A0A077Z657_TRITR Loading...

TIL domain containing protein

AlphaFold DB , UniProt , Accession A0A077Z657, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 76 aa.

						>A0A077Z657_TRITR|A0A077Z657
MSTVYWHFHCFLASAEQKCGPDEVFRRCGSACPLTCDDVKNPNRNKVCSRQCVAGCFCKAGFALNAAKVCVPTSSC
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50.6	Low	56.5	Low	238 Å²	238	170.5 Å²	170.5	100%	1.172	83%	0.832	S	S	*	*				0	111.3	0	-59	139.7	93.7	0	0	104.7
2	S	53.3	Low	56.4	Low	110 Å²	110	168.8 Å²	168.8	77%	0.769	83%	0.828	S	S	*	*				-154.3	145.9	53.2	-62.7	0	0	0	0	110.6
3	T	64.2	Low	56.7	Low	101 Å²	101	162.8 Å²	162.8	62%	0.62	82%	0.822	S	S	*	*			trans	-47.2	129.7	177.9	29.4	0	0	0	0	113.6	Y5	T3-Y5 WeakPolarHBondContact O-CD2 3.21Å; T3-Y5 WeakPolarHBondContact O-CE2 3.47Å; T3-Y5 PolarHBondContact O-N 2.96Å
4	V	64.4	Low	56.9	Low	130 Å²	130	157.6 Å²	157.6	79%	0.788	81%	0.808	S	S	*	*			trans	-60.6	102.2	166.5	-96	0	0	0	0	109.6	W6	V4-W6 PolarHBondContact O-N 3.07Å
5	Y	59.7	Low	57.1	Low	202 Å²	202	153.5 Å²	153.5	79%	0.792	81%	0.807	S	S	*	*			trans	-75.7	71.5	170.1	-63.6	-80	0	0	0	110	T3	T3-Y5 WeakPolarHBondContact O-CD2 3.21Å; T3-Y5 WeakPolarHBondContact O-CE2 3.47Å; T3-Y5 PolarHBondContact O-N 2.96Å
6	W	58.2	Low	57.4	Low	223 Å²	223	152.3 Å²	152.3	85%	0.845	80%	0.796	S	S	*	*			trans	-115.1	37.8	175.6	-88.8	91.6	0	0	0	111.9	V4	V4-W6 PolarHBondContact O-N 3.07Å
7	H	55.6	Low	57.9	Low	164 Å²	164	152.5 Å²	152.5	76%	0.759	79%	0.792	S	S	*	*	S	Bend	trans	-153.8	32.3	-179	-120.5	-77.2	0	0	0	117.1
8	F	56.2	Low	59.4	Low	205 Å²	205	153.9 Å²	153.9	90%	0.899	79%	0.791	S	S	*	*	S	Bend	trans	-144	16.4	179.1	-110.3	-80.8	0	0	0	118.4
9	H	53	Low	61.3	Low	193 Å²	193	147.5 Å²	147.5	89%	0.894	76%	0.761	S	S	*	*	S	Bend	trans	-133.2	131.3	172.8	-109.4	-159.4	0	0	0	112.4
10	C	52.7	Low	62.9	Low	107 Å²	107	141.7 Å²	141.7	72%	0.723	74%	0.739	S	S	*	*			trans	87.8	33.7	160.6	-96.6	0	0	0	0	120
11	F	53.7	Low	64.4	Low	202 Å²	202	140.1 Å²	140.1	89%	0.886	74%	0.737	S	S	*	*			trans	-88.9	24.6	146.3	-69.6	-72.9	0	0	0	112.2	A13	F11-A13 PolarHBondContact O-N 2.75Å
12	L	55.8	Low	66.7	Low	151 Å²	151	131.4 Å²	131.4	79%	0.791	70%	0.696	S	S	*	*			trans	-73	72.5	158.3	-60.8	176.2	0	0	0	106.2	S14	L12-S14 PolarHBondContact O-N 2.86Å
13	A	60.4	Low	68.8	Low	90 Å²	90	128.6 Å²	128.6	74%	0.744	67%	0.67	S	S	*	*			trans	-57.8	94.4	162.5	0	0	0	0	0	104.7	F11 A15	F11-A13 PolarHBondContact O-N 2.75Å; A13-A15 PolarHBondContact O-N 2.92Å
14	S	58.4	Low	70.3	Confident	91 Å²	91	127.1 Å²	127.1	64%	0.636	66%	0.661	S	S	*	*			trans	-51	117.8	165.3	57.3	0	0	0	0	103.6	L12 E16	L12-S14 PolarHBondContact O-N 2.86Å; S14-E16 PolarHBondContact O-N 2.64Å
15	A	60.4	Low	71.8	Confident	96 Å²	96	125.5 Å²	125.5	79%	0.793	64%	0.643	S	S	*	*			trans	-65.2	67.7	163.5	0	0	0	0	0	106.1	A13 Q17	A13-A15 PolarHBondContact O-N 2.92Å; A15-Q17 VanDerWaalsContact C-N 3.31Å; A15-Q17 PolarHBondContact O-N 3.36Å
16	E	62.7	Low	73.6	Confident	134 Å²	134	122.4 Å²	122.4	63%	0.626	63%	0.63	S	S	*	*			trans	-48.9	110.2	158.2	-173.8	92.6	177.3	0	0	102	S14 K18	S14-E16 PolarHBondContact O-N 2.64Å; E16-K18 HydrophobicContact CB-CG 4.13Å; E16-K18 HydrophobicContact CG-CG 3.89Å; E16-K18 WeakPolarHBondContact O-CG 3.46Å; E16-K18 PolarHBondContact O-N 2.93Å
17	Q	64.9	Low	75.4	Confident	156 Å²	156	122.5 Å²	122.5	73%	0.729	63%	0.631	S	S	*	*			trans	-70.3	77.9	-173.9	-162.9	123.3	51.4	0	0	106.9	A15 C19	A15-Q17 VanDerWaalsContact C-N 3.31Å; A15-Q17 PolarHBondContact O-N 3.36Å; Q17-C19 PolarHBondContact O-N 2.65Å
18	K	85.8	Confident	77.3	Confident	177 Å²	177	117.4 Å²	117.4	77%	0.77	61%	0.613	S	S	*	*			trans	-77.4	117.7	-175.9	-72.3	179.8	-175.7	179.7	0	106.3	E16	E16-K18 HydrophobicContact CB-CG 4.13Å; E16-K18 HydrophobicContact CG-CG 3.89Å; E16-K18 WeakPolarHBondContact O-CG 3.46Å; E16-K18 PolarHBondContact O-N 2.93Å
