A0A077Z6G4_TRITR Loading...

Small ribosomal subunit protein uS10

AlphaFold DB , UniProt , Accession A0A077Z6G4, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 116 aa.

						>A0A077Z6G4_TRITR|A0A077Z6G4
MAYFKKEVHEEADIQPKKIQVALTSCNVPALERACAELIKSARDNDVKVKGPIRFPTKILRITCRKTPCGEGSKTWDRYEMRIHKRTVRMMTSLEKLKELTKLPIEPVVSIYVTVA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48	Very low	51.4	Low	228 Å²	228	163 Å²	163	100%	1.123	79%	0.785	S	S	*	*				0	104.6	0	-83	162	165.8	0	0	107.7	Y3	M1-Y3 PolarHBondContact O-N 3.15Å
2	A	48.4	Very low	51.8	Low	104 Å²	104	152.4 Å²	152.4	86%	0.86	75%	0.745	S	S	*	*			trans	-74.4	116.7	175.9	0	0	0	0	0	108.4	F4	A2-F4 PolarHBondContact O-N 2.94Å; A2-F4 VanDerWaalsContact O-N 3.09Å
3	Y	53.1	Low	52.5	Low	221 Å²	221	146.2 Å²	146.2	87%	0.867	72%	0.717	S	S	*	*			trans	-67.8	106	166.9	-71.1	-88.1	0	0	0	107.1	M1 K5	M1-Y3 PolarHBondContact O-N 3.15Å; Y3-K5 PolarHBondContact O-N 3.06Å
4	F	58	Low	53.8	Low	187 Å²	187	145.9 Å²	145.9	82%	0.82	72%	0.717	S	S	*	*			trans	-69.7	85.9	169.1	-165.3	-96.2	0	0	0	107.2	A2 K6	A2-F4 PolarHBondContact O-N 2.94Å; A2-F4 VanDerWaalsContact O-N 3.09Å; F4-K6 HydrophobicContact CD1-CB 4.2Å; F4-K6 HydrophobicContact CE1-CB 4.21Å; F4-K6 HydrophobicContact CE1-CG 4.4Å; F4-K6 PolarHBondContact O-N 3.26Å
5	K	58.3	Low	55.6	Low	172 Å²	172	145.3 Å²	145.3	75%	0.748	71%	0.712	S	S	*	*			trans	-66.5	90	167.4	-173	-179.2	-178.5	-171.2	0	105.8	Y3 E7	Y3-K5 PolarHBondContact O-N 3.06Å; K5-E7 VanDerWaalsContact C-N 3.29Å; K5-E7 PolarHBondContact O-N 2.79Å
6	K	59.7	Low	57.3	Low	166 Å²	166	140.3 Å²	140.3	72%	0.722	69%	0.694	S	S	*	*			trans	-63.3	101.2	166.7	-166.8	174.1	-175	178	0	105.2	F4 V8	F4-K6 HydrophobicContact CD1-CB 4.2Å; F4-K6 HydrophobicContact CE1-CB 4.21Å; F4-K6 HydrophobicContact CE1-CG 4.4Å; F4-K6 PolarHBondContact O-N 3.26Å; K6-V8 VanDerWaalsContact C-N 3.28Å; K6-V8 PolarHBondContact O-N 3.12Å
7	E	42	Very low	59.2	Low	133 Å²	133	136.1 Å²	136.1	62%	0.621	67%	0.671	S	S	*	*			trans	-58.7	103.3	164.5	-65.8	-170.4	162.2	0	0	105.2	K5 H9	K5-E7 VanDerWaalsContact C-N 3.29Å; K5-E7 PolarHBondContact O-N 2.79Å; E7-H9 PolarHBondContact O-N 3.4Å
8	V	52.1	Low	61	Low	118 Å²	118	137.2 Å²	137.2	72%	0.715	67%	0.672	S	S	*	*			trans	-65.9	97.6	163.2	-179.3	0	0	0	0	102.7	K6 E10	K6-V8 VanDerWaalsContact C-N 3.28Å; K6-V8 PolarHBondContact O-N 3.12Å; V8-E10 PolarHBondContact O-N 2.85Å
9	H	44.1	Very low	62.6	Low	148 Å²	148	130.3 Å²	130.3	69%	0.685	64%	0.638	S	S	*	*			trans	-55.2	96.8	158.5	-77.4	-73.8	0	0	0	105.2	E7 E11	E7-H9 PolarHBondContact O-N 3.4Å; H9-E11 HydrophobicContact CB-CG 4.39Å; H9-E11 PolarHBondContact O-N 2.93Å
10	E	51.9	Low	64.2	Low	155 Å²	155	126 Å²	126	72%	0.724	62%	0.616	S	S	*	*			trans	-64.9	64.5	152.3	-81.5	-175.4	141.7	0	0	105.7	V8 A12 K98	V8-E10 PolarHBondContact O-N 2.85Å; E10-A12 PolarHBondContact O-N 3.09Å; E10-K98 IonicContact OE1-NZ 3.03Å
11	E	49.5	Very low	65.5	Low	161 Å²	161	120 Å²	120	75%	0.752	59%	0.587	S	S	*	*			trans	-59.1	104.2	147.3	-77	-174.4	174.5	0	0	103.1	H9 D13	H9-E11 HydrophobicContact CB-CG 4.39Å; H9-E11 PolarHBondContact O-N 2.93Å; E11-D13 PolarHBondContact O-N 3.42Å
12	A	56.7	Low	67.7	Low	36 Å²	36	109.4 Å²	109.4	30%	0.298	54%	0.535	S	S	.	.			trans	-37.7	112.7	168.8	0	0	0	0	0	106	E10 I14 E95	E10-A12 PolarHBondContact O-N 3.09Å; A12-I14 HydrophobicContact CB-CG1 4.1Å; A12-I14 WeakPolarHBondContact O-CG1 3.35Å; A12-I14 PolarHBondContact O-N 2.65Å; A12-E95 WeakPolarHBondContact CB-OE1 3.38Å
