG 2.9Å; D27-K31 PolarHBondContact O-N 3.07Å; A28-K31 PolarHBondContact O-N 3.18Å; A28-K31 VanDerWaalsContact O-N 3.16Å; A29-K31 PolarHBondContact O-N 2.94Å; K31-K34 PolarHBondContact O-N 3.37Å; K31-T35 WeakPolarHBondContact O-CB 3.48Å; K31-T35 PolarHBondContact O-N 3.19Å; K31-T35 PolarHBondContact O-OG1 3.37Å
32	F	70.3	Confident	66.5	Low	146 Å²	146	103 Å²	103	64%	0.64	54%	0.543	S	S	*	.	H	α-helix	trans	-62.8	-49.3	177.6	-83.3	-70.5	0	0	0	110.9	A28 A29 K34 T35 V36	A28-F32 HydrophobicContact CB-CD2 4.34Å; A28-F32 HydrophobicContact CB-CE2 4.35Å; A28-F32 WeakPolarHBondContact O-CD2 3.41Å; A28-F32 PolarHBondContact O-N 2.91Å; A29-F32 PolarHBondContact O-N 3.2Å; F32-K34 VanDerWaalsContact C-N 3.3Å; F32-K34 PolarHBondContact O-N 3.2Å; F32-T35 PolarHBondContact O-N 2.84Å; F32-V36 VanDerWaalsContact O-CG2 3.25Å; F32-V36 WeakPolarHBondContact O-CG2 3.44Å; F32-V36 PolarHBondContact O-N 3.09Å
33	L	71	Confident	66.6	Low	124 Å²	124	107 Å²	107	65%	0.649	56%	0.559	S	S	*	*	H	α-helix	trans	-60.7	-38.2	179.2	-69.4	174.9	0	0	0	112.5	A29 N37	A29-L33 WeakPolarHBondContact O-CB 3.18Å; A29-L33 VanDerWaalsContact O-CG 3.25Å; A29-L33 WeakPolarHBondContact O-CG 2.88Å; A29-L33 PolarHBondContact O-N 3.46Å; L33-N37 PolarHBondContact O-N 3.21Å
34	K	70.4	Confident	67	Low	136 Å²	136	108.1 Å²	108.1	59%	0.591	57%	0.569	S	S	*	*	H	α-helix	trans	-68	-45.5	175.2	-72.6	172.4	-174.1	179.5	0	112.2	D30 K31 F32 V36 N37 E38	D30-K34 WeakPolarHBondContact O-CB 3.43Å; D30-K34 WeakPolarHBondContact O-CG 3.39Å; D30-K34 PolarHBondContact O-N 2.92Å; K31-K34 PolarHBondContact O-N 3.37Å; F32-K34 VanDerWaalsContact C-N 3.3Å; F32-K34 PolarHBondContact O-N 3.2Å; K34-V36 VanDerWaalsContact C-N 3.34Å; K34-V36 PolarHBondContact O-N 2.92Å; K34-N37 PolarHBondContact O-N 3Å; K34-E38 PolarHBondContact O-N 3.41Å
35	T	64.4	Low	67.5	Low	69 Å²	69	109.7 Å²	109.7	42%	0.423	57%	0.572	S	S	.	*	H	α-helix	trans	-63.3	-41.2	-178.5	-52.3	0	0	0	0	111.5	K31 F32 N37 E38 Q39	K31-T35 WeakPolarHBondContact O-CB 3.48Å; K31-T35 PolarHBondContact O-N 3.19Å; K31-T35 PolarHBondContact O-OG1 3.37Å; F32-T35 PolarHBondContact O-N 2.84Å; T35-N37 VanDerWaalsContact C-N 3.25Å; T35-N37 PolarHBondContact O-N 3.03Å; T35-E38 PolarHBondContact O-N 3.07Å; T35-Q39 HydrophobicContact CG2-CG 4.34Å; T35-Q39 PolarHBondContact O-N 3.33Å
36	V	62.3	Low	68.3	Low	100 Å²	100	114.2 Å²	114.2	61%	0.606	59%	0.589	S	S	*	*	H	α-helix	trans	-62.8	-32	178.1	172.6	0	0	0	0	112	F32 K34	F32-V36 VanDerWaalsContact O-CG2 3.25Å; F32-V36 WeakPolarHBondContact O-CG2 3.44Å; F32-V36 PolarHBondContact O-N 3.09Å; K34-V36 VanDerWaalsContact C-N 3.34Å; K34-V36 PolarHBondContact O-N 2.92Å
37	N	63.5	Low	69.2	Low	145 Å²	145	116 Å²	116	78%	0.775	60%	0.595	S	S	*	*	H	α-helix	trans	-76.7	-25.6	179.1	-166.8	39.5	0	0	0	113.2	L33 K34 T35	L33-N37 PolarHBondContact O-N 3.21Å; K34-N37 PolarHBondContact O-N 3Å; T35-N37 VanDerWaalsContact C-N 3.25Å; T35-N37 PolarHBondContact O-N 3.03Å
38	E	65.1	Low	70.2	Confident	164 Å²	164	116.2 Å²	116.2	77%	0.766	59%	0.592	S	S	*	*	H	α-helix	trans	-95.5	-30.9	-175.3	-68.6	-179.9	-176.8	0	0	113.3	K34 T35	K34-E38 PolarHBondContact O-N 3.41Å; T35-E38 PolarHBondContact O-N 3.07Å
39	Q	59.9	Low	71.2	Confident	123 Å²	123	120 Å²	120	58%	0.575	61%	0.614	S	S	*	*	S	Bend	trans	-92.9	126.6	180	-60.7	-155.9	-53.3	0	0	110.4	T35 V41	T35-Q39 HydrophobicContact CG2-CG 4.34Å; T35-Q39 PolarHBondContact O-N 3.33Å; Q39-V41 HydrophobicContact CB-CG2 3.74Å; Q39-V41 WeakPolarHBondContact O-CG2 3.49Å; Q39-V41 PolarHBondContact O-N 3.34Å
40	N	59.3	Low	72.3	Confident	109 Å²	109	124.7 Å²	124.7	58%	0.583	63%	0.628	S	S	*	*			trans	-74	80.8	167.2	-153	-25.4	0	0	0	107.6	Y42	N40-Y42 HydrophobicContact CB-CD1 4.32Å; N40-Y42 HydrophobicContact CB-CE1 3.74Å; N40-Y42 HydrophobicContact CB-CE2 3.92Å; N40-Y42 VanDerWaalsContact CB-CZ 3.42Å; N40-Y42 WeakPolarHBondContact CB-OH 3.33Å; N40-Y42 VanDerWaalsContact CG-CD1 3.42Å; N40-Y42 WeakPolarHBondContact ND2-CE1 3.48Å; N40-Y42 PolarHBondContact ND2-OH 2.91Å; N40-Y42 WeakPolarHBondContact O-CD2 3.48Å; N40-Y42 VanDerWaalsContact O-CE2 3.24Å; N40-Y42 WeakPolarHBondContact O-CE2 3.4Å; N40-Y42 PolarHBondContact O-N 3Å; N40-Y42 WeakPolarHBondContact OD1-CD1 3.31Å; N40-Y42 WeakPolarHBondContact OD1-CE1 3.45Å
41	V	61	Low	73.4	Confident	85 Å²	85	123.7 Å²	123.7	52%	0.515	62%	0.623	S	S	.	*			trans	-76.7	57.7	-177	-165.1	0	0	0	0	109.2	Q39 E43	Q39-V41 HydrophobicContact CB-CG2 3.74Å; Q39-V41 WeakPolarHBondContact O-CG2 3.49Å; Q39-V41 PolarHBondContact O-N 3.34Å; V41-E43 HydrophobicContact CG1-CB 4.33Å; V41-E43 PolarHBondContact O-N 3.27Å
42	Y	61.5	Low	74.5	Confident	177 Å²	177	120.8 Å²	120.8	69%	0.694	61%	0.613	S	S	*	*			trans	-86.8	31.1	156.6	41.4	-136.4	0	0	0	110.5	N40 S44	N40-Y42 HydrophobicContact CB-CD1 4.32Å; N40-Y42 HydrophobicContact CB-CE1 3.74Å; N40-Y42 HydrophobicContact CB-CE2 3.92Å; N40-Y42 VanDerWaalsContact CB-CZ 3.42Å; N40-Y42 WeakPolarHBondContact CB-OH 3.33Å; N40-Y42 VanDerWaalsContact CG-CD1 3.42Å; N40-Y42 WeakPolarHBondContact ND2-CE1 3.48Å; N40-Y42 PolarHBondContact ND2-OH 2.91Å; N40-Y42 WeakPolarHBondContact O-CD2 3.48Å; N40-Y42 VanDerWaalsContact O-CE2 3.24Å; N40-Y42 WeakPolarHBondContact O-CE2 3.4Å; N40-Y42 PolarHBondContact O-N 3Å; N40-Y42 WeakPolarHBondContact OD1-CD1 3.31Å; N40-Y42 WeakPolarHBondContact OD1-CE1 3.45Å; Y42-S44 PolarHBondContact O-N 3.33Å