19	C	94	Very high	79.2	Confident	32 Å²	32	107.9 Å²	107.9	22%	0.216	57%	0.572	C	S	.	*			trans	-66	154.5	168.3	-60.3	0	0	0	0	110.3	Q17 E23 F25 C56	Q17-C19 PolarHBondContact O-N 2.65Å; C19-E23 HydrophobicContact CB-CB 3.57Å; C19-F25 WeakPolarHBondContact SG-CA 3.14Å; C19-F25 VanDerWaalsContact SG-CB 3.52Å; C19-F25 PolarHBondContact SG-N 3.24Å; C19-C56 WeakPolarHBondContact CA-SG 3.42Å; C19-C56 HydrophobicContact CB-CB 3.63Å; C19-C56 WeakPolarHBondContact CB-SG 3.38Å; C19-C56 VanDerWaalsContact SG-CA 3.56Å; C19-C56 WeakPolarHBondContact SG-CB 3.18Å; C19-C56 CovalentContact SG-SG 2.03Å; C19-C56 PolarHBondContact SG-SG 2.95Å
20	G	93.4	Very high	81.3	Confident	31 Å²	31	101.7 Å²	101.7	32%	0.32	55%	0.55	S	S	.	*			trans	-67.9	179.4	176.8	0	0	0	0	0	112.6	D22 E23	G20-D22 PolarHBondContact O-N 2.76Å; G20-E23 PolarHBondContact N-OE2 3.43Å; G20-E23 WeakPolarHBondContact O-CB 3.37Å; G20-E23 PolarHBondContact O-N 3.47Å
21	P	95.7	Very high	83.3	Confident	109 Å²	109	98.2 Å²	98.2	71%	0.708	53%	0.53	S	S	*	.	T	Hydrogen-bonded Turn	trans	-52.3	135.3	169.9	-23.8	34.3	0	0	0	111	E23	P21-E23 PolarHBondContact O-N 2.99Å; P21-E23 VanDerWaalsContact O-N 3.13Å
22	D	97.5	Very high	85.3	Confident	56 Å²	56	90 Å²	90	30%	0.299	50%	0.497	S	S	.	.	T	Hydrogen-bonded Turn	trans	59.8	20.8	178.7	-57.3	-49.7	0	0	0	116.6	G20 C58 K59 F62 C70	G20-D22 PolarHBondContact O-N 2.76Å; D22-C58 WeakPolarHBondContact O-CA 3.31Å; D22-K59 HydrophobicContact CB-CD 4.19Å; D22-K59 WeakPolarHBondContact O-CG 3.47Å; D22-K59 PolarHBondContact O-N 3.26Å; D22-K59 IonicContact OD1-NZ 2.76Å; D22-K59 PolarHBondContact OD1-NZ 2.06Å; D22-F62 HydrophobicContact CB-CD1 3.73Å; D22-F62 HydrophobicContact CB-CE1 3.63Å; D22-F62 HydrophobicContact CB-CG 4.45Å; D22-F62 HydrophobicContact CB-CZ 4.27Å; D22-C70 HydrophobicContact CB-CB 4.11Å
23	E	98	Very high	87.2	Confident	50 Å²	50	85.2 Å²	85.2	23%	0.234	48%	0.475	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.6	154.2	169.7	-67.5	-176.4	148.9	0	0	111.8	C19 G20 P21 C56 F57 C70	C19-E23 HydrophobicContact CB-CB 3.57Å; G20-E23 PolarHBondContact N-OE2 3.43Å; G20-E23 WeakPolarHBondContact O-CB 3.37Å; G20-E23 PolarHBondContact O-N 3.47Å; P21-E23 PolarHBondContact O-N 2.99Å; P21-E23 VanDerWaalsContact O-N 3.13Å; E23-C56 HydrophobicContact CB-CB 4.2Å; E23-C56 WeakPolarHBondContact OE2-CB 3.06Å; E23-F57 CarbonylContact C-O 3.6Å; E23-F57 VanDerWaalsContact CA-O 3.23Å; E23-F57 WeakPolarHBondContact CA-O 3.39Å; E23-C70 HydrophobicContact CG-CB 4.47Å; E23-C70 WeakPolarHBondContact CG-SG 3.42Å
24	V	96.8	Very high	89	Confident	70 Å²	70	85 Å²	85	42%	0.424	46%	0.461	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.4	129.7	175.8	-179.8	0	0	0	0	108.3	R26 F57 K59	V24-R26 HydrophobicContact CG1-CG 4.47Å; V24-R26 PolarHBondContact O-N 3.01Å; V24-F57 PolarHBondContact N-O 3.35Å; V24-F57 PolarHBondContact O-N 2.85Å; V24-K59 HydrophobicContact CG2-CG 3.64Å
25	F	96	Very high	90.8	Very high	97 Å²	97	82 Å²	82	43%	0.425	44%	0.438	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-69.4	129.3	173.8	-173.4	-97.2	0	0	0	109.6	C19 R27 G55	C19-F25 WeakPolarHBondContact SG-CA 3.14Å; C19-F25 VanDerWaalsContact SG-CB 3.52Å; C19-F25 PolarHBondContact SG-N 3.24Å; F25-R27 HydrophobicContact CE1-CG 4.14Å; F25-G55 CarbonylContact C-O 3.4Å; F25-G55 WeakPolarHBondContact CA-O 3.47Å
26	R	96	Very high	92.6	Very high	137 Å²	137	78 Å²	78	52%	0.517	41%	0.405	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.3	135.6	174	-56.5	177.2	67.1	-174.3	0.5	108.9	V24 C28 A54 G55 F57	V24-R26 HydrophobicContact CG1-CG 4.47Å; V24-R26 PolarHBondContact O-N 3.01Å; R26-C28 PolarHBondContact O-N 2.87Å; R26-A54 WeakPolarHBondContact O-CA 3.16Å; R26-G55 PolarHBondContact N-O 3.38Å; R26-G55 PolarHBondContact O-N 3.09Å; R26-F57 HydrophobicContact CB-CD2 3.73Å; R26-F57 HydrophobicContact CB-CE2 3.93Å; R26-F57 HydrophobicContact CG-CD2 3.99Å