13	D	61.1	Low	69.9	Low	71 Å²	71	104.5 Å²	104.5	38%	0.38	50%	0.495	S	S	.	.			trans	-65.9	81.4	174.3	-85.6	-55.3	0	0	0	105.6	E11 Q15 K17 S93	E11-D13 PolarHBondContact O-N 3.42Å; D13-Q15 PolarHBondContact O-N 2.92Å; D13-K17 WeakPolarHBondContact OD1-CE 3.42Å; D13-K17 IonicContact OD1-NZ 2.86Å; D13-K17 PolarHBondContact OD1-NZ 3.14Å; D13-K17 IonicContact OD2-NZ 3.5Å; D13-K17 PolarHBondContact OD2-NZ 3.26Å; D13-S93 VanDerWaalsContact O-CB 3.28Å; D13-S93 WeakPolarHBondContact O-CB 3.33Å
14	I	69.8	Low	71.9	Confident	142 Å²	142	95.2 Å²	95.2	73%	0.728	46%	0.461	S	S	*	.			trans	-67.2	-20.6	179.9	-65.2	154	0	0	0	108.7	A12	A12-I14 HydrophobicContact CB-CG1 4.1Å; A12-I14 WeakPolarHBondContact O-CG1 3.35Å; A12-I14 PolarHBondContact O-N 2.65Å
15	Q	80.7	Confident	73.7	Confident	137 Å²	137	86.6 Å²	86.6	64%	0.64	42%	0.424	S	S	*	.	S	Bend	trans	-71.5	128.2	178.3	-62.4	-58.8	-21.2	0	0	111.5	D13 K17	D13-Q15 PolarHBondContact O-N 2.92Å; Q15-K17 PolarHBondContact O-N 3.4Å; Q15-K17 VanDerWaalsContact O-N 3.14Å
16	P	84.1	Confident	75.4	Confident	66 Å²	66	81.7 Å²	81.7	43%	0.429	41%	0.411	S	S	.	.			trans	-67.8	113.9	178.2	26.9	-33.3	0	0	0	110.5	M91	P16-M91 HydrophobicContact CB-CE 3.9Å; P16-M91 HydrophobicContact CB-CG 3.89Å; P16-M91 HydrophobicContact CG-CE 3.81Å
17	K	89.4	Confident	77	Confident	69 Å²	69	76.7 Å²	76.7	30%	0.3	39%	0.392	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96	156.4	175.9	-66.2	-179.8	-174.4	173.5	0	110.8	D13 Q15 I19 M91 T92 V115	D13-K17 WeakPolarHBondContact OD1-CE 3.42Å; D13-K17 IonicContact OD1-NZ 2.86Å; D13-K17 PolarHBondContact OD1-NZ 3.14Å; D13-K17 IonicContact OD2-NZ 3.5Å; D13-K17 PolarHBondContact OD2-NZ 3.26Å; Q15-K17 PolarHBondContact O-N 3.4Å; Q15-K17 VanDerWaalsContact O-N 3.14Å; K17-I19 HydrophobicContact CB-CG1 4.45Å; K17-I19 PolarHBondContact O-N 2.9Å; K17-M91 WeakPolarHBondContact O-CA 3.47Å; K17-T92 PolarHBondContact N-O 2.88Å; K17-T92 VanDerWaalsContact N-O 3.13Å; K17-T92 PolarHBondContact O-N 2.91Å; K17-T92 VanDerWaalsContact O-N 3.09Å; K17-V115 HydrophobicContact CB-CG1 4.16Å; K17-V115 HydrophobicContact CD-CG1 3.82Å
18	K	90.9	Very high	79.5	Confident	156 Å²	156	72.5 Å²	72.5	68%	0.678	38%	0.375	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-79.7	115.2	171.1	-70.7	176.6	-175	168.5	0	108	A116	K18-A116 HydrophobicContact CB-CB 4.34Å; K18-A116 PolarHBondContact O-N 3.24Å
19	I	92.4	Very high	81.4	Confident	5 Å²	5	70.4 Å²	70.4	3%	0.026	36%	0.364	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.6	138	-177.9	-54.4	-174.7	0	0	0	109.3	K17 V21 R89 M90 T92 L97 V113 V115	K17-I19 HydrophobicContact CB-CG1 4.45Å; K17-I19 PolarHBondContact O-N 2.9Å; I19-V21 HydrophobicContact CG2-CG2 4.48Å; I19-R89 WeakPolarHBondContact O-CA 3.37Å; I19-M90 PolarHBondContact N-O 2.9Å; I19-M90 PolarHBondContact O-N 2.82Å; I19-M90 VanDerWaalsContact O-O 3.13Å; I19-T92 HydrophobicContact CD1-CG2 3.85Å; I19-L97 HydrophobicContact CD1-CB 4.32Å; I19-L97 HydrophobicContact CD1-CD2 4.02Å; I19-L97 HydrophobicContact CG2-CD1 4.24Å; I19-L97 HydrophobicContact CG2-CD2 3.8Å; I19-V113 HydrophobicContact CG2-CG1 3.89Å; I19-V115 HydrophobicContact CG1-CG2 4.46Å
20	Q	92.9	Very high	83.8	Confident	45 Å²	45	63.5 Å²	63.5	21%	0.21	33%	0.332	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.4	118.4	173.6	-174.9	175.8	-72.7	0	0	109.5	T87 R89 T114	Q20-T87 HydrophobicContact CG-CG2 3.14Å; Q20-R89 HydrophobicContact CB-CG 4.38Å; Q20-R89 HydrophobicContact CG-CG 4.03Å; Q20-T114 PolarHBondContact N-O 3.44Å; Q20-T114 PolarHBondContact O-N 2.62Å