43	E	67.1	Low	75.7	Confident	152 Å²	152	116.7 Å²	116.7	71%	0.71	60%	0.603	S	S	*	*			trans	-51.3	121.8	161.1	-77.2	-172.3	170.2	0	0	106.5	V41 I45	V41-E43 HydrophobicContact CG1-CB 4.33Å; V41-E43 PolarHBondContact O-N 3.27Å; E43-I45 PolarHBondContact O-N 3.22Å
44	S	70.1	Confident	76.8	Confident	110 Å²	110	116.2 Å²	116.2	77%	0.769	60%	0.596	S	S	*	*			trans	-51.8	106.4	-179.7	50.6	0	0	0	0	107.7	Y42 H46	Y42-S44 PolarHBondContact O-N 3.33Å; S44-H46 VanDerWaalsContact C-N 3.35Å; S44-H46 PolarHBondContact O-N 3.22Å
45	I	76.5	Confident	78	Confident	142 Å²	142	115.2 Å²	115.2	73%	0.728	60%	0.595	S	S	*	*			trans	-61.6	103.8	179.4	-56.2	174.4	0	0	0	105.6	E43 L47	E43-I45 PolarHBondContact O-N 3.22Å; I45-L47 VanDerWaalsContact C-N 3.35Å; I45-L47 HydrophobicContact CG2-CD2 4.49Å; I45-L47 HydrophobicContact CG2-CG 4.09Å; I45-L47 PolarHBondContact O-N 2.95Å
46	H	84.6	Confident	79.4	Confident	160 Å²	160	116.4 Å²	116.4	74%	0.741	60%	0.598	S	S	*	*			trans	-76.9	92.5	179.5	-177.8	-84.7	0	0	0	107.5	S44	S44-H46 VanDerWaalsContact C-N 3.35Å; S44-H46 PolarHBondContact O-N 3.22Å
47	L	87	Confident	80.9	Confident	79 Å²	79	116.8 Å²	116.8	41%	0.414	59%	0.593	S	S	.	*			trans	-80.8	125.1	176.9	-74.2	150.6	0	0	0	109.4	I45 D51 I52 M55	I45-L47 VanDerWaalsContact C-N 3.35Å; I45-L47 HydrophobicContact CG2-CD2 4.49Å; I45-L47 HydrophobicContact CG2-CG 4.09Å; I45-L47 PolarHBondContact O-N 2.95Å; L47-D51 HydrophobicContact CB-CB 4.5Å; L47-D51 HydrophobicContact CD2-CB 3.75Å; L47-I52 HydrophobicContact CB-CD1 4.43Å; L47-I52 HydrophobicContact CB-CG1 4.1Å; L47-M55 HydrophobicContact CD2-SD 4.13Å
48	E	93.1	Very high	82.3	Confident	106 Å²	106	113.9 Å²	113.9	50%	0.495	58%	0.577	S	S	.	*			trans	-71.3	154.7	170.7	-64.1	-168.9	167.4	0	0	109.9	E50 D51 I52	E48-E50 PolarHBondContact O-N 3.44Å; E48-E50 VanDerWaalsContact O-N 3.15Å; E48-D51 WeakPolarHBondContact CB-OD2 3.44Å; E48-D51 PolarHBondContact N-OD2 2.98Å; E48-D51 WeakPolarHBondContact O-CB 3.39Å; E48-D51 PolarHBondContact O-N 3.44Å; E48-I52 PolarHBondContact O-N 3.2Å
49	P	93.1	Very high	83.6	Confident	114 Å²	114	109.3 Å²	109.3	74%	0.74	57%	0.574	S	S	*	*	H	α-helix	trans	-58.3	-27.8	176.3	23	-33.8	0	0	0	112.7	S53	P49-S53 PolarHBondContact O-N 3.1Å
50	E	94.8	Very high	85.3	Confident	146 Å²	146	111.1 Å²	111.1	68%	0.682	58%	0.58	S	S	*	*	H	α-helix	trans	-65.3	-44.5	173.3	-174.4	168.7	-173.8	0	0	111.7	E48 I52 S53 F54	E48-E50 PolarHBondContact O-N 3.44Å; E48-E50 VanDerWaalsContact O-N 3.15Å; E50-I52 VanDerWaalsContact C-N 3.32Å; E50-I52 PolarHBondContact O-N 3.13Å; E50-S53 WeakPolarHBondContact O-CB 3.46Å; E50-S53 PolarHBondContact O-N 2.94Å; E50-S53 VanDerWaalsContact O-N 3.13Å; E50-F54 WeakPolarHBondContact O-CB 3.45Å; E50-F54 PolarHBondContact O-N 3Å
51	D	94.5	Very high	87	Confident	66 Å²	66	108.7 Å²	108.7	35%	0.353	57%	0.567	S	S	.	*	H	α-helix	trans	-59.7	-44.3	176.8	-58.2	-42.5	0	0	0	111.2	L47 E48 S53 F54 M55	L47-D51 HydrophobicContact CB-CB 4.5Å; L47-D51 HydrophobicContact CD2-CB 3.75Å; E48-D51 WeakPolarHBondContact CB-OD2 3.44Å; E48-D51 PolarHBondContact N-OD2 2.98Å; E48-D51 WeakPolarHBondContact O-CB 3.39Å; E48-D51 PolarHBondContact O-N 3.44Å; D51-S53 VanDerWaalsContact C-N 3.32Å; D51-S53 PolarHBondContact O-N 2.86Å; D51-F54 PolarHBondContact O-N 2.85Å; D51-M55 WeakPolarHBondContact O-CB 3.42Å; D51-M55 VanDerWaalsContact O-CG 3.31Å; D51-M55 WeakPolarHBondContact O-CG 3.25Å; D51-M55 PolarHBondContact O-N 3.26Å
52	I	94.9	Very high	88.7	Confident	84 Å²	84	107.9 Å²	107.9	43%	0.431	56%	0.562	S	S	.	*	H	α-helix	trans	-63.4	-40.1	177.9	-60.3	171.5	0	0	0	110.4	L47 E48 E50 N56	L47-I52 HydrophobicContact CB-CD1 4.43Å; L47-I52 HydrophobicContact CB-CG1 4.1Å; E48-I52 PolarHBondContact O-N 3.2Å; E50-I52 VanDerWaalsContact C-N 3.32Å; E50-I52 PolarHBondContact O-N 3.13Å; I52-N56 WeakPolarHBondContact O-CB 3.34Å; I52-N56 PolarHBondContact O-N 2.91Å; I52-N56 VanDerWaalsContact O-N 3.11Å; I52-N56 PolarHBondContact O-ND2 2.94Å
53	S	95.7	Very high	90.3	Very high	59 Å²	59	104.3 Å²	104.3	41%	0.413	56%	0.561	S	S	.	*	H	α-helix	trans	-62.1	-47.9	174.8	-169.3	0	0	0	0	111	P49 E50 D51 M55 N56 E57	P49-S53 PolarHBondContact O-N 3.1Å; E50-S53 WeakPolarHBondContact O-CB 3.46Å; E50-S53 PolarHBondContact O-N 2.94Å; E50-S53 VanDerWaalsContact O-N 3.13Å; D51-S53 VanDerWaalsContact C-N 3.32Å; D51-S53 PolarHBondContact O-N 2.86Å; S53-M55 PolarHBondContact O-N 2.9Å; S53-N56 WeakPolarHBondContact O-CB 3.48Å; S53-N56 PolarHBondContact O-N 3.17Å; S53-E57 WeakPolarHBondContact O-CG 3.17Å; S53-E57 PolarHBondContact O-N 3.44Å
54	F	94.7	Very high	91.7	Very high	115 Å²	115	103 Å²	103	50%	0.504	56%	0.559	S	S	.	*	H	α-helix	trans	-63.6	-42	-179.1	-175.6	-112.9	0	0	0	112.5	E50 D51 N56 E57 L58	E50-F54 WeakPolarHBondContact O-CB 3.45Å; E50-F54 PolarHBondContact O-N 3Å; D51-F54 PolarHBondContact O-N 2.85Å; F54-N56 VanDerWaalsContact C-N 3.32Å; F54-N56 PolarHBondContact O-N 3.19Å; F54-E57 WeakPolarHBondContact O-CB 3.32Å; F54-E57 PolarHBondContact O-N 3.33Å; F54-L58 PolarHBondContact O-N 3.42Å