27	R	96.2	Very high	94.3	Very high	225 Å²	225	75 Å²	75	85%	0.849	39%	0.393	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-68.6	-26.9	172	-66.2	-175.6	-178.5	-174.2	0.4	112.6	F25 A54	F25-R27 HydrophobicContact CE1-CG 4.14Å; R27-A54 WeakPolarHBondContact O-CA 3.01Å; R27-A54 WeakPolarHBondContact O-CB 3.24Å
28	C	96.5	Very high	95.8	Very high	57 Å²	57	68.6 Å²	68.6	39%	0.385	36%	0.364	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.4	112.5	170	168.8	0	0	0	0	109.2	R26 C52	R26-C28 PolarHBondContact O-N 2.87Å; C28-C52 HydrophobicContact CB-CB 3.55Å; C28-C52 WeakPolarHBondContact CB-SG 3.44Å; C28-C52 WeakPolarHBondContact SG-CB 3.37Å; C28-C52 CovalentContact SG-SG 2.03Å; C28-C52 PolarHBondContact SG-SG 2.86Å
29	G	95.8	Very high	96.3	Very high	5 Å²	5	62.7 Å²	62.7	5%	0.052	34%	0.342	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.3	176.7	165.1	0	0	0	0	0	111.2	V53 F57	G29-V53 PolarHBondContact N-O 3.42Å; G29-V53 PolarHBondContact O-N 3.47Å; G29-F57 VanDerWaalsContact CA-CZ 3.47Å
30	S	95.9	Very high	96.5	Very high	62 Å²	62	67.6 Å²	67.6	43%	0.434	36%	0.36	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-66.3	135.4	-179.4	178.6	0	0	0	0	111.3	C32 F57	S30-C32 PolarHBondContact O-N 2.03Å; S30-C32 VanDerWaalsContact OG-C 3.3Å; S30-C32 PolarHBondContact OG-N 2.78Å; S30-C32 PolarHBondContact OG-O 2.82Å; S30-F57 WeakPolarHBondContact O-CE1 3.47Å
31	A	95.9	Very high	96.7	Very high	35 Å²	35	69.9 Å²	69.9	29%	0.289	37%	0.365	S	S	.	.	S	Bend	trans	-63	-17.5	168	0	0	0	0	0	113.1	Q51 V53	A31-Q51 HydrophobicContact CB-CG 3.92Å; A31-V53 HydrophobicContact CB-CG2 3.8Å
32	C	95.9	Very high	96.6	Very high	30 Å²	30	69.6 Å²	69.6	20%	0.203	36%	0.363	C	S	.	.	S	Bend	trans	-117.2	91.4	173.9	-75.7	0	0	0	0	109.8	S30 K46 C48	S30-C32 PolarHBondContact O-N 2.03Å; S30-C32 VanDerWaalsContact OG-C 3.3Å; S30-C32 PolarHBondContact OG-N 2.78Å; S30-C32 PolarHBondContact OG-O 2.82Å; C32-K46 HydrophobicContact CB-CD 4.24Å; C32-C48 HydrophobicContact CB-CB 3.71Å; C32-C48 WeakPolarHBondContact CB-SG 2.99Å; C32-C48 VanDerWaalsContact SG-CA 3.52Å; C32-C48 WeakPolarHBondContact SG-CB 3.12Å; C32-C48 CovalentContact SG-SG 2.02Å; C32-C48 PolarHBondContact SG-SG 2.78Å
33	P	95.4	Very high	96.5	Very high	49 Å²	49	74.6 Å²	74.6	32%	0.318	39%	0.39	S	S	.	.			trans	-62	152.3	173.1	26.7	-34	0	0	0	110.8	K46 L64	P33-K46 PolarHBondContact O-NZ 3.13Å; P33-L64 HydrophobicContact CB-CD1 3.82Å; P33-L64 HydrophobicContact CG-CD1 3.7Å
34	L	96.9	Very high	96.2	Very high	86 Å²	86	78.8 Å²	78.8	45%	0.45	40%	0.404	S	S	.	.			trans	-67.5	130	172.9	-175.4	69.2	0	0	0	109.3	D38 V39 A63 L64 T73	L34-D38 HydrophobicContact CD1-CB 3.85Å; L34-V39 HydrophobicContact CD1-CG2 4.35Å; L34-V39 HydrophobicContact CD2-CG2 4.26Å; L34-V39 HydrophobicContact CG-CG2 4.25Å; L34-A63 HydrophobicContact CB-CB 4.46Å; L34-A63 HydrophobicContact CD2-CB 4.05Å; L34-A63 HydrophobicContact CG-CB 3.9Å; L34-A63 WeakPolarHBondContact O-CA 3.48Å; L34-L64 PolarHBondContact O-N 3.22Å; L34-T73 HydrophobicContact CD2-CG2 4.11Å
35	T	97.8	Very high	95.8	Very high	27 Å²	27	82.5 Å²	82.5	17%	0.166	42%	0.421	C	S	.	.	B	Isolated β-bridge	trans	-117.6	158.7	177.6	69.3	0	0	0	0	110.5	D37 D38 V39 L64	T35-D37 PolarHBondContact O-N 2.03Å; T35-D38 WeakPolarHBondContact CA-OD2 3Å; T35-D38 WeakPolarHBondContact CB-OD2 3.26Å; T35-D38 PolarHBondContact N-OD2 3.38Å; T35-D38 WeakPolarHBondContact O-CB 3.5Å; T35-D38 PolarHBondContact O-N 3.28Å; T35-D38 PolarHBondContact OG1-N 2.91Å; T35-D38 PolarHBondContact OG1-OD2 3.46Å; T35-V39 PolarHBondContact O-N 2.89Å; T35-V39 VanDerWaalsContact O-N 3.11Å; T35-L64 CarbonylContact C-O 3.57Å; T35-L64 VanDerWaalsContact CA-O 3.31Å; T35-L64 WeakPolarHBondContact CA-O 3.44Å; T35-L64 HydrophobicContact CG2-CB 4.33Å