21	V	92.9	Very high	85.8	Confident	1 Å²	1	56.1 Å²	56.1	1%	0.006	30%	0.298	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.7	116.6	171.8	-176	0	0	0	0	107.9	I19 L23 L38 T87 V88 M90 L97 I111	I19-V21 HydrophobicContact CG2-CG2 4.48Å; V21-L23 HydrophobicContact CG1-CD2 4.37Å; V21-L38 HydrophobicContact CB-CD2 4.32Å; V21-L38 HydrophobicContact CG1-CD2 3.96Å; V21-T87 CarbonylContact O-C 3.6Å; V21-T87 VanDerWaalsContact O-CA 3.3Å; V21-T87 WeakPolarHBondContact O-CA 3.48Å; V21-V88 PolarHBondContact N-O 3.06Å; V21-V88 PolarHBondContact O-N 2.85Å; V21-M90 HydrophobicContact CG2-CE 4.09Å; V21-L97 HydrophobicContact CG2-CD1 3.7Å; V21-I111 HydrophobicContact CG1-CG2 3.72Å
22	A	94.2	Very high	87.9	Confident	4 Å²	4	52.2 Å²	52.2	3%	0.033	28%	0.28	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.6	125.3	175.2	0	0	0	0	0	110.1	R86 I111 Y112	A22-R86 CarbonylContact C-O 3.55Å; A22-R86 WeakPolarHBondContact CA-O 3.46Å; A22-I111 CarbonylContact O-C 3.59Å; A22-I111 WeakPolarHBondContact O-CA 3.47Å; A22-Y112 PolarHBondContact N-O 3.02Å; A22-Y112 PolarHBondContact O-N 3.07Å
23	L	93.8	Very high	89.6	Confident	2 Å²	2	58.4 Å²	58.4	1%	0.01	30%	0.295	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.7	130.8	175	-58	173.7	0	0	0	108.6	V21 L31 C35 L38 K85 R86 V109 S110 I111	V21-L23 HydrophobicContact CG1-CD2 4.37Å; L23-L31 HydrophobicContact CB-CD1 3.46Å; L23-L31 VanDerWaalsContact CB-CD1 3.46Å; L23-L31 HydrophobicContact CD1-CD1 4.49Å; L23-C35 HydrophobicContact CD1-CB 3.9Å; L23-L38 HydrophobicContact CD1-CD2 4.49Å; L23-K85 CarbonylContact O-C 3.58Å; L23-K85 WeakPolarHBondContact O-CA 3.37Å; L23-R86 HydrophobicContact CB-CB 4.48Å; L23-R86 PolarHBondContact N-O 2.88Å; L23-R86 PolarHBondContact O-N 3.09Å; L23-V109 HydrophobicContact CB-CG1 4.31Å; L23-V109 HydrophobicContact CD2-CG1 4.26Å; L23-S110 WeakPolarHBondContact CA-O 3.5Å; L23-I111 HydrophobicContact CD2-CB 4.29Å; L23-I111 HydrophobicContact CD2-CG1 3.76Å; L23-I111 HydrophobicContact CD2-CG2 4.09Å
24	T	95	Very high	91.1	Very high	25 Å²	25	55.5 Å²	55.5	15%	0.153	28%	0.281	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.3	131.7	176.7	51	0	0	0	0	110.4	H84 K85 S110	T24-H84 WeakPolarHBondContact CA-O 3.33Å; T24-K85 HydrophobicContact CG2-CB 4.08Å; T24-K85 HydrophobicContact CG2-CD 4.35Å; T24-K85 HydrophobicContact CG2-CG 3.95Å; T24-S110 PolarHBondContact N-O 3.3Å; T24-S110 PolarHBondContact O-N 3.47Å; T24-S110 PolarHBondContact OG1-O 2.94Å
25	S	95.2	Very high	92.2	Very high	6 Å²	6	48.9 Å²	48.9	4%	0.042	25%	0.248	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-154.9	160.5	173.9	-167.8	0	0	0	0	111.6	N27 H84 V108	S25-N27 PolarHBondContact OG-N 2.84Å; S25-N27 VanDerWaalsContact OG-N 3.17Å; S25-H84 PolarHBondContact N-O 3.03Å; S25-H84 VanDerWaalsContact N-O 3.09Å; S25-H84 WeakPolarHBondContact O-CB 3.49Å; S25-H84 PolarHBondContact O-N 3.03Å; S25-V108 PolarHBondContact OG-O 3.32Å
26	C	94.8	Very high	92.7	Very high	70 Å²	70	45.3 Å²	45.3	47%	0.473	24%	0.241	S	C	.	.	S	Bend	trans	-84.9	-24.8	167.1	-60.2	0	0	0	0	111.9	R82	C26-R82 WeakPolarHBondContact CA-O 3.45Å
27	N	93.9	Very high	93.1	Very high	60 Å²	60	46 Å²	46	32%	0.321	24%	0.239	S	C	.	.			trans	-95.9	113	-177.7	-173	-0.3	0	0	0	110.7	S25 P29 A30 L31 V108	S25-N27 PolarHBondContact OG-N 2.84Å; S25-N27 VanDerWaalsContact OG-N 3.17Å; N27-P29 WeakPolarHBondContact OD1-CD 3.35Å; N27-A30 HydrophobicContact CB-CB 4.02Å; N27-L31 WeakPolarHBondContact O-CB 3.48Å; N27-L31 PolarHBondContact O-N 2.84Å; N27-L31 VanDerWaalsContact O-N 3.17Å; N27-V108 HydrophobicContact CB-CG1 4.21Å