55	M	94.1	Very high	92.9	Very high	115 Å²	115	102.3 Å²	102.3	57%	0.567	54%	0.543	S	S	*	.	H	α-helix	trans	-59.7	-43	173.4	-73.8	179.3	67.9	0	0	111.9	L47 D51 S53 E57 L58 G59	L47-M55 HydrophobicContact CD2-SD 4.13Å; D51-M55 WeakPolarHBondContact O-CB 3.42Å; D51-M55 VanDerWaalsContact O-CG 3.31Å; D51-M55 WeakPolarHBondContact O-CG 3.25Å; D51-M55 PolarHBondContact O-N 3.26Å; S53-M55 PolarHBondContact O-N 2.9Å; M55-E57 VanDerWaalsContact C-N 3.33Å; M55-L58 PolarHBondContact O-N 2.88Å; M55-G59 PolarHBondContact O-N 3.4Å
56	N	94.9	Very high	93.9	Very high	93 Å²	93	97.9 Å²	97.9	50%	0.497	52%	0.523	S	S	.	.	H	α-helix	trans	-67.3	-33.4	177.1	-76.7	-48.2	0	0	0	112.4	I52 S53 F54 K60	I52-N56 WeakPolarHBondContact O-CB 3.34Å; I52-N56 PolarHBondContact O-N 2.91Å; I52-N56 VanDerWaalsContact O-N 3.11Å; I52-N56 PolarHBondContact O-ND2 2.94Å; S53-N56 WeakPolarHBondContact O-CB 3.48Å; S53-N56 PolarHBondContact O-N 3.17Å; F54-N56 VanDerWaalsContact C-N 3.32Å; F54-N56 PolarHBondContact O-N 3.19Å; N56-K60 WeakPolarHBondContact O-CD 3.49Å; N56-K60 WeakPolarHBondContact O-CE 3.49Å; N56-K60 VanDerWaalsContact O-CG 3.23Å; N56-K60 WeakPolarHBondContact O-CG 3.27Å; N56-K60 PolarHBondContact O-N 3.43Å
57	E	94.3	Very high	94.5	Very high	109 Å²	109	95.1 Å²	95.1	51%	0.509	51%	0.512	S	S	.	.	H	α-helix	trans	-66.8	-46.2	172.7	-73.6	176	-165.7	0	0	111.3	S53 F54 M55 G59 K60	S53-E57 WeakPolarHBondContact O-CG 3.17Å; S53-E57 PolarHBondContact O-N 3.44Å; F54-E57 WeakPolarHBondContact O-CB 3.32Å; F54-E57 PolarHBondContact O-N 3.33Å; M55-E57 VanDerWaalsContact C-N 3.33Å; E57-G59 VanDerWaalsContact C-N 3.33Å; E57-G59 PolarHBondContact O-N 3.01Å; E57-K60 PolarHBondContact O-N 2.91Å
58	L	91.6	Very high	95	Very high	84 Å²	84	95.8 Å²	95.8	44%	0.44	52%	0.515	S	S	.	.	H	α-helix	trans	-61.5	-40.3	177.5	-176.4	57.1	0	0	0	112	F54 M55 K60 L61	F54-L58 PolarHBondContact O-N 3.42Å; M55-L58 PolarHBondContact O-N 2.88Å; L58-K60 PolarHBondContact O-N 2.71Å; L58-L61 HydrophobicContact CD1-CD1 3.71Å; L58-L61 HydrophobicContact CD1-CG 4.5Å; L58-L61 WeakPolarHBondContact O-CB 3.45Å; L58-L61 WeakPolarHBondContact O-CG 3.31Å; L58-L61 PolarHBondContact O-N 2.87Å
59	G	93.8	Very high	95.1	Very high	68 Å²	68	93.7 Å²	93.7	70%	0.701	51%	0.505	S	S	*	.	H	α-helix	trans	-68.3	-16.7	178.1	0	0	0	0	0	114.9	M55 E57	M55-G59 PolarHBondContact O-N 3.4Å; E57-G59 VanDerWaalsContact C-N 3.33Å; E57-G59 PolarHBondContact O-N 3.01Å
60	K	95.5	Very high	95.2	Very high	161 Å²	161	92 Å²	92	70%	0.7	49%	0.49	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87	-10.8	175.7	-70.1	164.9	-170.6	173.4	0	113	N56 E57 L58	N56-K60 WeakPolarHBondContact O-CD 3.49Å; N56-K60 WeakPolarHBondContact O-CE 3.49Å; N56-K60 VanDerWaalsContact O-CG 3.23Å; N56-K60 WeakPolarHBondContact O-CG 3.27Å; N56-K60 PolarHBondContact O-N 3.43Å; E57-K60 PolarHBondContact O-N 2.91Å; L58-K60 PolarHBondContact O-N 2.71Å
61	L	95.2	Very high	95.4	Very high	57 Å²	57	90.3 Å²	90.3	30%	0.298	48%	0.48	S	S	.	.			trans	-69.8	141.6	-177.7	-61.7	-172.5	0	0	0	111.1	L58 Q65 V66 Q69	L58-L61 HydrophobicContact CD1-CD1 3.71Å; L58-L61 HydrophobicContact CD1-CG 4.5Å; L58-L61 WeakPolarHBondContact O-CB 3.45Å; L58-L61 WeakPolarHBondContact O-CG 3.31Å; L58-L61 PolarHBondContact O-N 2.87Å; L61-Q65 HydrophobicContact CB-CB 4Å; L61-Q65 HydrophobicContact CD2-CB 4.23Å; L61-Q65 HydrophobicContact CG-CB 4.49Å; L61-V66 HydrophobicContact CB-CG2 3.73Å; L61-V66 HydrophobicContact CD1-CG2 4.43Å; L61-Q69 HydrophobicContact CD1-CG 4.42Å
62	T	96.1	Very high	95.5	Very high	68 Å²	68	93.7 Å²	93.7	42%	0.417	49%	0.492	S	S	.	.			trans	-72.5	160.1	168.7	66.5	0	0	0	0	110.6	D64 Q65 V66	T62-D64 PolarHBondContact O-N 3.34Å; T62-Q65 WeakPolarHBondContact O-CB 3.37Å; T62-Q65 PolarHBondContact O-N 3.28Å; T62-Q65 WeakPolarHBondContact OG1-CG 3.07Å; T62-Q65 PolarHBondContact OG1-N 3.45Å; T62-V66 WeakPolarHBondContact O-CG2 3.4Å; T62-V66 PolarHBondContact O-N 2.84Å
63	P	95.4	Very high	95.6	Very high	103 Å²	103	95.4 Å²	95.4	67%	0.669	50%	0.499	S	S	*	.	H	α-helix	trans	-53	-39.8	178.4	-28.1	35.9	0	0	0	113.7	V66 M67	P63-V66 PolarHBondContact O-N 2.74Å; P63-M67 WeakPolarHBondContact O-CG 3.43Å; P63-M67 PolarHBondContact O-N 3.47Å
64	D	96	Very high	95.7	Very high	125 Å²	125	98.5 Å²	98.5	67%	0.668	51%	0.507	S	S	*	.	H	α-helix	trans	-65	-41.3	177.1	-62.2	-26.2	0	0	0	111.8	T62 M67 D68	T62-D64 PolarHBondContact O-N 3.34Å; D64-M67 WeakPolarHBondContact O-CB 3.25Å; D64-M67 PolarHBondContact O-N 3.01Å; D64-D68 PolarHBondContact O-N 3.22Å
65	Q	96.3	Very high	95.9	Very high	95 Å²	95	97.9 Å²	97.9	44%	0.444	51%	0.506	S	S	.	.	H	α-helix	trans	-66.9	-36.9	176.3	-71.5	173.9	-22.9	0	0	112.3	L61 T62 M67 D68 Q69	L61-Q65 HydrophobicContact CB-CB 4Å; L61-Q65 HydrophobicContact CD2-CB 4.23Å; L61-Q65 HydrophobicContact CG-CB 4.49Å; T62-Q65 WeakPolarHBondContact O-CB 3.37Å; T62-Q65 PolarHBondContact O-N 3.28Å; T62-Q65 WeakPolarHBondContact OG1-CG 3.07Å; T62-Q65 PolarHBondContact OG1-N 3.45Å; Q65-M67 VanDerWaalsContact C-N 3.33Å; Q65-D68 PolarHBondContact O-N 3.47Å; Q65-Q69 PolarHBondContact O-N 3.35Å