36	C	98.3	Very high	95.7	Very high	14 Å²	14	81.1 Å²	81.1	10%	0.095	42%	0.415	C	S	.	.	H	α-helix	trans	-61.7	-24.7	175	-74.8	0	0	0	0	113.1	V39 K40 L64 C76	C36-V39 PolarHBondContact O-N 2.97Å; C36-K40 WeakPolarHBondContact O-CB 3.44Å; C36-K40 WeakPolarHBondContact O-CG 3.23Å; C36-K40 PolarHBondContact O-N 2.03Å; C36-L64 PolarHBondContact N-O 3.4Å; C36-C76 WeakPolarHBondContact CA-SG 3.36Å; C36-C76 HydrophobicContact CB-CB 3.54Å; C36-C76 WeakPolarHBondContact CB-SG 3.19Å; C36-C76 VanDerWaalsContact SG-CA 3.54Å; C36-C76 WeakPolarHBondContact SG-CB 3.32Å; C36-C76 CovalentContact SG-SG 2.06Å; C36-C76 PolarHBondContact SG-SG 2.87Å
37	D	97	Very high	95.6	Very high	70 Å²	70	80.9 Å²	80.9	37%	0.374	43%	0.428	S	S	.	.	H	α-helix	trans	-64.8	-41.4	170.8	-178.7	60	0	0	0	111.5	T35 V39 K40 N41 R44	T35-D37 PolarHBondContact O-N 2.03Å; D37-V39 VanDerWaalsContact C-N 3.3Å; D37-V39 PolarHBondContact O-N 3.36Å; D37-K40 PolarHBondContact O-N 2.95Å; D37-N41 WeakPolarHBondContact O-CB 3.44Å; D37-N41 PolarHBondContact O-N 2.83Å; D37-N41 PolarHBondContact O-ND2 2.99Å; D37-N41 PolarHBondContact OD1-ND2 3.36Å; D37-R44 IonicContact OD2-CZ 3.94Å; D37-R44 IonicContact OD2-NE 2.76Å; D37-R44 IonicContact OD2-NH1 3.61Å; D37-R44 PolarHBondContact OD2-NH1 3.11Å
38	D	96.6	Very high	95.5	Very high	22 Å²	22	72.5 Å²	72.5	12%	0.118	40%	0.404	C	S	.	.	H	α-helix	trans	-65.5	-35.8	176	-52.6	-58.2	0	0	0	111.5	L34 T35 N41 R44 K46	L34-D38 HydrophobicContact CD1-CB 3.85Å; T35-D38 WeakPolarHBondContact CA-OD2 3Å; T35-D38 WeakPolarHBondContact CB-OD2 3.26Å; T35-D38 PolarHBondContact N-OD2 3.38Å; T35-D38 WeakPolarHBondContact O-CB 3.5Å; T35-D38 PolarHBondContact O-N 3.28Å; T35-D38 PolarHBondContact OG1-N 2.91Å; T35-D38 PolarHBondContact OG1-OD2 3.46Å; D38-N41 CarbonylContact O-C 3.54Å; D38-R44 IonicContact OD1-NH1 3.96Å; D38-K46 WeakPolarHBondContact OD1-CD 3.48Å; D38-K46 IonicContact OD1-NZ 3.28Å; D38-K46 PolarHBondContact OD1-NZ 3.02Å; D38-K46 IonicContact OD2-NZ 2.71Å; D38-K46 PolarHBondContact OD2-NZ 3.2Å
39	V	97.3	Very high	95.5	Very high	52 Å²	52	72.8 Å²	72.8	32%	0.315	41%	0.406	S	S	.	.	H	α-helix	trans	-66.9	-42.8	176.2	177.2	0	0	0	0	111.2	L34 T35 C36 D37 A63 T73 C76	L34-V39 HydrophobicContact CD1-CG2 4.35Å; L34-V39 HydrophobicContact CD2-CG2 4.26Å; L34-V39 HydrophobicContact CG-CG2 4.25Å; T35-V39 PolarHBondContact O-N 2.89Å; T35-V39 VanDerWaalsContact O-N 3.11Å; C36-V39 PolarHBondContact O-N 2.97Å; D37-V39 VanDerWaalsContact C-N 3.3Å; D37-V39 PolarHBondContact O-N 3.36Å; V39-A63 HydrophobicContact CG2-CB 3.99Å; V39-T73 HydrophobicContact CG2-CG2 4.03Å; V39-C76 HydrophobicContact CB-CB 4.26Å; V39-C76 HydrophobicContact CG1-CB 4.1Å
40	K	97.4	Very high	95.4	Very high	136 Å²	136	84.6 Å²	84.6	59%	0.591	45%	0.449	S	S	*	.	H	α-helix	trans	-74	-29.5	179.5	-71.8	176.3	-176.1	-175	0	113.1	C36 D37 P42 C76	C36-K40 WeakPolarHBondContact O-CB 3.44Å; C36-K40 WeakPolarHBondContact O-CG 3.23Å; C36-K40 PolarHBondContact O-N 2.03Å; D37-K40 PolarHBondContact O-N 2.95Å; K40-P42 VanDerWaalsContact C-CD 3.4Å; K40-P42 VanDerWaalsContact O-CD 3.3Å; K40-P42 WeakPolarHBondContact O-CD 3.45Å; K40-C76 WeakPolarHBondContact CE-O 3.36Å; K40-C76 PolarHBondContact NZ-O 2.76Å
41	N	97	Very high	95.5	Very high	78 Å²	78	87.4 Å²	87.4	42%	0.417	46%	0.456	S	S	.	.			trans	-121	66.6	-176.4	-60.3	-65.7	0	0	0	110.7	D37 D38 N43 R44	D37-N41 WeakPolarHBondContact O-CB 3.44Å; D37-N41 PolarHBondContact O-N 2.83Å; D37-N41 PolarHBondContact O-ND2 2.99Å; D37-N41 PolarHBondContact OD1-ND2 3.36Å; D38-N41 CarbonylContact O-C 3.54Å; N41-N43 PolarHBondContact O-N 2.79Å; N41-N43 VanDerWaalsContact O-N 3.09Å; N41-R44 HydrophobicContact CB-CB 4.19Å; N41-R44 WeakPolarHBondContact O-CB 3.01Å; N41-R44 PolarHBondContact O-N 3.41Å
42	P	94.3	Very high	95.5	Very high	103 Å²	103	89.8 Å²	89.8	67%	0.669	47%	0.469	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.8	-21.7	-172.6	25.8	-35.7	0	0	0	113.9	K40 R44	K40-P42 VanDerWaalsContact C-CD 3.4Å; K40-P42 VanDerWaalsContact O-CD 3.3Å; K40-P42 WeakPolarHBondContact O-CD 3.45Å; P42-R44 VanDerWaalsContact C-N 3.31Å
