A0A077Z665_TRITR Loading...

U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein

May play a role in mRNA splicing.

AlphaFold DB , UniProt , Accession A0A077Z665, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 41 aa.

						>A0A077Z665_TRITR|A0A077Z665
MLQGQKVENNPTGAALVHKKRKYRQYMNRRGGFNRPLDPIA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	45.5	Very low	58.8	Low	245 Å²	245	157.4 Å²	157.4	100%	1.207	83%	0.831	S	S	*	*				0	103.2	0	-56.4	174.6	175.8	0	0	104.9
2	L	52.8	Low	58.8	Low	181 Å²	181	154.7 Å²	154.7	95%	0.948	83%	0.826	S	S	*	*				-143.7	149.4	53.5	-78.6	149.4	0	0	0	110.9
3	Q	46.8	Very low	58.8	Low	194 Å²	194	147.8 Å²	147.8	91%	0.907	82%	0.815	S	S	*	*			trans	-104.4	138.3	175.2	174.2	175.7	-31.9	0	0	109.1
4	G	59	Low	58.9	Low	71 Å²	71	143.7 Å²	143.7	73%	0.732	81%	0.81	S	S	*	*			trans	83	127.9	165.6	0	0	0	0	0	115.4
5	Q	64.2	Low	59.5	Low	190 Å²	190	139.7 Å²	139.7	89%	0.888	80%	0.802	S	S	*	*			cis	-152.8	151.8	19.7	-60	-174.1	52.7	0	0	109.6	V7	Q5-V7 PolarHBondContact O-N 3.35Å
6	K	63.6	Low	59.7	Low	181 Å²	181	139.8 Å²	139.8	79%	0.787	80%	0.798	S	S	*	*			trans	-73.8	111.6	173.3	-168.6	173.5	-176.5	-71.1	0	108.1	E8	K6-E8 PolarHBondContact O-N 3.4Å
7	V	66.9	Low	60.3	Low	117 Å²	117	137.5 Å²	137.5	71%	0.709	79%	0.787	S	S	*	*			trans	-69.2	112	169.4	-179.7	0	0	0	0	106.8	Q5 N9	Q5-V7 PolarHBondContact O-N 3.35Å; V7-N9 PolarHBondContact O-N 3.36Å
8	E	65.4	Low	60.8	Low	172 Å²	172	139 Å²	139	80%	0.804	79%	0.785	S	S	*	*			trans	-69.3	82.4	170.4	-65	-167.8	175.9	0	0	108.2	K6 N10	K6-E8 PolarHBondContact O-N 3.4Å; E8-N10 PolarHBondContact O-N 3.49Å
9	N	62.2	Low	61.3	Low	138 Å²	138	140.9 Å²	140.9	74%	0.738	78%	0.784	S	S	*	*			trans	33.3	92.7	164.4	-66.5	-49.6	0	0	0	113.8	V7 P11	V7-N9 PolarHBondContact O-N 3.36Å; N9-P11 WeakPolarHBondContact O-CD 3.46Å
10	N	62.9	Low	61.8	Low	126 Å²	126	143.8 Å²	143.8	67%	0.674	79%	0.788	S	S	*	*			trans	-46.6	104.7	163.4	-178.7	19.6	0	0	0	108.4	E8 T12	E8-N10 PolarHBondContact O-N 3.49Å; N10-T12 PolarHBondContact O-N 3.34Å; N10-T12 PolarHBondContact O-OG1 3.18Å
11	P	57.7	Low	62.3	Low	116 Å²	116	148 Å²	148	75%	0.753	79%	0.792	S	S	*	*			trans	-70.9	82.3	-170	28.9	-32.7	0	0	0	107.5	N9 G13	N9-P11 WeakPolarHBondContact O-CD 3.46Å; P11-G13 PolarHBondContact O-N 2.79Å
12	T	58.1	Low	63.5	Low	125 Å²	125	144.6 Å²	144.6	77%	0.767	77%	0.771	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62	113.7	-171.2	-64.3	0	0	0	0	107.6	N10	N10-T12 PolarHBondContact O-N 3.34Å; N10-T12 PolarHBondContact O-OG1 3.18Å