28	V	93.6	Very high	93.2	Very high	46 Å²	46	43.2 Å²	43.2	28%	0.279	23%	0.227	S	C	.	.	H	α-helix	trans	-67.1	-51.2	-177	-179.9	0	0	0	0	112.3	A30 L31 E32 H84	V28-A30 VanDerWaalsContact C-N 3.34Å; V28-A30 PolarHBondContact O-N 3.18Å; V28-L31 PolarHBondContact O-N 3.33Å; V28-L31 VanDerWaalsContact O-N 3.17Å; V28-E32 HydrophobicContact CG1-CG 4.14Å; V28-E32 WeakPolarHBondContact O-CG 3.38Å; V28-E32 PolarHBondContact O-N 2.93Å; V28-H84 VanDerWaalsContact CG2-CE1 3.49Å; V28-H84 WeakPolarHBondContact CG2-CE1 3.4Å; V28-H84 WeakPolarHBondContact CG2-NE2 3.45Å
29	P	93.5	Very high	93.3	Very high	74 Å²	74	36.5 Å²	36.5	48%	0.481	20%	0.199	S	C	.	.	H	α-helix	trans	-50.1	-48.4	175.5	-29.4	27.2	0	0	0	114.6	N27 L31 E32 R33	N27-P29 WeakPolarHBondContact OD1-CD 3.35Å; P29-L31 PolarHBondContact O-N 2.98Å; P29-E32 PolarHBondContact O-N 2.8Å; P29-R33 WeakPolarHBondContact O-CG 3.46Å; P29-R33 PolarHBondContact O-N 3.42Å
30	A	92.9	Very high	93.2	Very high	2 Å²	2	42.8 Å²	42.8	2%	0.017	23%	0.226	C	C	.	.	H	α-helix	trans	-61	-45.9	178.9	0	0	0	0	0	111.6	N27 V28 E32 R33 A34 E106 V109	N27-A30 HydrophobicContact CB-CB 4.02Å; V28-A30 VanDerWaalsContact C-N 3.34Å; V28-A30 PolarHBondContact O-N 3.18Å; A30-E32 VanDerWaalsContact C-N 3.34Å; A30-E32 PolarHBondContact O-N 2.84Å; A30-R33 PolarHBondContact O-N 2.84Å; A30-A34 WeakPolarHBondContact O-CB 3.25Å; A30-A34 PolarHBondContact O-N 2.69Å; A30-E106 HydrophobicContact CB-CB 4.46Å; A30-E106 WeakPolarHBondContact CB-OE2 3.42Å; A30-V109 HydrophobicContact CB-CG2 4.08Å
31	L	93.7	Very high	93.1	Very high	0 Å²	0	41.5 Å²	41.5	0%	0	22%	0.222	C	C	.	.	H	α-helix	trans	-63.8	-38.3	179.6	-176	62.4	0	0	0	112.6	L23 N27 V28 P29 C35 H84 R86 V109	L23-L31 HydrophobicContact CB-CD1 3.46Å; L23-L31 VanDerWaalsContact CB-CD1 3.46Å; L23-L31 HydrophobicContact CD1-CD1 4.49Å; N27-L31 WeakPolarHBondContact O-CB 3.48Å; N27-L31 PolarHBondContact O-N 2.84Å; N27-L31 VanDerWaalsContact O-N 3.17Å; V28-L31 PolarHBondContact O-N 3.33Å; V28-L31 VanDerWaalsContact O-N 3.17Å; P29-L31 PolarHBondContact O-N 2.98Å; L31-C35 WeakPolarHBondContact O-CB 3.3Å; L31-C35 PolarHBondContact O-N 2.81Å; L31-H84 HydrophobicContact CD2-CB 3.48Å; L31-H84 VanDerWaalsContact CD2-CB 3.48Å; L31-R86 HydrophobicContact CD1-CG 4.41Å; L31-R86 HydrophobicContact CD2-CG 3.8Å; L31-R86 HydrophobicContact CG-CG 3.96Å; L31-V109 HydrophobicContact CD1-CG1 3.99Å
32	E	93.7	Very high	93	Very high	79 Å²	79	41.5 Å²	41.5	37%	0.369	22%	0.222	S	C	.	.	H	α-helix	trans	-73	-38.2	179.4	-67.8	-162.4	148	0	0	112.3	V28 P29 A30 C35 A36 R54 R86	V28-E32 HydrophobicContact CG1-CG 4.14Å; V28-E32 WeakPolarHBondContact O-CG 3.38Å; V28-E32 PolarHBondContact O-N 2.93Å; P29-E32 PolarHBondContact O-N 2.8Å; A30-E32 VanDerWaalsContact C-N 3.34Å; A30-E32 PolarHBondContact O-N 2.84Å; E32-C35 PolarHBondContact O-N 3.13Å; E32-A36 WeakPolarHBondContact O-CB 3.28Å; E32-A36 PolarHBondContact O-N 3.19Å; E32-R54 IonicContact OE1-NH2 3.84Å; E32-R86 IonicContact OE1-CZ 2.69Å; E32-R86 IonicContact OE1-NH1 3.48Å; E32-R86 PolarHBondContact OE1-NH1 3.41Å; E32-R86 IonicContact OE1-NH2 2.81Å; E32-R86 PolarHBondContact OE1-NH2 3.01Å
33	R	93.2	Very high	92.9	Very high	166 Å²	166	49.5 Å²	49.5	63%	0.626	25%	0.251	S	S	*	.	H	α-helix	trans	-60.6	-53.1	171.7	-71.2	174.5	-177.7	177.1	-0.4	111.4	P29 A30 C35 A36 E37	P29-R33 WeakPolarHBondContact O-CG 3.46Å; P29-R33 PolarHBondContact O-N 3.42Å; A30-R33 PolarHBondContact O-N 2.84Å; R33-C35 VanDerWaalsContact C-N 3.27Å; R33-C35 PolarHBondContact O-N 3.06Å; R33-A36 PolarHBondContact O-N 2.87Å; R33-A36 VanDerWaalsContact O-N 3.12Å; R33-E37 WeakPolarHBondContact O-CG 3.16Å; R33-E37 PolarHBondContact O-N 2.92Å