43	N	94.9	Very high	95.6	Very high	162 Å²	162	91.1 Å²	91.1	87%	0.866	48%	0.476	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87.2	0.6	178.2	-62.5	-35.5	0	0	0	113.3	N41 N45	N41-N43 PolarHBondContact O-N 2.79Å; N41-N43 VanDerWaalsContact O-N 3.09Å; N43-N45 PolarHBondContact O-N 3.38Å
44	R	91.5	Very high	95.6	Very high	137 Å²	137	91.9 Å²	91.9	52%	0.517	49%	0.486	S	S	.	.			trans	-66.8	123.4	176.9	-176.6	-175.7	179.1	-154.2	-5.9	109.2	D37 D38 N41 P42 K46	D37-R44 IonicContact OD2-CZ 3.94Å; D37-R44 IonicContact OD2-NE 2.76Å; D37-R44 IonicContact OD2-NH1 3.61Å; D37-R44 PolarHBondContact OD2-NH1 3.11Å; D38-R44 IonicContact OD1-NH1 3.96Å; N41-R44 HydrophobicContact CB-CB 4.19Å; N41-R44 WeakPolarHBondContact O-CB 3.01Å; N41-R44 PolarHBondContact O-N 3.41Å; P42-R44 VanDerWaalsContact C-N 3.31Å; R44-K46 VanDerWaalsContact C-N 3.33Å; R44-K46 PolarHBondContact O-N 2.81Å
45	N	90.3	Very high	95.6	Very high	148 Å²	148	88.7 Å²	88.7	79%	0.791	47%	0.474	S	S	*	.			trans	-76.6	84.9	175.8	-162.3	26.7	0	0	0	110.4	N43 V47	N43-N45 PolarHBondContact O-N 3.38Å; N45-V47 PolarHBondContact O-N 3.3Å
46	K	92	Very high	95.5	Very high	69 Å²	69	89.3 Å²	89.3	30%	0.3	48%	0.48	S	S	.	.			trans	-79.9	106.5	177.5	-165.7	-170.2	-164.2	163.5	0	109.7	C32 P33 D38 R44	C32-K46 HydrophobicContact CB-CD 4.24Å; P33-K46 PolarHBondContact O-NZ 3.13Å; D38-K46 WeakPolarHBondContact OD1-CD 3.48Å; D38-K46 IonicContact OD1-NZ 3.28Å; D38-K46 PolarHBondContact OD1-NZ 3.02Å; D38-K46 IonicContact OD2-NZ 2.71Å; D38-K46 PolarHBondContact OD2-NZ 3.2Å; R44-K46 VanDerWaalsContact C-N 3.33Å; R44-K46 PolarHBondContact O-N 2.81Å
47	V	94.2	Very high	95.5	Very high	131 Å²	131	89.9 Å²	89.9	79%	0.794	48%	0.48	S	S	*	.			trans	-77.8	123.8	175.2	-178.2	0	0	0	0	109.5	N45	N45-V47 PolarHBondContact O-N 3.3Å
48	C	95.3	Very high	95.6	Very high	50 Å²	50	87.9 Å²	87.9	34%	0.338	47%	0.471	S	S	.	.			trans	-133.7	137.4	-176.9	-66.3	0	0	0	0	110.9	C32	C32-C48 HydrophobicContact CB-CB 3.71Å; C32-C48 WeakPolarHBondContact CB-SG 2.99Å; C32-C48 VanDerWaalsContact SG-CA 3.52Å; C32-C48 WeakPolarHBondContact SG-CB 3.12Å; C32-C48 CovalentContact SG-SG 2.02Å; C32-C48 PolarHBondContact SG-SG 2.78Å
49	S	96	Very high	95.6	Very high	62 Å²	62	91 Å²	91	43%	0.434	48%	0.484	S	S	.	.			trans	-68.5	147.6	170.3	59.6	0	0	0	0	109.9	Q51	S49-Q51 PolarHBondContact O-N 2.82Å; S49-Q51 WeakPolarHBondContact OG-CG 3.2Å; S49-Q51 PolarHBondContact OG-NE2 2.93Å; S49-Q51 VanDerWaalsContact OG-NE2 3.13Å
50	R	93.9	Very high	95.6	Very high	254 Å²	254	93.5 Å²	93.5	96%	0.958	51%	0.51	S	S	*	.			trans	-83	12.2	177.8	-65.7	-173.8	178	179.6	-0.3	113.3
51	Q	96.9	Very high	95.7	Very high	121 Å²	121	89.3 Å²	89.3	57%	0.565	51%	0.506	S	S	*	.			trans	-73.2	141.9	-180	74.1	-165.4	-9.9	0	0	111	A31 S49 V53	A31-Q51 HydrophobicContact CB-CG 3.92Å; S49-Q51 PolarHBondContact O-N 2.82Å; S49-Q51 WeakPolarHBondContact OG-CG 3.2Å; S49-Q51 PolarHBondContact OG-NE2 2.93Å; S49-Q51 VanDerWaalsContact OG-NE2 3.13Å; Q51-V53 HydrophobicContact CG-CG2 4.23Å
52	C	97.4	Very high	95.7	Very high	85 Å²	85	87.7 Å²	87.7	57%	0.574	50%	0.495	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-73.6	134	167.1	-75.8	0	0	0	0	109.9	C28	C28-C52 HydrophobicContact CB-CB 3.55Å; C28-C52 WeakPolarHBondContact CB-SG 3.44Å; C28-C52 WeakPolarHBondContact SG-CB 3.37Å; C28-C52 CovalentContact SG-SG 2.03Å; C28-C52 PolarHBondContact SG-SG 2.86Å
53	V	96.7	Very high	95.9	Very high	58 Å²	58	82.8 Å²	82.8	35%	0.352	46%	0.463	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.9	134.3	168.2	-176.8	0	0	0	0	108.6	G29 A31 Q51 F57	G29-V53 PolarHBondContact N-O 3.42Å; G29-V53 PolarHBondContact O-N 3.47Å; A31-V53 HydrophobicContact CB-CG2 3.8Å; Q51-V53 HydrophobicContact CG-CG2 4.23Å; V53-F57 WeakPolarHBondContact O-CZ 3.33Å