66	V	96.6	Very high	96.1	Very high	49 Å²	49	96.1 Å²	96.1	30%	0.297	50%	0.502	S	S	.	.	H	α-helix	trans	-61	-45.6	173.2	173.8	0	0	0	0	109.8	L61 T62 P63 D68 Q69 I70	L61-V66 HydrophobicContact CB-CG2 3.73Å; L61-V66 HydrophobicContact CD1-CG2 4.43Å; T62-V66 WeakPolarHBondContact O-CG2 3.4Å; T62-V66 PolarHBondContact O-N 2.84Å; P63-V66 PolarHBondContact O-N 2.74Å; V66-D68 VanDerWaalsContact C-N 3.32Å; V66-D68 PolarHBondContact O-N 2.89Å; V66-Q69 PolarHBondContact O-N 3.34Å; V66-I70 HydrophobicContact CG1-CD1 3.96Å; V66-I70 WeakPolarHBondContact O-CG1 3.21Å; V66-I70 PolarHBondContact O-N 3.1Å
67	M	96.5	Very high	96.2	Very high	102 Å²	102	94.6 Å²	94.6	50%	0.502	50%	0.502	S	S	.	.	H	α-helix	trans	-60.3	-41.4	176.6	-73.5	-59.7	-61.5	0	0	112.3	P63 D64 Q65 I70 K71	P63-M67 WeakPolarHBondContact O-CG 3.43Å; P63-M67 PolarHBondContact O-N 3.47Å; D64-M67 WeakPolarHBondContact O-CB 3.25Å; D64-M67 PolarHBondContact O-N 3.01Å; Q65-M67 VanDerWaalsContact C-N 3.33Å; M67-I70 PolarHBondContact O-N 2.86Å; M67-I70 HydrophobicContact SD-CD1 4.42Å; M67-K71 WeakPolarHBondContact O-CG 3.49Å; M67-K71 PolarHBondContact O-N 2.86Å
68	D	97.1	Very high	96.3	Very high	92 Å²	92	96.8 Å²	96.8	49%	0.492	51%	0.507	S	S	.	.	H	α-helix	trans	-68.7	-35.2	176.8	-74.8	-13.9	0	0	0	112.6	D64 Q65 V66 K71 K72	D64-D68 PolarHBondContact O-N 3.22Å; Q65-D68 PolarHBondContact O-N 3.47Å; V66-D68 VanDerWaalsContact C-N 3.32Å; V66-D68 PolarHBondContact O-N 2.89Å; D68-K71 PolarHBondContact O-N 2.93Å; D68-K71 IonicContact OD1-NZ 3.48Å; D68-K71 PolarHBondContact OD1-NZ 3.44Å; D68-K72 WeakPolarHBondContact O-CB 3.44Å; D68-K72 PolarHBondContact O-N 2.92Å
69	Q	95.8	Very high	96.7	Very high	62 Å²	62	95.6 Å²	95.6	29%	0.29	50%	0.501	S	S	.	.	H	α-helix	trans	-64.4	-42.3	171.7	-121.5	-56.8	39.5	0	0	111.6	L61 Q65 V66 K71 K72 M73	L61-Q69 HydrophobicContact CD1-CG 4.42Å; Q65-Q69 PolarHBondContact O-N 3.35Å; V66-Q69 PolarHBondContact O-N 3.34Å; Q69-K71 VanDerWaalsContact C-N 3.34Å; Q69-K71 PolarHBondContact O-N 3.28Å; Q69-K72 PolarHBondContact O-N 3.16Å; Q69-M73 WeakPolarHBondContact O-CB 3.33Å; Q69-M73 PolarHBondContact O-N 3.15Å
70	I	96.2	Very high	96.9	Very high	79 Å²	79	97.4 Å²	97.4	41%	0.405	49%	0.494	S	S	.	.	H	α-helix	trans	-59.8	-45.8	176.4	-68.7	165.9	0	0	0	110.5	V66 M67 K72 M73 Q74	V66-I70 HydrophobicContact CG1-CD1 3.96Å; V66-I70 WeakPolarHBondContact O-CG1 3.21Å; V66-I70 PolarHBondContact O-N 3.1Å; M67-I70 PolarHBondContact O-N 2.86Å; M67-I70 HydrophobicContact SD-CD1 4.42Å; I70-K72 VanDerWaalsContact C-N 3.33Å; I70-K72 PolarHBondContact O-N 3.37Å; I70-M73 WeakPolarHBondContact O-CB 3.32Å; I70-M73 PolarHBondContact O-N 3.42Å; I70-Q74 HydrophobicContact CG2-CG 4.47Å; I70-Q74 VanDerWaalsContact O-CG 3.31Å; I70-Q74 WeakPolarHBondContact O-CG 3.5Å; I70-Q74 PolarHBondContact O-N 3.34Å
71	K	97.5	Very high	96.9	Very high	111 Å²	111	91.3 Å²	91.3	48%	0.483	48%	0.477	S	S	.	.	H	α-helix	trans	-60.1	-42.7	175.5	-68.8	172.1	-162.2	155.6	0	111.9	M67 D68 Q69 Q74 Q75	M67-K71 WeakPolarHBondContact O-CG 3.49Å; M67-K71 PolarHBondContact O-N 2.86Å; D68-K71 PolarHBondContact O-N 2.93Å; D68-K71 IonicContact OD1-NZ 3.48Å; D68-K71 PolarHBondContact OD1-NZ 3.44Å; Q69-K71 VanDerWaalsContact C-N 3.34Å; Q69-K71 PolarHBondContact O-N 3.28Å; K71-Q74 PolarHBondContact O-N 3.25Å; K71-Q75 WeakPolarHBondContact O-CB 3.32Å; K71-Q75 PolarHBondContact O-N 2.96Å
72	K	97.3	Very high	97	Very high	137 Å²	137	94.7 Å²	94.7	60%	0.596	49%	0.485	S	S	*	.	H	α-helix	trans	-61.6	-44.9	176.9	-179	-177.3	175.8	-174.5	0	111.2	D68 Q69 I70 Q75 T76	D68-K72 WeakPolarHBondContact O-CB 3.44Å; D68-K72 PolarHBondContact O-N 2.92Å; Q69-K72 PolarHBondContact O-N 3.16Å; I70-K72 VanDerWaalsContact C-N 3.33Å; I70-K72 PolarHBondContact O-N 3.37Å; K72-Q75 PolarHBondContact O-N 2.87Å; K72-T76 PolarHBondContact O-N 3.38Å; K72-T76 PolarHBondContact O-OG1 3.29Å; K72-T76 VanDerWaalsContact O-OG1 3.1Å
73	M	98	Very high	97	Very high	119 Å²	119	96 Å²	96	59%	0.586	49%	0.489	S	S	*	.	H	α-helix	trans	-59.8	-46.6	175.9	-171.5	70.8	76.2	0	0	111.2	Q69 I70 Q75 T76 A77	Q69-M73 WeakPolarHBondContact O-CB 3.33Å; Q69-M73 PolarHBondContact O-N 3.15Å; I70-M73 WeakPolarHBondContact O-CB 3.32Å; I70-M73 PolarHBondContact O-N 3.42Å; M73-Q75 VanDerWaalsContact C-N 3.33Å; M73-Q75 PolarHBondContact O-N 3.05Å; M73-T76 WeakPolarHBondContact O-CB 3.32Å; M73-T76 PolarHBondContact O-N 3.34Å; M73-A77 WeakPolarHBondContact O-CB 3.4Å; M73-A77 PolarHBondContact O-N 3.03Å
74	Q	97.6	Very high	97	Very high	124 Å²	124	96.4 Å²	96.4	58%	0.579	48%	0.482	S	S	*	.	H	α-helix	trans	-59.6	-43.5	175.9	-72.7	173.5	-5	0	0	111.7	I70 K71 T76 A77 Y78	I70-Q74 HydrophobicContact CG2-CG 4.47Å; I70-Q74 VanDerWaalsContact O-CG 3.31Å; I70-Q74 WeakPolarHBondContact O-CG 3.5Å; I70-Q74 PolarHBondContact O-N 3.34Å; K71-Q74 PolarHBondContact O-N 3.25Å; Q74-T76 VanDerWaalsContact C-N 3.34Å; Q74-T76 PolarHBondContact O-N 2.91Å; Q74-A77 PolarHBondContact O-N 3.01Å; Q74-Y78 WeakPolarHBondContact O-CB 3.19Å; Q74-Y78 PolarHBondContact O-N 2.96Å
75	Q	97.7	Very high	96.9	Very high	102 Å²	102	97.1 Å²	97.1	48%	0.477	48%	0.481	S	S	.	.	H	α-helix	trans	-62.5	-42	176.7	-172.8	63.6	49.2	0	0	111.7	K71 K72 M73 N79	K71-Q75 WeakPolarHBondContact O-CB 3.32Å; K71-Q75 PolarHBondContact O-N 2.96Å; K72-Q75 PolarHBondContact O-N 2.87Å; M73-Q75 VanDerWaalsContact C-N 3.33Å; M73-Q75 PolarHBondContact O-N 3.05Å; Q75-N79 PolarHBondContact NE2-OD1 3.45Å; Q75-N79 VanDerWaalsContact O-CB 3.29Å; Q75-N79 WeakPolarHBondContact O-CB 3.29Å; Q75-N79 PolarHBondContact O-N 3.25Å; Q75-N79 PolarHBondContact O-ND2 2.75Å