34	A	91.8	Very high	92.8	Very high	10 Å²	10	54.6 Å²	54.6	8%	0.083	28%	0.278	C	S	.	.	H	α-helix	trans	-58.7	-39.4	178.6	0	0	0	0	0	112.3	A30 L38	A30-A34 WeakPolarHBondContact O-CB 3.25Å; A30-A34 PolarHBondContact O-N 2.69Å; A34-L38 WeakPolarHBondContact O-CB 3.44Å; A34-L38 PolarHBondContact O-N 2.83Å
35	C	92.9	Very high	92.5	Very high	4 Å²	4	57.3 Å²	57.3	3%	0.027	29%	0.292	C	S	.	.	H	α-helix	trans	-69.9	-38.5	178.2	-167	0	0	0	0	112.5	L23 L31 E32 R33 I39 P52	L23-C35 HydrophobicContact CD1-CB 3.9Å; L31-C35 WeakPolarHBondContact O-CB 3.3Å; L31-C35 PolarHBondContact O-N 2.81Å; E32-C35 PolarHBondContact O-N 3.13Å; R33-C35 VanDerWaalsContact C-N 3.27Å; R33-C35 PolarHBondContact O-N 3.06Å; C35-I39 WeakPolarHBondContact O-CD1 3.41Å; C35-I39 VanDerWaalsContact O-CG1 3.25Å; C35-I39 WeakPolarHBondContact O-CG1 3.48Å; C35-I39 PolarHBondContact O-N 3.45Å; C35-I39 VanDerWaalsContact O-N 3.12Å; C35-P52 VanDerWaalsContact SG-CB 3.53Å
36	A	92.4	Very high	92.1	Very high	61 Å²	61	64.2 Å²	64.2	50%	0.504	33%	0.329	S	S	.	.	H	α-helix	trans	-66.7	-42.7	176.3	0	0	0	0	0	111.8	E32 R33 I39 K40	E32-A36 WeakPolarHBondContact O-CB 3.28Å; E32-A36 PolarHBondContact O-N 3.19Å; R33-A36 PolarHBondContact O-N 2.87Å; R33-A36 VanDerWaalsContact O-N 3.12Å; A36-I39 PolarHBondContact O-N 2.93Å; A36-K40 WeakPolarHBondContact O-CB 3.33Å; A36-K40 PolarHBondContact O-N 3.12Å
37	E	91.8	Very high	91.8	Very high	82 Å²	82	61.7 Å²	61.7	38%	0.383	31%	0.311	S	S	.	.	H	α-helix	trans	-63.6	-43.9	176.4	-72.5	173.5	-164.2	0	0	112	R33 I39 K40 S41 L103	R33-E37 WeakPolarHBondContact O-CG 3.16Å; R33-E37 PolarHBondContact O-N 2.92Å; E37-I39 VanDerWaalsContact C-N 3.32Å; E37-I39 PolarHBondContact O-N 3.35Å; E37-K40 PolarHBondContact O-N 3.41Å; E37-S41 WeakPolarHBondContact O-CB 3.42Å; E37-S41 PolarHBondContact O-N 3.02Å; E37-L103 HydrophobicContact CB-CD1 4.45Å
38	L	91.8	Very high	91.5	Very high	10 Å²	10	67.6 Å²	67.6	5%	0.052	33%	0.334	C	S	.	.	H	α-helix	trans	-60.2	-42.3	175.8	-175.2	67.8	0	0	0	111.8	V21 L23 A34 A42 V88 L100	V21-L38 HydrophobicContact CB-CD2 4.32Å; V21-L38 HydrophobicContact CG1-CD2 3.96Å; L23-L38 HydrophobicContact CD1-CD2 4.49Å; A34-L38 WeakPolarHBondContact O-CB 3.44Å; A34-L38 PolarHBondContact O-N 2.83Å; L38-A42 VanDerWaalsContact O-CB 3.26Å; L38-A42 WeakPolarHBondContact O-CB 3.33Å; L38-A42 PolarHBondContact O-N 2.93Å; L38-V88 HydrophobicContact CD2-CB 4.18Å; L38-V88 HydrophobicContact CD2-CG2 3.98Å; L38-L100 HydrophobicContact CD1-CB 4.41Å
39	I	92.2	Very high	91.4	Very high	15 Å²	15	67.3 Å²	67.3	8%	0.077	33%	0.332	C	S	.	.	H	α-helix	trans	-68.3	-40.5	177.8	-69.9	163.2	0	0	0	111.2	C35 A36 E37 A42 R43 P52 V88	C35-I39 WeakPolarHBondContact O-CD1 3.41Å; C35-I39 VanDerWaalsContact O-CG1 3.25Å; C35-I39 WeakPolarHBondContact O-CG1 3.48Å; C35-I39 PolarHBondContact O-N 3.45Å; C35-I39 VanDerWaalsContact O-N 3.12Å; A36-I39 PolarHBondContact O-N 2.93Å; E37-I39 VanDerWaalsContact C-N 3.32Å; E37-I39 PolarHBondContact O-N 3.35Å; I39-A42 PolarHBondContact O-N 3.12Å; I39-R43 VanDerWaalsContact CG2-CZ 3.44Å; I39-R43 WeakPolarHBondContact O-CG 3.42Å; I39-R43 PolarHBondContact O-N 2.78Å; I39-P52 HydrophobicContact CD1-CB 4.05Å; I39-P52 HydrophobicContact CD1-CG 3.83Å; I39-V88 HydrophobicContact CG1-CG2 4.4Å