54	A	96.5	Very high	96.1	Very high	64 Å²	64	76.1 Å²	76.1	53%	0.529	43%	0.428	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.5	137.1	172.3	0	0	0	0	0	109.7	R26 R27	R26-A54 WeakPolarHBondContact O-CA 3.16Å; R27-A54 WeakPolarHBondContact O-CA 3.01Å; R27-A54 WeakPolarHBondContact O-CB 3.24Å
55	G	95.8	Very high	96.4	Very high	19 Å²	19	71.9 Å²	71.9	20%	0.196	42%	0.415	C	S	.	.	E	Extended strand (participates in β ladder)	trans	162.7	-170.4	-179.3	0	0	0	0	0	113.8	F25 R26 F57	F25-G55 CarbonylContact C-O 3.4Å; F25-G55 WeakPolarHBondContact CA-O 3.47Å; R26-G55 PolarHBondContact N-O 3.38Å; R26-G55 PolarHBondContact O-N 3.09Å; G55-F57 WeakPolarHBondContact O-CD2 3.46Å; G55-F57 WeakPolarHBondContact O-CE2 3.4Å
56	C	97	Very high	96.7	Very high	41 Å²	41	69.9 Å²	69.9	28%	0.277	42%	0.42	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.3	133.2	173.7	-63.6	0	0	0	0	110.1	C19 E23	C19-C56 WeakPolarHBondContact CA-SG 3.42Å; C19-C56 HydrophobicContact CB-CB 3.63Å; C19-C56 WeakPolarHBondContact CB-SG 3.38Å; C19-C56 VanDerWaalsContact SG-CA 3.56Å; C19-C56 WeakPolarHBondContact SG-CB 3.18Å; C19-C56 CovalentContact SG-SG 2.03Å; C19-C56 PolarHBondContact SG-SG 2.95Å; E23-C56 HydrophobicContact CB-CB 4.2Å; E23-C56 WeakPolarHBondContact OE2-CB 3.06Å
57	F	97.8	Very high	97	Very high	25 Å²	25	70.2 Å²	70.2	11%	0.11	44%	0.435	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.9	145.8	-178.7	-60.1	-86.1	0	0	0	109.6	E23 V24 R26 G29 S30 V53 G55 K59	E23-F57 CarbonylContact C-O 3.6Å; E23-F57 VanDerWaalsContact CA-O 3.23Å; E23-F57 WeakPolarHBondContact CA-O 3.39Å; V24-F57 PolarHBondContact N-O 3.35Å; V24-F57 PolarHBondContact O-N 2.85Å; R26-F57 HydrophobicContact CB-CD2 3.73Å; R26-F57 HydrophobicContact CB-CE2 3.93Å; R26-F57 HydrophobicContact CG-CD2 3.99Å; G29-F57 VanDerWaalsContact CA-CZ 3.47Å; S30-F57 WeakPolarHBondContact O-CE1 3.47Å; V53-F57 WeakPolarHBondContact O-CZ 3.33Å; G55-F57 WeakPolarHBondContact O-CD2 3.46Å; G55-F57 WeakPolarHBondContact O-CE2 3.4Å; F57-K59 PolarHBondContact O-N 3Å
58	C	98.5	Very high	97	Very high	28 Å²	28	71 Å²	71	19%	0.189	43%	0.428	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-53.8	141.7	172.5	-59.2	0	0	0	0	111.5	D22 F62 C70	D22-C58 WeakPolarHBondContact O-CA 3.31Å; C58-F62 HydrophobicContact CB-CB 3.8Å; C58-C70 WeakPolarHBondContact CA-SG 3.47Å; C58-C70 HydrophobicContact CB-CB 3.77Å; C58-C70 WeakPolarHBondContact CB-SG 3.05Å; C58-C70 VanDerWaalsContact SG-CA 3.56Å; C58-C70 WeakPolarHBondContact SG-CB 3.36Å; C58-C70 CovalentContact SG-SG 2.03Å; C58-C70 PolarHBondContact SG-SG 3.39Å
59	K	98.1	Very high	97.1	Very high	87 Å²	87	72.1 Å²	72.1	38%	0.378	43%	0.433	S	S	.	.	P	Polyproline II helix	trans	-53.5	158.6	169.5	-72.1	169.5	-173.5	167.9	0	110.7	D22 V24 F57 G61 F62	D22-K59 HydrophobicContact CB-CD 4.19Å; D22-K59 WeakPolarHBondContact O-CG 3.47Å; D22-K59 PolarHBondContact O-N 3.26Å; D22-K59 IonicContact OD1-NZ 2.76Å; D22-K59 PolarHBondContact OD1-NZ 2.06Å; V24-K59 HydrophobicContact CG2-CG 3.64Å; F57-K59 PolarHBondContact O-N 3Å; K59-G61 PolarHBondContact O-N 3.39Å; K59-F62 HydrophobicContact CB-CD2 3.99Å; K59-F62 HydrophobicContact CB-CE2 4.47Å; K59-F62 WeakPolarHBondContact O-CB 2.77Å; K59-F62 PolarHBondContact O-N 3.13Å; K59-F62 VanDerWaalsContact O-N 3.09Å
60	A	97.2	Very high	97.3	Very high	105 Å²	105	69.5 Å²	69.5	87%	0.868	42%	0.415	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.6	135.1	171.8	0	0	0	0	0	110.4
61	G	97.9	Very high	97.5	Very high	49 Å²	49	58.7 Å²	58.7	51%	0.505	38%	0.377	S	S	.	.	T	Hydrogen-bonded Turn	trans	82.6	7.5	-175	0	0	0	0	0	115.2	K59 T73	K59-G61 PolarHBondContact O-N 3.39Å; G61-T73 WeakPolarHBondContact O-CG2 3.49Å; G61-T73 PolarHBondContact O-N 2.98Å; G61-T73 PolarHBondContact O-OG1 2.9Å