76	T	98.3	Very high	96.8	Very high	79 Å²	79	98.9 Å²	98.9	49%	0.485	49%	0.489	S	S	.	.	H	α-helix	trans	-62.3	-48.1	175.4	-60.7	0	0	0	0	111.1	K72 M73 Q74 Y78 N79 L80	K72-T76 PolarHBondContact O-N 3.38Å; K72-T76 PolarHBondContact O-OG1 3.29Å; K72-T76 VanDerWaalsContact O-OG1 3.1Å; M73-T76 WeakPolarHBondContact O-CB 3.32Å; M73-T76 PolarHBondContact O-N 3.34Å; Q74-T76 VanDerWaalsContact C-N 3.34Å; Q74-T76 PolarHBondContact O-N 2.91Å; T76-Y78 PolarHBondContact O-N 3.49Å; T76-N79 PolarHBondContact O-N 3.25Å; T76-L80 WeakPolarHBondContact O-CB 3.42Å; T76-L80 PolarHBondContact O-N 3.48Å
77	A	97.6	Very high	96.7	Very high	61 Å²	61	101.8 Å²	101.8	50%	0.504	50%	0.5	S	S	.	.	H	α-helix	trans	-61.4	-43.7	178.2	0	0	0	0	0	111.9	M73 Q74 L80 G81	M73-A77 WeakPolarHBondContact O-CB 3.4Å; M73-A77 PolarHBondContact O-N 3.03Å; Q74-A77 PolarHBondContact O-N 3.01Å; A77-L80 PolarHBondContact O-N 2.84Å; A77-G81 PolarHBondContact O-N 3.29Å
78	Y	97.3	Very high	96.4	Very high	154 Å²	154	100.9 Å²	100.9	60%	0.604	50%	0.497	S	S	*	.	H	α-helix	trans	-61.8	-47.1	175.6	174.7	-99.4	0	0	0	112.2	Q74 T76 L80 G81 R82	Q74-Y78 WeakPolarHBondContact O-CB 3.19Å; Q74-Y78 PolarHBondContact O-N 2.96Å; T76-Y78 PolarHBondContact O-N 3.49Å; Y78-L80 VanDerWaalsContact C-N 3.32Å; Y78-L80 PolarHBondContact O-N 3.48Å; Y78-G81 PolarHBondContact O-N 3.11Å; Y78-R82 PolarHBondContact O-N 3.41Å
79	N	98.2	Very high	96	Very high	59 Å²	59	106.3 Å²	106.3	32%	0.316	51%	0.51	S	S	.	.	H	α-helix	trans	-62.6	-41.1	178	-74.1	-19	0	0	0	111.7	Q75 T76 R82 I83	Q75-N79 PolarHBondContact NE2-OD1 3.45Å; Q75-N79 VanDerWaalsContact O-CB 3.29Å; Q75-N79 WeakPolarHBondContact O-CB 3.29Å; Q75-N79 PolarHBondContact O-N 3.25Å; Q75-N79 PolarHBondContact O-ND2 2.75Å; T76-N79 PolarHBondContact O-N 3.25Å; N79-R82 PolarHBondContact O-N 3.14Å; N79-I83 WeakPolarHBondContact O-CG1 3.37Å; N79-I83 PolarHBondContact O-N 2.87Å; N79-I83 VanDerWaalsContact O-N 3.12Å
80	L	98.2	Very high	95.9	Very high	107 Å²	107	110.2 Å²	110.2	56%	0.56	52%	0.522	S	S	*	.	H	α-helix	trans	-61.2	-50.2	175.7	-179.4	61.4	0	0	0	110.6	T76 A77 Y78 R82 I83 E84	T76-L80 WeakPolarHBondContact O-CB 3.42Å; T76-L80 PolarHBondContact O-N 3.48Å; A77-L80 PolarHBondContact O-N 2.84Å; Y78-L80 VanDerWaalsContact C-N 3.32Å; Y78-L80 PolarHBondContact O-N 3.48Å; L80-R82 VanDerWaalsContact C-N 3.28Å; L80-R82 PolarHBondContact O-N 3.33Å; L80-I83 PolarHBondContact O-N 2.91Å; L80-I83 VanDerWaalsContact O-N 3.11Å; L80-E84 WeakPolarHBondContact O-CB 3.33Å; L80-E84 PolarHBondContact O-N 3.04Å
81	G	96.6	Very high	95.6	Very high	33 Å²	33	106.8 Å²	106.8	34%	0.34	51%	0.506	S	S	.	.	H	α-helix	trans	-58.4	-38	178	0	0	0	0	0	113	A77 Y78 E84 Q85	A77-G81 PolarHBondContact O-N 3.29Å; Y78-G81 PolarHBondContact O-N 3.11Å; G81-E84 PolarHBondContact O-N 3.02Å; G81-Q85 WeakPolarHBondContact O-CB 3.38Å; G81-Q85 PolarHBondContact O-N 3.12Å
82	R	96.3	Very high	95.1	Very high	127 Å²	127	104.4 Å²	104.4	48%	0.479	51%	0.507	S	S	.	.	H	α-helix	trans	-65.2	-41.6	175.7	-171.5	179.1	63.7	84.8	2.7	112.6	Y78 N79 L80 Q86	Y78-R82 PolarHBondContact O-N 3.41Å; N79-R82 PolarHBondContact O-N 3.14Å; L80-R82 VanDerWaalsContact C-N 3.28Å; L80-R82 PolarHBondContact O-N 3.33Å; R82-Q86 PolarHBondContact O-N 2.78Å
83	I	97.6	Very high	94.7	Very high	96 Å²	96	104.8 Å²	104.8	49%	0.492	52%	0.515	S	S	.	.	H	α-helix	trans	-68.4	-44.9	177.6	-68.6	166.9	0	0	0	109.9	N79 L80 Q85 Q86 E87	N79-I83 WeakPolarHBondContact O-CG1 3.37Å; N79-I83 PolarHBondContact O-N 2.87Å; N79-I83 VanDerWaalsContact O-N 3.12Å; L80-I83 PolarHBondContact O-N 2.91Å; L80-I83 VanDerWaalsContact O-N 3.11Å; I83-Q85 PolarHBondContact O-N 3Å; I83-Q86 WeakPolarHBondContact O-CB 3.46Å; I83-Q86 PolarHBondContact O-N 2.77Å; I83-E87 PolarHBondContact O-N 3.13Å
84	E	95	Very high	94.4	Very high	112 Å²	112	103.7 Å²	103.7	52%	0.523	51%	0.511	S	S	.	.	H	α-helix	trans	-60.1	-45.6	177.6	-174.8	173.8	-167.1	0	0	111.2	L80 G81 Q86 E87 L88	L80-E84 WeakPolarHBondContact O-CB 3.33Å; L80-E84 PolarHBondContact O-N 3.04Å; G81-E84 PolarHBondContact O-N 3.02Å; E84-Q86 VanDerWaalsContact C-N 3.31Å; E84-Q86 PolarHBondContact O-N 3.22Å; E84-E87 PolarHBondContact O-N 2.97Å; E84-E87 VanDerWaalsContact O-N 3.13Å; E84-L88 HydrophobicContact CG-CD1 4.03Å; E84-L88 HydrophobicContact CG-CG 4.3Å; E84-L88 WeakPolarHBondContact O-CB 3.26Å; E84-L88 VanDerWaalsContact O-CG 3.28Å; E84-L88 WeakPolarHBondContact O-CG 3.5Å; E84-L88 PolarHBondContact O-N 3.48Å
85	Q	93.1	Very high	93.9	Very high	140 Å²	140	106.3 Å²	106.3	65%	0.654	52%	0.516	S	S	*	.	H	α-helix	trans	-59.3	-41.2	175.5	-174.1	-175.6	7	0	0	112.3	G81 I83 E87 L88 R89	G81-Q85 WeakPolarHBondContact O-CB 3.38Å; G81-Q85 PolarHBondContact O-N 3.12Å; I83-Q85 PolarHBondContact O-N 3Å; Q85-E87 VanDerWaalsContact C-N 3.34Å; Q85-L88 PolarHBondContact O-N 3.41Å; Q85-R89 WeakPolarHBondContact O-CB 3.42Å; Q85-R89 PolarHBondContact O-N 3.49Å
86	Q	93.9	Very high	93.4	Very high	131 Å²	131	106.1 Å²	106.1	61%	0.612	52%	0.522	S	S	*	.	H	α-helix	trans	-62.9	-43.2	176.4	-179.7	177.8	-11.7	0	0	111.2	R82 I83 E84 R89 R90	R82-Q86 PolarHBondContact O-N 2.78Å; I83-Q86 WeakPolarHBondContact O-CB 3.46Å; I83-Q86 PolarHBondContact O-N 2.77Å; E84-Q86 VanDerWaalsContact C-N 3.31Å; E84-Q86 PolarHBondContact O-N 3.22Å; Q86-R89 PolarHBondContact O-N 3.48Å; Q86-R90 PolarHBondContact O-N 3.38Å