40	K	91.9	Very high	91.4	Very high	136 Å²	136	69.8 Å²	69.8	59%	0.591	34%	0.335	S	S	*	.	H	α-helix	trans	-61.8	-53	177.7	-176	-177.1	174.3	-173.3	0	110.4	A36 E37 A42 R43 D44	A36-K40 WeakPolarHBondContact O-CB 3.33Å; A36-K40 PolarHBondContact O-N 3.12Å; E37-K40 PolarHBondContact O-N 3.41Å; K40-A42 VanDerWaalsContact C-N 3.28Å; K40-A42 PolarHBondContact O-N 2.9Å; K40-R43 WeakPolarHBondContact O-CB 3.27Å; K40-R43 PolarHBondContact O-N 3.27Å; K40-D44 VanDerWaalsContact O-CG 3.23Å; K40-D44 PolarHBondContact O-N 3.26Å
41	S	90.7	Very high	91.1	Very high	19 Å²	19	71.3 Å²	71.3	13%	0.133	35%	0.351	C	S	.	.	H	α-helix	trans	-60.8	-36.5	178.9	180	0	0	0	0	112.9	E37 R43 D44 N45 L100	E37-S41 WeakPolarHBondContact O-CB 3.42Å; E37-S41 PolarHBondContact O-N 3.02Å; S41-R43 VanDerWaalsContact C-N 3.34Å; S41-D44 PolarHBondContact O-N 3.38Å; S41-N45 PolarHBondContact O-N 3.03Å; S41-N45 PolarHBondContact O-ND2 3.07Å; S41-L100 VanDerWaalsContact OG-CD2 3.27Å; S41-L100 WeakPolarHBondContact OG-CD2 3.44Å
42	A	91.2	Very high	91.1	Very high	1 Å²	1	73.5 Å²	73.5	1%	0.008	37%	0.365	C	S	.	.	H	α-helix	trans	-69.3	-31.2	175.9	0	0	0	0	0	113	L38 I39 K40 V47 V49 L100	L38-A42 VanDerWaalsContact O-CB 3.26Å; L38-A42 WeakPolarHBondContact O-CB 3.33Å; L38-A42 PolarHBondContact O-N 2.93Å; I39-A42 PolarHBondContact O-N 3.12Å; K40-A42 VanDerWaalsContact C-N 3.28Å; K40-A42 PolarHBondContact O-N 2.9Å; A42-V47 HydrophobicContact CB-CB 4.5Å; A42-V47 WeakPolarHBondContact O-CB 3.26Å; A42-V47 PolarHBondContact O-N 3.35Å; A42-V49 HydrophobicContact CB-CG2 3.41Å; A42-V49 VanDerWaalsContact CB-CG2 3.41Å; A42-L100 HydrophobicContact CB-CD1 4.31Å; A42-L100 HydrophobicContact CB-CD2 4.33Å
43	R	90.5	Very high	91.2	Very high	171 Å²	171	71.9 Å²	71.9	65%	0.645	36%	0.358	S	S	*	.	H	α-helix	trans	-72.5	-40	171.8	-71.8	176.1	-170.7	151.1	0.2	112.1	I39 K40 S41 N45 D46	I39-R43 VanDerWaalsContact CG2-CZ 3.44Å; I39-R43 WeakPolarHBondContact O-CG 3.42Å; I39-R43 PolarHBondContact O-N 2.78Å; K40-R43 WeakPolarHBondContact O-CB 3.27Å; K40-R43 PolarHBondContact O-N 3.27Å; S41-R43 VanDerWaalsContact C-N 3.34Å; R43-N45 PolarHBondContact O-N 3.02Å; R43-D46 PolarHBondContact O-N 3.2Å
44	D	91.3	Very high	91.4	Very high	109 Å²	109	71.4 Å²	71.4	58%	0.583	36%	0.357	S	S	*	.	H	α-helix	trans	-62.7	-26.4	177.9	-61.3	-22.6	0	0	0	111.9	K40 S41	K40-D44 VanDerWaalsContact O-CG 3.23Å; K40-D44 PolarHBondContact O-N 3.26Å; S41-D44 PolarHBondContact O-N 3.38Å
45	N	89.5	Confident	91.5	Very high	82 Å²	82	74.7 Å²	74.7	44%	0.439	37%	0.369	S	S	.	.	T	Hydrogen-bonded Turn	trans	-97.1	14.5	175.7	-70.5	-67.4	0	0	0	114.1	S41 R43 V47 L100	S41-N45 PolarHBondContact O-N 3.03Å; S41-N45 PolarHBondContact O-ND2 3.07Å; R43-N45 PolarHBondContact O-N 3.02Å; N45-V47 HydrophobicContact CB-CG2 4.32Å; N45-V47 PolarHBondContact O-N 3.25Å; N45-V47 VanDerWaalsContact O-N 3.15Å; N45-L100 HydrophobicContact CB-CD2 4.47Å; N45-L100 WeakPolarHBondContact ND2-CD2 3.19Å
46	D	87.3	Confident	91.7	Very high	152 Å²	152	79.8 Å²	79.8	81%	0.813	40%	0.402	S	S	*	.	T	Hydrogen-bonded Turn	trans	55.6	29.6	179.3	-65.7	-59.9	0	0	0	115.2	R43	R43-D46 PolarHBondContact O-N 3.2Å
47	V	88.4	Confident	91.9	Very high	17 Å²	17	80 Å²	80	10%	0.103	40%	0.397	C	S	.	.			trans	-84.4	132.2	176.4	-178.4	0	0	0	0	110.1	A42 N45 V49 M90 L100	A42-V47 HydrophobicContact CB-CB 4.5Å; A42-V47 WeakPolarHBondContact O-CB 3.26Å; A42-V47 PolarHBondContact O-N 3.35Å; N45-V47 HydrophobicContact CB-CG2 4.32Å; N45-V47 PolarHBondContact O-N 3.25Å; N45-V47 VanDerWaalsContact O-N 3.15Å; V47-V49 HydrophobicContact CG1-CG2 4.48Å; V47-V49 PolarHBondContact O-N 3.33Å; V47-V49 VanDerWaalsContact O-N 3.12Å; V47-M90 HydrophobicContact CG1-CB 3.87Å; V47-M90 HydrophobicContact CG1-CG 4.41Å; V47-M90 HydrophobicContact CG1-SD 4.22Å; V47-L100 HydrophobicContact CG2-CD1 4.49Å