62	F	98.6	Very high	97.6	Very high	43 Å²	43	55.2 Å²	55.2	19%	0.189	37%	0.365	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.7	154.1	175.7	-72.2	-115.4	0	0	0	111.2	D22 C58 K59 C70 V71 P72	D22-F62 HydrophobicContact CB-CD1 3.73Å; D22-F62 HydrophobicContact CB-CE1 3.63Å; D22-F62 HydrophobicContact CB-CG 4.45Å; D22-F62 HydrophobicContact CB-CZ 4.27Å; C58-F62 HydrophobicContact CB-CB 3.8Å; K59-F62 HydrophobicContact CB-CD2 3.99Å; K59-F62 HydrophobicContact CB-CE2 4.47Å; K59-F62 WeakPolarHBondContact O-CB 2.77Å; K59-F62 PolarHBondContact O-N 3.13Å; K59-F62 VanDerWaalsContact O-N 3.09Å; F62-C70 HydrophobicContact CB-CB 4.34Å; F62-C70 HydrophobicContact CD1-CB 4.35Å; F62-V71 CarbonylContact C-O 3.47Å; F62-V71 WeakPolarHBondContact CA-O 3.36Å; F62-V71 WeakPolarHBondContact CB-O 3.37Å; F62-V71 WeakPolarHBondContact CD1-O 3.08Å; F62-P72 HydrophobicContact CD1-CG 4.3Å; F62-P72 HydrophobicContact CE1-CB 4.48Å; F62-P72 HydrophobicContact CE1-CG 3.73Å; F62-P72 HydrophobicContact CZ-CG 3.99Å
63	A	98.4	Very high	97.6	Very high	0 Å²	0	53.6 Å²	53.6	0%	0	35%	0.352	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.7	153.9	176.4	0	0	0	0	0	111.1	L34 V39 N65 V71 T73	L34-A63 HydrophobicContact CB-CB 4.46Å; L34-A63 HydrophobicContact CD2-CB 4.05Å; L34-A63 HydrophobicContact CG-CB 3.9Å; L34-A63 WeakPolarHBondContact O-CA 3.48Å; V39-A63 HydrophobicContact CG2-CB 3.99Å; A63-N65 PolarHBondContact O-N 2.72Å; A63-V71 PolarHBondContact N-O 2.88Å; A63-V71 PolarHBondContact O-N 3.11Å; A63-T73 HydrophobicContact CB-CG2 4.14Å
64	L	98.3	Very high	97.7	Very high	23 Å²	23	55.8 Å²	55.8	12%	0.12	37%	0.37	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.4	123.5	175.4	-69.2	170.4	0	0	0	110.5	P33 L34 T35 C36 K68	P33-L64 HydrophobicContact CB-CD1 3.82Å; P33-L64 HydrophobicContact CG-CD1 3.7Å; L34-L64 PolarHBondContact O-N 3.22Å; T35-L64 CarbonylContact C-O 3.57Å; T35-L64 VanDerWaalsContact CA-O 3.31Å; T35-L64 WeakPolarHBondContact CA-O 3.44Å; T35-L64 HydrophobicContact CG2-CB 4.33Å; C36-L64 PolarHBondContact N-O 3.4Å; L64-K68 WeakPolarHBondContact CD2-O 3.35Å
65	N	98	Very high	97.7	Very high	47 Å²	47	56.5 Å²	56.5	25%	0.251	37%	0.371	S	S	.	.			trans	-76.2	-178.8	167.5	72.6	11.9	0	0	0	111.6	A63 A67 K68 V69 V71	A63-N65 PolarHBondContact O-N 2.72Å; N65-A67 PolarHBondContact O-N 2.95Å; N65-A67 WeakPolarHBondContact OD1-CA 2.96Å; N65-A67 WeakPolarHBondContact OD1-CB 2.77Å; N65-A67 PolarHBondContact OD1-N 2.02Å; N65-K68 PolarHBondContact O-N 3.13Å; N65-K68 PolarHBondContact OD1-N 2.71Å; N65-K68 VanDerWaalsContact OD1-N 3.13Å; N65-V69 PolarHBondContact N-O 2.99Å; N65-V69 PolarHBondContact OD1-N 2.65Å; N65-V69 PolarHBondContact OD1-O 3.44Å; N65-V71 HydrophobicContact CB-CG1 4.46Å; N65-V71 HydrophobicContact CB-CG2 4.14Å
66	A	96.8	Very high	97.8	Very high	107 Å²	107	58.1 Å²	58.1	88%	0.884	38%	0.379	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.8	-29.8	179	0	0	0	0	0	113.4	K68	A66-K68 PolarHBondContact O-N 3.28Å
67	A	97.1	Very high	97.8	Very high	76 Å²	76	59 Å²	59	63%	0.628	38%	0.384	S	S	*	.	T	Hydrogen-bonded Turn	trans	-83	8.2	176.1	0	0	0	0	0	113.6	N65 V69	N65-A67 PolarHBondContact O-N 2.95Å; N65-A67 WeakPolarHBondContact OD1-CA 2.96Å; N65-A67 WeakPolarHBondContact OD1-CB 2.77Å; N65-A67 PolarHBondContact OD1-N 2.02Å; A67-V69 HydrophobicContact CB-CG2 4.41Å; A67-V69 PolarHBondContact O-N 3.34Å
68	K	95.6	Very high	97.8	Very high	146 Å²	146	60.7 Å²	60.7	64%	0.635	40%	0.398	S	S	*	.	S	Bend	trans	60.8	30.3	-177.8	-54	-62	-175.1	-179.8	0	113.9	L64 N65 A66	L64-K68 WeakPolarHBondContact CD2-O 3.35Å; N65-K68 PolarHBondContact O-N 3.13Å; N65-K68 PolarHBondContact OD1-N 2.71Å; N65-K68 VanDerWaalsContact OD1-N 3.13Å; A66-K68 PolarHBondContact O-N 3.28Å
69	V	97.6	Very high	97.8	Very high	74 Å²	74	62.6 Å²	62.6	45%	0.448	41%	0.41	S	S	.	.			trans	-102.3	136.4	172.8	-179.1	0	0	0	0	109.1	N65 A67 V71	N65-V69 PolarHBondContact N-O 2.99Å; N65-V69 PolarHBondContact OD1-N 2.65Å; N65-V69 PolarHBondContact OD1-O 3.44Å; A67-V69 HydrophobicContact CB-CG2 4.41Å; A67-V69 PolarHBondContact O-N 3.34Å; V69-V71 PolarHBondContact O-N 3.27Å