87	E	94.8	Very high	92.6	Very high	111 Å²	111	104.1 Å²	104.1	52%	0.519	51%	0.508	S	S	.	.	H	α-helix	trans	-71.4	-36.8	179.7	-164	58.3	-153	0	0	111.9	I83 E84 Q85 R89 R90 G91	I83-E87 PolarHBondContact O-N 3.13Å; E84-E87 PolarHBondContact O-N 2.97Å; E84-E87 VanDerWaalsContact O-N 3.13Å; Q85-E87 VanDerWaalsContact C-N 3.34Å; E87-R89 PolarHBondContact O-N 3.35Å; E87-R90 CarbonylContact O-C 3.58Å; E87-R90 WeakPolarHBondContact O-CB 3.28Å; E87-R90 PolarHBondContact O-N 3.2Å; E87-R90 WeakPolarHBondContact OE1-CD 3.41Å; E87-R90 IonicContact OE1-NE 3.66Å; E87-G91 PolarHBondContact O-N 3.18Å
88	L	90.7	Very high	91.7	Very high	83 Å²	83	106.5 Å²	106.5	44%	0.435	51%	0.509	S	S	.	.	H	α-helix	trans	-62.9	-40.9	172.7	-72.7	173.7	0	0	0	111.5	E84 Q85 R90 G91 A92 L97	E84-L88 HydrophobicContact CG-CD1 4.03Å; E84-L88 HydrophobicContact CG-CG 4.3Å; E84-L88 WeakPolarHBondContact O-CB 3.26Å; E84-L88 VanDerWaalsContact O-CG 3.28Å; E84-L88 WeakPolarHBondContact O-CG 3.5Å; E84-L88 PolarHBondContact O-N 3.48Å; Q85-L88 PolarHBondContact O-N 3.41Å; L88-R90 VanDerWaalsContact C-N 3.32Å; L88-R90 PolarHBondContact O-N 2.97Å; L88-G91 CarbonylContact O-C 3.59Å; L88-G91 PolarHBondContact O-N 3.33Å; L88-A92 WeakPolarHBondContact O-CB 3.44Å; L88-A92 PolarHBondContact O-N 3.12Å; L88-L97 HydrophobicContact CD2-CD1 3.96Å
89	R	89.2	Confident	90.6	Very high	205 Å²	205	106.6 Å²	106.6	77%	0.774	52%	0.519	S	S	*	.	H	α-helix	trans	-62.9	-40.6	174.6	-177.3	174.3	180	158.3	1.6	111.6	Q85 Q86 E87 A92 L93	Q85-R89 WeakPolarHBondContact O-CB 3.42Å; Q85-R89 PolarHBondContact O-N 3.49Å; Q86-R89 PolarHBondContact O-N 3.48Å; E87-R89 PolarHBondContact O-N 3.35Å; R89-A92 PolarHBondContact O-N 3.11Å; R89-L93 PolarHBondContact O-N 3.18Å; R89-L93 VanDerWaalsContact O-N 3.09Å
90	R	92.1	Very high	89.3	Confident	144 Å²	144	110.3 Å²	110.3	54%	0.543	54%	0.536	S	S	.	.	H	α-helix	trans	-63.8	-43.7	173	175.9	-178.5	162.5	79.6	5.7	110.7	Q86 E87 L88 A92 L93 L94	Q86-R90 PolarHBondContact O-N 3.38Å; E87-R90 CarbonylContact O-C 3.58Å; E87-R90 WeakPolarHBondContact O-CB 3.28Å; E87-R90 PolarHBondContact O-N 3.2Å; E87-R90 WeakPolarHBondContact OE1-CD 3.41Å; E87-R90 IonicContact OE1-NE 3.66Å; L88-R90 VanDerWaalsContact C-N 3.32Å; L88-R90 PolarHBondContact O-N 2.97Å; R90-A92 VanDerWaalsContact C-N 3.34Å; R90-A92 PolarHBondContact O-N 2.96Å; R90-L93 PolarHBondContact O-N 3.22Å; R90-L94 HydrophobicContact CG-CD1 4.01Å; R90-L94 WeakPolarHBondContact O-CG 3.38Å; R90-L94 PolarHBondContact O-N 2.64Å
91	G	90.1	Very high	87.5	Confident	7 Å²	7	111.1 Å²	111.1	7%	0.072	54%	0.541	C	S	.	.	H	α-helix	trans	-60.6	-41.4	176.9	0	0	0	0	0	112.8	E87 L88 L94 R95 V96	E87-G91 PolarHBondContact O-N 3.18Å; L88-G91 CarbonylContact O-C 3.59Å; L88-G91 PolarHBondContact O-N 3.33Å; G91-L94 CarbonylContact O-C 3.46Å; G91-L94 PolarHBondContact O-N 3.47Å; G91-R95 PolarHBondContact O-N 3.41Å; G91-V96 WeakPolarHBondContact O-CG2 3.45Å; G91-V96 PolarHBondContact O-N 3.47Å; G91-V96 VanDerWaalsContact O-N 3.12Å
92	A	87.6	Confident	85.7	Confident	61 Å²	61	116.7 Å²	116.7	50%	0.504	56%	0.558	S	S	.	*	H	α-helix	trans	-63.8	-43.4	175.2	0	0	0	0	0	112	L88 R89 R90 L94 R95	L88-A92 WeakPolarHBondContact O-CB 3.44Å; L88-A92 PolarHBondContact O-N 3.12Å; R89-A92 PolarHBondContact O-N 3.11Å; R90-A92 VanDerWaalsContact C-N 3.34Å; R90-A92 PolarHBondContact O-N 2.96Å; A92-L94 VanDerWaalsContact C-N 3.27Å; A92-L94 PolarHBondContact O-N 2.97Å; A92-R95 PolarHBondContact O-N 3.28Å; A92-R95 VanDerWaalsContact O-N 3.14Å
93	L	88.9	Confident	83.7	Confident	146 Å²	146	116.7 Å²	116.7	76%	0.764	57%	0.574	S	S	*	*	H	α-helix	trans	-62.6	-36.4	175.6	-178.5	62.8	0	0	0	112.2	R89 R90 R95	R89-L93 PolarHBondContact O-N 3.18Å; R89-L93 VanDerWaalsContact O-N 3.09Å; R90-L93 PolarHBondContact O-N 3.22Å; L93-R95 VanDerWaalsContact C-N 3.29Å
94	L	92.3	Very high	81.6	Confident	96 Å²	96	116.3 Å²	116.3	50%	0.503	58%	0.58	S	S	.	*	T	Hydrogen-bonded Turn	trans	-85.9	1.3	178.2	-64	176.3	0	0	0	113.5	R90 G91 A92 V96	R90-L94 HydrophobicContact CG-CD1 4.01Å; R90-L94 WeakPolarHBondContact O-CG 3.38Å; R90-L94 PolarHBondContact O-N 2.64Å; G91-L94 CarbonylContact O-C 3.46Å; G91-L94 PolarHBondContact O-N 3.47Å; A92-L94 VanDerWaalsContact C-N 3.27Å; A92-L94 PolarHBondContact O-N 2.97Å; L94-V96 HydrophobicContact CB-CG1 4.14Å; L94-V96 PolarHBondContact O-N 3.02Å; L94-V96 VanDerWaalsContact O-N 3.11Å
95	R	86.8	Confident	79.4	Confident	178 Å²	178	119.3 Å²	119.3	67%	0.672	59%	0.594	S	S	*	*	T	Hydrogen-bonded Turn	trans	52.7	27.3	-178.8	-56.6	-175	-177.2	-171.1	-2	114.6	G91 A92 L93 L97 E98	G91-R95 PolarHBondContact O-N 3.41Å; A92-R95 PolarHBondContact O-N 3.28Å; A92-R95 VanDerWaalsContact O-N 3.14Å; L93-R95 VanDerWaalsContact C-N 3.29Å; R95-L97 PolarHBondContact O-N 3.18Å; R95-E98 HydrophobicContact CB-CB 4.43Å; R95-E98 WeakPolarHBondContact CD-OE2 3.36Å; R95-E98 PolarHBondContact O-N 3.27Å
96	V	87.7	Confident	77.1	Confident	99 Å²	99	118.3 Å²	118.3	60%	0.6	60%	0.602	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.3	-11	176.5	-60.2	0	0	0	0	112.6	G91 L94	G91-V96 WeakPolarHBondContact O-CG2 3.45Å; G91-V96 PolarHBondContact O-N 3.47Å; G91-V96 VanDerWaalsContact O-N 3.12Å; L94-V96 HydrophobicContact CB-CG1 4.14Å; L94-V96 PolarHBondContact O-N 3.02Å; L94-V96 VanDerWaalsContact O-N 3.11Å