48	K	88.1	Confident	92.1	Very high	184 Å²	184	83.4 Å²	83.4	80%	0.8	41%	0.411	S	S	*	.			trans	-69.3	110.1	172.9	-68.1	-177.2	-177.3	177.2	0	110.2	M90	K48-M90 WeakPolarHBondContact O-CA 3.35Å
49	V	91.5	Very high	92.3	Very high	39 Å²	39	86 Å²	86	24%	0.236	42%	0.424	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.5	127.7	-178.6	177	0	0	0	0	110.8	A42 V47 V88 M90	A42-V49 HydrophobicContact CB-CG2 3.41Å; A42-V49 VanDerWaalsContact CB-CG2 3.41Å; V47-V49 HydrophobicContact CG1-CG2 4.48Å; V47-V49 PolarHBondContact O-N 3.33Å; V47-V49 VanDerWaalsContact O-N 3.12Å; V49-V88 HydrophobicContact CG1-CG1 3.47Å; V49-V88 VanDerWaalsContact CG1-CG1 3.47Å; V49-M90 HydrophobicContact CG2-CB 4.24Å
50	K	91.9	Very high	92.5	Very high	127 Å²	127	89.7 Å²	89.7	55%	0.552	44%	0.443	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-81.4	121.9	157.8	-168.8	171.8	-176.4	171.5	0	106.9	I53 R89	K50-I53 HydrophobicContact CD-CD1 4.22Å; K50-R89 HydrophobicContact CB-CB 4.11Å; K50-R89 PolarHBondContact N-O 3.05Å; K50-R89 PolarHBondContact O-N 3.28Å
51	G	87.6	Confident	92.8	Very high	33 Å²	33	91.1 Å²	91.1	34%	0.34	45%	0.445	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-53.8	-178.4	-173.3	0	0	0	0	0	114.8	I53	G51-I53 PolarHBondContact O-N 2.85Å
52	P	94.3	Very high	93	Very high	46 Å²	46	95.7 Å²	95.7	30%	0.299	47%	0.467	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.2	107.8	-170.6	29.8	-31	0	0	0	110.4	C35 I39 R54	C35-P52 VanDerWaalsContact SG-CB 3.53Å; I39-P52 HydrophobicContact CD1-CB 4.05Å; I39-P52 HydrophobicContact CD1-CG 3.83Å; P52-R54 PolarHBondContact O-N 2.85Å
53	I	95.5	Very high	93.2	Very high	45 Å²	45	99.9 Å²	99.9	23%	0.231	49%	0.492	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.3	113.5	172.7	-60.1	167.6	0	0	0	106.9	K50 G51 F55 R86 T87 R89	K50-I53 HydrophobicContact CD-CD1 4.22Å; G51-I53 PolarHBondContact O-N 2.85Å; I53-F55 HydrophobicContact CG2-CD2 4.39Å; I53-F55 HydrophobicContact CG2-CE2 4.09Å; I53-R86 CarbonylContact O-C 3.6Å; I53-R86 WeakPolarHBondContact O-CA 3.32Å; I53-T87 PolarHBondContact N-O 3.02Å; I53-T87 PolarHBondContact O-N 3.19Å; I53-R89 HydrophobicContact CD1-CG 4.3Å
54	R	95.9	Very high	93.2	Very high	157 Å²	157	94 Å²	94	59%	0.592	48%	0.477	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-79.5	121.8	173.7	-58.5	-171	165.4	74.8	-1.3	108.6	E32 P52	E32-R54 IonicContact OE1-NH2 3.84Å; P52-R54 PolarHBondContact O-N 2.85Å
55	F	95.3	Very high	93.2	Very high	79 Å²	79	92.7 Å²	92.7	35%	0.346	46%	0.464	S	S	.	.	P	Polyproline II helix	trans	-89.2	154.6	168.3	-84.2	-89.2	0	0	0	110.2	I53 T57 K85 T87	I53-F55 HydrophobicContact CG2-CD2 4.39Å; I53-F55 HydrophobicContact CG2-CE2 4.09Å; F55-T57 PolarHBondContact O-N 3.39Å; F55-K85 HydrophobicContact CB-CB 3.97Å; F55-K85 HydrophobicContact CB-CD 4.41Å; F55-K85 HydrophobicContact CB-CG 4.19Å; F55-K85 HydrophobicContact CD2-CD 4.34Å; F55-K85 HydrophobicContact CD2-CG 4.22Å; F55-K85 HydrophobicContact CG-CD 4.35Å; F55-K85 HydrophobicContact CG-CG 4.41Å; F55-K85 PolarHBondContact N-O 2.92Å; F55-T87 HydrophobicContact CE2-CG2 4.49Å; F55-T87 WeakPolarHBondContact CE2-OG1 3.44Å
56	P	97	Very high	93.3	Very high	111 Å²	111	94.6 Å²	94.6	72%	0.721	47%	0.469	S	S	*	.	P	Polyproline II helix	trans	-53	138.4	172.3	-25.5	34.4	0	0	0	111.4	K58	P56-K58 PolarHBondContact O-N 3.13Å