70	C	98.6	Very high	97.7	Very high	7 Å²	7	61.1 Å²	61.1	5%	0.047	41%	0.412	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.1	119	172.3	-64.6	0	0	0	0	110	D22 E23 C58 F62	D22-C70 HydrophobicContact CB-CB 4.11Å; E23-C70 HydrophobicContact CG-CB 4.47Å; E23-C70 WeakPolarHBondContact CG-SG 3.42Å; C58-C70 WeakPolarHBondContact CA-SG 3.47Å; C58-C70 HydrophobicContact CB-CB 3.77Å; C58-C70 WeakPolarHBondContact CB-SG 3.05Å; C58-C70 VanDerWaalsContact SG-CA 3.56Å; C58-C70 WeakPolarHBondContact SG-CB 3.36Å; C58-C70 CovalentContact SG-SG 2.03Å; C58-C70 PolarHBondContact SG-SG 3.39Å; F62-C70 HydrophobicContact CB-CB 4.34Å; F62-C70 HydrophobicContact CD1-CB 4.35Å
71	V	98.6	Very high	97.8	Very high	27 Å²	27	58.4 Å²	58.4	16%	0.164	38%	0.383	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.6	153.3	173.8	-61.3	0	0	0	0	109.4	F62 A63 N65 V69 T73	F62-V71 CarbonylContact C-O 3.47Å; F62-V71 WeakPolarHBondContact CA-O 3.36Å; F62-V71 WeakPolarHBondContact CB-O 3.37Å; F62-V71 WeakPolarHBondContact CD1-O 3.08Å; A63-V71 PolarHBondContact N-O 2.88Å; A63-V71 PolarHBondContact O-N 3.11Å; N65-V71 HydrophobicContact CB-CG1 4.46Å; N65-V71 HydrophobicContact CB-CG2 4.14Å; V69-V71 PolarHBondContact O-N 3.27Å; V71-T73 PolarHBondContact O-N 3.21Å
72	P	98.5	Very high	97.8	Very high	48 Å²	48	59 Å²	59	31%	0.312	38%	0.375	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-52.3	141.3	173	-25	34.1	0	0	0	110.1	F62 S74 S75 C76	F62-P72 HydrophobicContact CD1-CG 4.3Å; F62-P72 HydrophobicContact CE1-CB 4.48Å; F62-P72 HydrophobicContact CE1-CG 3.73Å; F62-P72 HydrophobicContact CZ-CG 3.99Å; P72-S74 PolarHBondContact O-N 3.33Å; P72-S74 VanDerWaalsContact O-N 3.11Å; P72-S75 CarbonylContact O-C 3.52Å; P72-S75 WeakPolarHBondContact O-CA 3.3Å; P72-S75 WeakPolarHBondContact O-CB 3.32Å; P72-S75 PolarHBondContact O-N 3.3Å; P72-C76 PolarHBondContact O-N 3.34Å
73	T	98.3	Very high	97.7	Very high	52 Å²	52	60.1 Å²	60.1	32%	0.319	39%	0.389	S	S	.	.	G	3₁₀ helix	trans	-60.5	-24.1	178.9	49.9	0	0	0	0	112.7	L34 V39 G61 A63 V71 S75 C76	L34-T73 HydrophobicContact CD2-CG2 4.11Å; V39-T73 HydrophobicContact CG2-CG2 4.03Å; G61-T73 WeakPolarHBondContact O-CG2 3.49Å; G61-T73 PolarHBondContact O-N 2.98Å; G61-T73 PolarHBondContact O-OG1 2.9Å; A63-T73 HydrophobicContact CB-CG2 4.14Å; V71-T73 PolarHBondContact O-N 3.21Å; T73-S75 PolarHBondContact O-N 3.09Å; T73-C76 WeakPolarHBondContact O-CB 3.49Å; T73-C76 PolarHBondContact O-N 2.98Å
74	S	98.1	Very high	97.6	Very high	103 Å²	103	64.8 Å²	64.8	72%	0.72	42%	0.418	S	S	*	.	G	3₁₀ helix	trans	-71.4	-11.3	171.3	56.4	0	0	0	0	114.4	P72	P72-S74 PolarHBondContact O-N 3.33Å; P72-S74 VanDerWaalsContact O-N 3.11Å
75	S	98	Very high	97.6	Very high	80 Å²	80	68.3 Å²	68.3	56%	0.559	44%	0.443	S	S	*	.	G	3₁₀ helix	trans	-111.6	8	177.7	-56.5	0	0	0	0	112.2	P72 T73	P72-S75 CarbonylContact O-C 3.52Å; P72-S75 WeakPolarHBondContact O-CA 3.3Å; P72-S75 WeakPolarHBondContact O-CB 3.32Å; P72-S75 PolarHBondContact O-N 3.3Å; T73-S75 PolarHBondContact O-N 3.09Å
76	C	96	Very high	97.6	Very high	52 Å²	52	70.2 Å²	70.2	35%	0.351	46%	0.461	S	S	.	.			trans	-71.7	0	152.4	-62	0	0	0	0	107.6	C36 V39 K40 P72 T73	C36-C76 WeakPolarHBondContact CA-SG 3.36Å; C36-C76 HydrophobicContact CB-CB 3.54Å; C36-C76 WeakPolarHBondContact CB-SG 3.19Å; C36-C76 VanDerWaalsContact SG-CA 3.54Å; C36-C76 WeakPolarHBondContact SG-CB 3.32Å; C36-C76 CovalentContact SG-SG 2.06Å; C36-C76 PolarHBondContact SG-SG 2.87Å; V39-C76 HydrophobicContact CB-CB 4.26Å; V39-C76 HydrophobicContact CG1-CB 4.1Å; K40-C76 WeakPolarHBondContact CE-O 3.36Å; K40-C76 PolarHBondContact NZ-O 2.76Å; P72-C76 PolarHBondContact O-N 3.34Å; T73-C76 WeakPolarHBondContact O-CB 3.49Å; T73-C76 PolarHBondContact O-N 2.98Å

Retrieved 76 of 76 residues in 74.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).