13	G	59.7	Low	64.5	Low	66 Å²	66	144.3 Å²	144.3	68%	0.68	76%	0.758	S	S	*	*	T	Hydrogen-bonded Turn	trans	80.7	58.5	154.2	0	0	0	0	0	116.1	P11 A15	P11-G13 PolarHBondContact O-N 2.79Å; G13-A15 PolarHBondContact O-N 3.25Å
14	A	60.3	Low	65.6	Low	90 Å²	90	145.3 Å²	145.3	74%	0.744	75%	0.754	S	S	*	*			trans	-69.1	78.6	152.6	0	0	0	0	0	109	L16	A14-L16 PolarHBondContact O-N 3.14Å
15	A	66.9	Low	66.3	Low	83 Å²	83	147.6 Å²	147.6	69%	0.686	75%	0.745	S	S	*	*			trans	-74.6	82.4	164.7	0	0	0	0	0	107.5	G13 V17	G13-A15 PolarHBondContact O-N 3.25Å; A15-V17 PolarHBondContact O-N 3.42Å; A15-V17 HydrophobicContact CB-CG2 4.26Å
16	L	63.8	Low	66.5	Low	141 Å²	141	145.8 Å²	145.8	74%	0.738	73%	0.732	S	S	*	*			trans	-68.9	70.8	168.9	-68.9	176.7	0	0	0	109.2	A14 H18	A14-L16 PolarHBondContact O-N 3.14Å; L16-H18 VanDerWaalsContact C-N 3.33Å; L16-H18 PolarHBondContact O-N 3.14Å; L16-H18 PolarHBondContact O-ND1 3.16Å; L16-H18 VanDerWaalsContact O-ND1 3.08Å
17	V	69.5	Low	66.5	Low	101 Å²	101	143.7 Å²	143.7	61%	0.612	73%	0.726	S	S	*	*			trans	-72.1	97.7	170.7	-171	0	0	0	0	106.6	A15 K19	A15-V17 PolarHBondContact O-N 3.42Å; A15-V17 HydrophobicContact CB-CG2 4.26Å; V17-K19 HydrophobicContact CB-CG 4.49Å; V17-K19 HydrophobicContact CG1-CD 4.47Å; V17-K19 HydrophobicContact CG1-CG 3.7Å; V17-K19 PolarHBondContact O-N 3.36Å
18	H	68.3	Low	66.7	Low	165 Å²	165	143.8 Å²	143.8	76%	0.764	72%	0.723	S	S	*	*			trans	-66.8	74.2	171.4	-73.1	76.2	0	0	0	109.4	L16 K20	L16-H18 VanDerWaalsContact C-N 3.33Å; L16-H18 PolarHBondContact O-N 3.14Å; L16-H18 PolarHBondContact O-ND1 3.16Å; L16-H18 VanDerWaalsContact O-ND1 3.08Å; H18-K20 VanDerWaalsContact O-N 3.08Å; H18-K20 PolarHBondContact O-N 3.08Å
19	K	71.1	Confident	67.1	Low	175 Å²	175	144.4 Å²	144.4	76%	0.761	72%	0.718	S	S	*	*			trans	-73.2	101.3	167.5	-63.2	-170.1	-176.8	179.1	0	106.4	V17 R21	V17-K19 HydrophobicContact CB-CG 4.49Å; V17-K19 HydrophobicContact CG1-CD 4.47Å; V17-K19 HydrophobicContact CG1-CG 3.7Å; V17-K19 PolarHBondContact O-N 3.36Å; K19-R21 PolarHBondContact O-N 2.74Å
20	K	72.3	Confident	67.5	Low	198 Å²	198	150.2 Å²	150.2	86%	0.861	73%	0.729	S	S	*	*			trans	-49	120.5	162.1	-68.3	-176.9	179.9	178.5	0	106.1	H18 K22	H18-K20 VanDerWaalsContact O-N 3.08Å; H18-K20 PolarHBondContact O-N 3.08Å; K20-K22 PolarHBondContact O-N 3.05Å