97	L	80.6	Confident	75.1	Confident	37 Å²	37	119.2 Å²	119.2	19%	0.194	61%	0.61	C	S	.	*	T	Hydrogen-bonded Turn	trans	-100.5	1.2	177.5	-52.7	178.1	0	0	0	112.3	L88 R95 D99 M100 L101	L88-L97 HydrophobicContact CD2-CD1 3.96Å; R95-L97 PolarHBondContact O-N 3.18Å; L97-D99 VanDerWaalsContact C-N 3.28Å; L97-D99 PolarHBondContact O-N 3.46Å; L97-M100 HydrophobicContact CD2-CE 4.2Å; L97-M100 HydrophobicContact CD2-SD 3.61Å; L97-M100 WeakPolarHBondContact O-CB 3.44Å; L97-M100 PolarHBondContact O-N 3.06Å; L97-L101 PolarHBondContact O-N 3.19Å
98	E	79.3	Confident	72.5	Confident	111 Å²	111	118.9 Å²	118.9	52%	0.519	62%	0.618	S	S	.	*	T	Hydrogen-bonded Turn	trans	-62.3	-36.8	-174.2	-164.7	162.4	-163.1	0	0	111.4	R95 M100 L101	R95-E98 HydrophobicContact CB-CB 4.43Å; R95-E98 WeakPolarHBondContact CD-OE2 3.36Å; R95-E98 PolarHBondContact O-N 3.27Å; E98-M100 VanDerWaalsContact C-N 3.26Å; E98-M100 PolarHBondContact O-N 3.42Å; E98-L101 PolarHBondContact O-N 3.34Å
99	D	74.4	Confident	70.3	Confident	155 Å²	155	124.1 Å²	124.1	83%	0.829	64%	0.639	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.4	-14.5	175.3	-58	-17.2	0	0	0	113.4	L97	L97-D99 VanDerWaalsContact C-N 3.28Å; L97-D99 PolarHBondContact O-N 3.46Å
100	M	69.9	Low	68	Low	137 Å²	137	123.3 Å²	123.3	68%	0.675	64%	0.644	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.7	-24.4	176.3	-67.4	176.8	40.3	0	0	112.6	L97 E98 E102	L97-M100 HydrophobicContact CD2-CE 4.2Å; L97-M100 HydrophobicContact CD2-SD 3.61Å; L97-M100 WeakPolarHBondContact O-CB 3.44Å; L97-M100 PolarHBondContact O-N 3.06Å; E98-M100 VanDerWaalsContact C-N 3.26Å; E98-M100 PolarHBondContact O-N 3.42Å; M100-E102 VanDerWaalsContact C-N 3.31Å; M100-E102 PolarHBondContact O-N 3.5Å
101	L	61	Low	65.4	Low	124 Å²	124	124.6 Å²	124.6	65%	0.649	66%	0.657	S	S	*	*	S	Bend	trans	-85.1	82.6	169.1	-72.7	141.6	0	0	0	106.2	L97 E98 P103	L97-L101 PolarHBondContact O-N 3.19Å; E98-L101 PolarHBondContact O-N 3.34Å; L101-P103 VanDerWaalsContact O-N 3.15Å
102	E	59	Low	62.9	Low	151 Å²	151	129.7 Å²	129.7	71%	0.706	69%	0.691	S	S	*	*			trans	-43.4	129.4	158.5	-74.9	-67.1	157.5	0	0	107.1	M100 S104	M100-E102 VanDerWaalsContact C-N 3.31Å; M100-E102 PolarHBondContact O-N 3.5Å; E102-S104 PolarHBondContact O-N 2.81Å
103	P	52.7	Low	60.5	Low	126 Å²	126	132.6 Å²	132.6	82%	0.818	70%	0.702	S	S	*	*			trans	-69.6	76.1	-167.8	23.9	-30.7	0	0	0	110.7	L101 E105	L101-P103 VanDerWaalsContact O-N 3.15Å; P103-E105 PolarHBondContact O-N 3.09Å
104	S	53.9	Low	58.1	Low	88 Å²	88	133.8 Å²	133.8	62%	0.615	70%	0.704	S	S	*	*			trans	-85.6	107.7	169.2	60.7	0	0	0	0	107.5	E102	E102-S104 PolarHBondContact O-N 2.81Å
105	E	49	Very low	55.5	Low	175 Å²	175	137.4 Å²	137.4	82%	0.818	72%	0.716	S	S	*	*			trans	16	113.2	155.9	-65	179.2	159.1	0	0	116.7	P103 I107	P103-E105 PolarHBondContact O-N 3.09Å; E105-I107 PolarHBondContact O-N 3Å
106	S	45.5	Very low	53.1	Low	119 Å²	119	135.8 Å²	135.8	83%	0.832	72%	0.721	S	S	*	*			trans	-24	102.9	167.6	54.4	0	0	0	0	114.7	P108	S106-P108 WeakPolarHBondContact O-CD 3.42Å
107	I	52	Low	50.8	Low	150 Å²	150	138.5 Å²	138.5	77%	0.769	73%	0.726	S	S	*	*			trans	-81.5	119.2	163.7	-57.5	175.8	0	0	0	106.7	E105 H109	E105-I107 PolarHBondContact O-N 3Å; I107-H109 PolarHBondContact O-N 3.47Å
108	P	40	Very low	48.9	Very low	105 Å²	105	142.4 Å²	142.4	68%	0.682	75%	0.754	S	S	*	*			trans	-56.9	133.2	175.3	-23.8	34.4	0	0	0	110.5	S106 E110	S106-P108 WeakPolarHBondContact O-CD 3.42Å; P108-E110 PolarHBondContact O-N 3.04Å
109	H	44.7	Very low	47.3	Very low	192 Å²	192	146 Å²	146	89%	0.889	77%	0.773	S	S	*	*			trans	-54.2	98.9	170.6	-68.9	-74.9	0	0	0	109.6	I107 E111	I107-H109 PolarHBondContact O-N 3.47Å; H109-E111 PolarHBondContact O-N 3.34Å
110	E	40.8	Very low	45.7	Very low	188 Å²	188	145.7 Å²	145.7	88%	0.879	77%	0.771	S	S	*	*			trans	-73.8	91.7	160	-69.9	-147	157.5	0	0	107.3	P108 S112	P108-E110 PolarHBondContact O-N 3.04Å; E110-S112 VanDerWaalsContact C-N 3.33Å; E110-S112 PolarHBondContact O-N 2.86Å
111	E	37.2	Very low	44.2	Very low	171 Å²	171	143.8 Å²	143.8	80%	0.799	77%	0.771	S	S	*	*			trans	-55.3	98.8	160.2	-176.9	175.2	-175.2	0	0	107.5	H109 V113	H109-E111 PolarHBondContact O-N 3.34Å; E111-V113 VanDerWaalsContact C-N 3.26Å; E111-V113 PolarHBondContact O-N 3.38Å
112	S	37.6	Very low	43	Very low	114 Å²	114	141.8 Å²	141.8	80%	0.797	77%	0.773	S	S	*	*			trans	-63.6	94.6	170	45.1	0	0	0	0	108	E110 E114	E110-S112 VanDerWaalsContact C-N 3.33Å; E110-S112 PolarHBondContact O-N 2.86Å; S112-E114 PolarHBondContact O-N 2.98Å; S112-E114 VanDerWaalsContact O-N 3.08Å
113	V	37.2	Very low	42.4	Very low	122 Å²	122	141 Å²	141	74%	0.739	78%	0.78	S	S	*	*			trans	-42.1	112.1	169.3	171.1	0	0	0	0	108.8	E111 K115	E111-V113 VanDerWaalsContact C-N 3.26Å; E111-V113 PolarHBondContact O-N 3.38Å; V113-K115 PolarHBondContact O-N 2.9Å
114	E	37.5	Very low	41.8	Very low	171 Å²	171	141.2 Å²	141.2	80%	0.799	78%	0.78	S	S	*	*			trans	-54.2	101.1	167.4	-174	163.1	172.5	0	0	108.1	S112 D116	S112-E114 PolarHBondContact O-N 2.98Å; S112-E114 VanDerWaalsContact O-N 3.08Å; E114-D116 VanDerWaalsContact C-N 3.31Å; E114-D116 PolarHBondContact O-N 2.94Å