21	R	70.4	Confident	67.8	Low	234 Å²	234	147 Å²	147	88%	0.883	73%	0.725	S	S	*	*			trans	-57	102.3	-179.2	-69.1	-175.2	-176.7	168.2	0.8	107.6	K19 Y23	K19-R21 PolarHBondContact O-N 2.74Å; R21-Y23 PolarHBondContact O-N 2.76Å
22	K	70.7	Confident	68.3	Low	173 Å²	173	144.4 Å²	144.4	75%	0.752	72%	0.72	S	S	*	*	S	Bend	trans	-62.2	-29.8	-173.2	-175.9	177.1	178.5	-172	0	111.8	K20	K20-K22 PolarHBondContact O-N 3.05Å
23	Y	74.9	Confident	68.8	Low	175 Å²	175	148.2 Å²	148.2	69%	0.686	73%	0.726	S	S	*	*	S	Bend	trans	-117.7	126	-178.5	-56.7	-73.3	0	0	0	109.7	R21	R21-Y23 PolarHBondContact O-N 2.76Å
24	R	68.8	Low	69	Low	214 Å²	214	151.7 Å²	151.7	81%	0.808	73%	0.729	S	S	*	*			trans	-66.9	137.5	165.8	-66.7	176.6	65.4	-151.1	-1.4	107.8	Y26	R24-Y26 PolarHBondContact O-N 2.93Å; R24-Y26 VanDerWaalsContact O-N 3.14Å
25	Q	74.7	Confident	69.5	Low	119 Å²	119	157.4 Å²	157.4	56%	0.556	73%	0.732	S	S	*	*			trans	-55.8	120.3	170.8	-68.9	-72.2	10.3	0	0	108.5	M27 N28	Q25-M27 PolarHBondContact O-N 3.08Å; Q25-M27 VanDerWaalsContact O-N 3.16Å; Q25-N28 PolarHBondContact O-N 2.94Å; Q25-N28 VanDerWaalsContact O-N 3.14Å
26	Y	68.3	Low	69.8	Low	153 Å²	153	158.9 Å²	158.9	60%	0.6	73%	0.734	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.7	-22.2	-176.4	58.8	-91.9	0	0	0	112.7	R24 N28 R29	R24-Y26 PolarHBondContact O-N 2.93Å; R24-Y26 VanDerWaalsContact O-N 3.14Å; Y26-N28 VanDerWaalsContact C-N 3.28Å; Y26-N28 PolarHBondContact O-N 2.86Å; Y26-R29 WeakPolarHBondContact O-CG 3.44Å
27	M	62.9	Low	70.2	Confident	136 Å²	136	160.1 Å²	160.1	67%	0.67	74%	0.741	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72	-17.6	178.6	-58.2	-173.5	-170	0	0	113.6	Q25 R29	Q25-M27 PolarHBondContact O-N 3.08Å; Q25-M27 VanDerWaalsContact O-N 3.16Å; M27-R29 PolarHBondContact O-N 3.04Å
28	N	72.7	Confident	70.5	Confident	120 Å²	120	162.5 Å²	162.5	64%	0.642	75%	0.75	S	S	*	*			trans	-96.6	36.9	-176	-64.3	-22.2	0	0	0	113	Q25 Y26	Q25-N28 PolarHBondContact O-N 2.94Å; Q25-N28 VanDerWaalsContact O-N 3.14Å; Y26-N28 VanDerWaalsContact C-N 3.28Å; Y26-N28 PolarHBondContact O-N 2.86Å
29	R	73.5	Confident	70.6	Confident	184 Å²	184	160.4 Å²	160.4	69%	0.694	75%	0.751	S	S	*	*			trans	-84.2	130.4	174.8	-67.1	178.3	-169.8	-149.6	3.6	109.9	Y26 M27 G31 G32	Y26-R29 WeakPolarHBondContact O-CG 3.44Å; M27-R29 PolarHBondContact O-N 3.04Å; R29-G31 PolarHBondContact O-N 3.02Å; R29-G32 PolarHBondContact O-N 2.65Å