115	K	38.5	Very low	40.8	Very low	172 Å²	172	144 Å²	144	75%	0.748	79%	0.788	S	S	*	*			trans	-74.4	93.3	173.3	-119.3	178.9	-177.4	175.4	0	107	V113 H117	V113-K115 PolarHBondContact O-N 2.9Å; K115-H117 PolarHBondContact O-N 2.9Å; K115-H117 PolarHBondContact O-ND1 3.14Å
116	D	36.1	Very low	40.4	Very low	145 Å²	145	140.8 Å²	140.8	78%	0.775	78%	0.784	S	S	*	*			trans	-41.1	100.4	164.3	-81.6	-52.6	0	0	0	109.8	E114	E114-D116 VanDerWaalsContact C-N 3.31Å; E114-D116 PolarHBondContact O-N 2.94Å
117	H	38.8	Very low	40	Very low	155 Å²	155	141 Å²	141	72%	0.718	78%	0.781	S	S	*	*			trans	-93.3	114.7	160	-70.9	74.8	0	0	0	105.5	K115 M119	K115-H117 PolarHBondContact O-N 2.9Å; K115-H117 PolarHBondContact O-ND1 3.14Å; H117-M119 PolarHBondContact O-N 2.88Å; H117-M119 VanDerWaalsContact O-N 3.14Å
118	P	42.7	Very low	39.5	Very low	119 Å²	119	138.7 Å²	138.7	77%	0.773	79%	0.785	S	S	*	*			trans	-60	124	179.3	24.2	-31	0	0	0	108	D120	P118-D120 PolarHBondContact O-N 3.39Å
119	M	45.3	Very low	39.4	Very low	188 Å²	188	142.5 Å²	142.5	93%	0.926	79%	0.793	S	S	*	*			trans	-50.2	101.2	168	-77.3	-79	-178.9	0	0	108.3	H117 S121	H117-M119 PolarHBondContact O-N 2.88Å; H117-M119 VanDerWaalsContact O-N 3.14Å; M119-S121 PolarHBondContact O-N 3.39Å
120	D	40	Very low	39	Very low	147 Å²	147	141.9 Å²	141.9	79%	0.786	79%	0.791	S	S	*	*			trans	-66.8	127.7	168.4	-160.4	-4.1	0	0	0	107.5	P118 A122	P118-D120 PolarHBondContact O-N 3.39Å; D120-A122 PolarHBondContact O-N 3.14Å
121	S	39.5	Very low	39.1	Very low	97 Å²	97	138.4 Å²	138.4	68%	0.678	78%	0.784	S	S	*	*			trans	-37.9	121.1	-171.6	26.7	0	0	0	0	114.3	M119	M119-S121 PolarHBondContact O-N 3.39Å
122	A	35.7	Very low	39.4	Very low	82 Å²	82	135.8 Å²	135.8	68%	0.678	79%	0.785	S	S	*	*			trans	-55.2	131	166.7	0	0	0	0	0	110.3	D120 T124	D120-A122 PolarHBondContact O-N 3.14Å; A122-T124 PolarHBondContact O-N 3.01Å
123	P	45.8	Very low	39.6	Very low	134 Å²	134	136.8 Å²	136.8	87%	0.87	79%	0.787	S	S	*	*			trans	-68.7	101.2	165.6	-9.2	24.8	0	0	0	108
124	T	39.2	Very low	40.3	Very low	131 Å²	131	136.9 Å²	136.9	80%	0.804	79%	0.79	S	S	*	*			trans	-68.4	141.6	155	46.6	0	0	0	0	108.6	A122	A122-T124 PolarHBondContact O-N 3.01Å
125	D	34.5	Very low	40.6	Very low	148 Å²	148	134 Å²	134	79%	0.791	79%	0.789	S	S	*	*			trans	102.7	93.7	162.4	-157.6	28.4	0	0	0	116.4
126	S	39.5	Very low	40.6	Very low	106 Å²	106	132 Å²	132	74%	0.741	79%	0.791	S	S	*	*				-168.6	113.6	110.1	-135.9	0	0	0	0	110.8	A128	S126-A128 PolarHBondContact O-N 2.82Å
127	T	37	Very low	41	Very low	124 Å²	124	134 Å²	134	76%	0.761	80%	0.795	S	S	*	*			trans	-7.9	102.3	143.7	-56	0	0	0	0	114.5
128	A	41.2	Very low	41.1	Very low	102 Å²	102	131 Å²	131	84%	0.843	80%	0.798	S	S	*	*			trans	-101.8	103.9	162.3	0	0	0	0	0	108	S126 E130	S126-A128 PolarHBondContact O-N 2.82Å; A128-E130 PolarHBondContact O-N 3.08Å
129	E	39.4	Very low	40.9	Very low	185 Å²	185	132.4 Å²	132.4	86%	0.864	80%	0.804	S	S	*	*			trans	-65.3	106.4	176.4	-159.9	179.2	151.8	0	0	109.8
130	E	35.6	Very low	40.9	Very low	179 Å²	179	127.7 Å²	127.7	84%	0.836	80%	0.795	S	S	*	*			trans	-74.6	151	146.8	-95	-168.9	143.2	0	0	107.5	A128	A128-E130 PolarHBondContact O-N 3.08Å
131	P	41.8	Very low	41	Very low	115 Å²	115	128.1 Å²	128.1	75%	0.747	80%	0.797	S	S	*	*			cis	-140.8	161.4	17	37.7	-18.3	0	0	0	114.7
132	S	44.5	Very low	41	Very low	116 Å²	116	129.6 Å²	129.6	81%	0.811	81%	0.806	S	S	*	*			trans	-159.3	113.2	143.6	46.1	0	0	0	0	111.3	P134	S132-P134 WeakPolarHBondContact O-CD 3.42Å
133	T	41.1	Very low	41.4	Very low	135 Å²	135	138.8 Å²	138.8	83%	0.828	83%	0.83	S	S	*	*	P	Polyproline II helix	trans	-67.4	125.4	166.9	44.7	0	0	0	0	110
134	P	51.7	Low	41.2	Very low	124 Å²	124	139 Å²	139	81%	0.805	83%	0.828	S	S	*	*	P	Polyproline II helix	trans	-84.3	117	157	28	-20.4	0	0	0	108.7	S132	S132-P134 WeakPolarHBondContact O-CD 3.42Å
135	S	44.2	Very low	41.3	Very low	111 Å²	111	139.4 Å²	139.4	78%	0.776	83%	0.83	S	S	*	*	P	Polyproline II helix	trans	-51.4	136	164.2	-80.5	0	0	0	0	111.6
136	T	38.6	Very low	41.7	Very low	129 Å²	129	138.9 Å²	138.9	79%	0.791	83%	0.832	S	S	*	*			trans	8.6	117.9	131	-50.6	0	0	0	0	116.7
137	E	45.1	Very low	41.8	Very low	186 Å²	186	140.9 Å²	140.9	87%	0.869	84%	0.837	S	S	*	*			trans	-177.1	110.5	138.1	-102.1	167.1	-161.5	0	0	107.7
138	A	39.9	Very low	42.1	Very low	93 Å²	93	141.9 Å²	141.9	77%	0.769	84%	0.842	S	S	*	*				98.9	115.1	89.5	0	0	0	0	0	111.7
139	V	39.4	Very low	42.2	Very low	149 Å²	149	144.6 Å²	144.6	90%	0.903	84%	0.842	S	S	*	*			trans	-46.6	125.9	170.1	178.4	0	0	0	0	111.6
140	A	45.4	Very low	42.4	Very low	89 Å²	89	141.7 Å²	141.7	74%	0.736	84%	0.84	S	S	*	*			trans	-142.8	91	161.9	0	0	0	0	0	110.7	C142	A140-C142 PolarHBondContact O-N 2.99Å
141	N	41	Very low	42.9	Very low	155 Å²	155	138.8 Å²	138.8	83%	0.829	84%	0.841	S	S	*	*			trans	-3.7	110.8	145.5	-158.6	35.1	0	0	0	116.2
142	C	40.9	Very low	43	Very low	129 Å²	129	140.8 Å²	140.8	87%	0.872	85%	0.848	S	S	*	*			trans	-101.4	115.3	160.6	-87.5	0	0	0	0	108.9	A140	A140-C142 PolarHBondContact O-N 2.99Å
143	K	44.5	Very low	42.9	Very low	274 Å²	274	143.1 Å²	143.1	100%	1.191	85%	0.852	S	S	*	*			trans	-25.6	0	171	-104.9	167.9	169.2	178.1	0	117.3

Retrieved 143 of 143 residues in 123.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).