30	R	69.7	Low	70.6	Confident	261 Å²	261	160.2 Å²	160.2	99%	0.985	76%	0.757	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.8	118.5	165.2	-79.8	-167.3	173.3	-172.1	-1.3	107.8
31	G	68.5	Low	70.9	Confident	57 Å²	57	158.8 Å²	158.8	59%	0.588	78%	0.782	S	S	*	*	T	Hydrogen-bonded Turn	trans	126.9	-20.9	-177.5	0	0	0	0	0	114.4	R29	R29-G31 PolarHBondContact O-N 3.02Å
32	G	68.4	Low	70.9	Confident	63 Å²	63	155.1 Å²	155.1	65%	0.649	78%	0.777	S	S	*	*			trans	54.3	-168.1	175.1	0	0	0	0	0	114.3	R29 N34	R29-G32 PolarHBondContact O-N 2.65Å; G32-N34 PolarHBondContact O-N 3.5Å
33	F	68.4	Low	70.9	Confident	204 Å²	204	154.1 Å²	154.1	90%	0.895	78%	0.778	S	S	*	*	S	Bend	trans	-75.4	-11.1	172.8	-175.5	-104.9	0	0	0	112.6
34	N	65	Low	70.7	Confident	139 Å²	139	152.9 Å²	152.9	74%	0.743	78%	0.783	S	S	*	*			trans	-111.4	37.6	-165.3	-69	0.9	0	0	0	113.9	G32 P36	G32-N34 PolarHBondContact O-N 3.5Å; N34-P36 WeakPolarHBondContact O-CD 3.11Å
35	R	70.3	Confident	70.8	Confident	211 Å²	211	149.4 Å²	149.4	80%	0.796	78%	0.782	S	S	*	*	P	Polyproline II helix	trans	-70.3	122.6	164.9	-165.8	170	-173	155.2	0	107.3	L37	R35-L37 PolarHBondContact O-N 2.82Å
36	P	73.3	Confident	70.6	Confident	114 Å²	114	151.3 Å²	151.3	74%	0.74	80%	0.796	S	S	*	*	P	Polyproline II helix	trans	-58.5	134.7	177.3	23.7	-31.8	0	0	0	109.1	N34	N34-P36 WeakPolarHBondContact O-CD 3.11Å
37	L	72.3	Confident	70.7	Confident	167 Å²	167	151.1 Å²	151.1	87%	0.874	81%	0.809	S	S	*	*	P	Polyproline II helix	trans	-75.9	136.5	173.9	-64.7	170.3	0	0	0	108	R35	R35-L37 PolarHBondContact O-N 2.82Å
38	D	75.1	Confident	71.3	Confident	150 Å²	150	152.2 Å²	152.2	80%	0.802	82%	0.819	S	S	*	*	P	Polyproline II helix	trans	-60.9	141.1	178.7	-65.9	-39.8	0	0	0	110	I40	D38-I40 PolarHBondContact O-N 3.28Å
39	P	71.6	Confident	71.2	Confident	122 Å²	122	154.7 Å²	154.7	79%	0.792	83%	0.833	S	S	*	*	P	Polyproline II helix	trans	-64.4	132.9	-177.8	24.9	-31.7	0	0	0	110.3	A41	P39-A41 PolarHBondContact O-N 3.19Å
40	I	71.5	Confident	71	Confident	171 Å²	171	152.3 Å²	152.3	88%	0.877	84%	0.844	S	S	*	*	P	Polyproline II helix	trans	-71.7	120.6	166.4	-57.1	170.2	0	0	0	105.9	D38	D38-I40 PolarHBondContact O-N 3.28Å
41	A	77.7	Confident	71.1	Confident	168 Å²	168	142.4 Å²	142.4	100%	1.388	83%	0.831	S	S	*	*			trans	-60.8	0	178.5	0	0	0	0	0	112.5	P39	P39-A41 PolarHBondContact O-N 3.19Å

Retrieved 41 of 41 residues in 25.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).