57	T	96.1	Very high	93.3	Very high	65 Å²	65	89.1 Å²	89.1	40%	0.399	44%	0.44	S	S	.	.	P	Polyproline II helix	trans	-72.3	120.5	178.6	53.9	0	0	0	0	109.4	F55 I59 H84	F55-T57 PolarHBondContact O-N 3.39Å; T57-I59 PolarHBondContact O-N 3.45Å; T57-H84 VanDerWaalsContact CG2-CE1 3.49Å; T57-H84 WeakPolarHBondContact CG2-CE1 3.13Å; T57-H84 WeakPolarHBondContact CG2-ND1 3.49Å
58	K	95.9	Very high	93.2	Very high	153 Å²	153	94.8 Å²	94.8	67%	0.665	48%	0.478	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-78.9	122	174.1	-66.7	-175.1	177.1	-173.3	0	108.1	P56 I83	P56-K58 PolarHBondContact O-N 3.13Å; K58-I83 HydrophobicContact CB-CB 4.37Å; K58-I83 PolarHBondContact N-O 3.44Å; K58-I83 PolarHBondContact O-N 3.36Å
59	I	96.9	Very high	93	Very high	66 Å²	66	90.6 Å²	90.6	34%	0.338	47%	0.47	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.9	109.2	178.7	-50.4	177.3	0	0	0	107	T57 R61 E80 R82	T57-I59 PolarHBondContact O-N 3.45Å; I59-R61 HydrophobicContact CG2-CG 3.84Å; I59-E80 HydrophobicContact CG2-CB 4.44Å; I59-E80 HydrophobicContact CG2-CG 4.4Å; I59-R82 HydrophobicContact CG1-CG 4.44Å; I59-R82 HydrophobicContact CG2-CG 4.49Å
60	L	96.6	Very high	92.4	Very high	91 Å²	91	90.2 Å²	90.2	48%	0.476	47%	0.474	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.5	126.9	168.9	-56.3	-179.9	0	0	0	107.5	E80 M81 I83	L60-E80 CarbonylContact O-C 3.6Å; L60-E80 WeakPolarHBondContact O-CA 3.37Å; L60-M81 HydrophobicContact CB-CB 4.25Å; L60-M81 HydrophobicContact CD1-SD 4.25Å; L60-M81 PolarHBondContact N-O 3.14Å; L60-M81 PolarHBondContact O-N 3.17Å; L60-I83 HydrophobicContact CD1-CD1 3.83Å; L60-I83 HydrophobicContact CG-CD1 4.3Å
61	R	97	Very high	91.9	Very high	166 Å²	166	91.3 Å²	91.3	63%	0.626	48%	0.481	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-121.9	126.7	-178.4	-66	-176.4	161.3	160.4	-1.5	109	I59 Y79 E80	I59-R61 HydrophobicContact CG2-CG 3.84Å; R61-Y79 WeakPolarHBondContact CA-O 3.39Å; R61-E80 HydrophobicContact CG-CG 4.33Å; R61-E80 IonicContact CZ-OE1 3.96Å; R61-E80 IonicContact NE-OE1 3.37Å; R61-E80 PolarHBondContact NE-OE1 3.44Å; R61-E80 IonicContact NH2-OE1 3.73Å; R61-E80 PolarHBondContact NH2-OE1 2.78Å
62	I	96.2	Very high	91.5	Very high	116 Å²	116	92.6 Å²	92.6	60%	0.595	50%	0.495	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-118.7	119.6	168.8	-60.8	174.9	0	0	0	106.6	Y79	I62-Y79 PolarHBondContact N-O 2.94Å; I62-Y79 PolarHBondContact O-N 3.33Å
63	T	94.8	Very high	91	Very high	88 Å²	88	94 Å²	94	54%	0.54	51%	0.506	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.1	117.2	175.1	56.5	0	0	0	0	108.9	D77 R78	T63-D77 VanDerWaalsContact CA-O 3.31Å; T63-D77 WeakPolarHBondContact CA-O 3.33Å; T63-R78 HydrophobicContact CG2-CG 4.12Å
64	C	91	Very high	90.5	Very high	49 Å²	49	101.1 Å²	101.1	33%	0.331	54%	0.535	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.9	163.4	178.5	46	0	0	0	0	110.2	W76 D77 Y79	C64-W76 CarbonylContact O-C 3.58Å; C64-W76 WeakPolarHBondContact O-CA 3.49Å; C64-D77 PolarHBondContact N-O 3.21Å; C64-D77 VanDerWaalsContact N-O 3.15Å; C64-D77 PolarHBondContact O-N 3.27Å; C64-Y79 WeakPolarHBondContact SG-CE2 3.41Å
65	R	90.7	Very high	90.3	Very high	81 Å²	81	96 Å²	96	31%	0.306	52%	0.522	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-76.5	143	173.1	-74	-167.4	58.7	164.1	-7.8	110.1	T67 G70 W76	R65-T67 PolarHBondContact NE-OG1 2.79Å; R65-T67 PolarHBondContact NH2-OG1 2.91Å; R65-G70 PolarHBondContact NH1-O 3.42Å; R65-G70 PolarHBondContact NH2-O 2.85Å; R65-W76 HydrophobicContact CG-CD2 4.24Å; R65-W76 HydrophobicContact CG-CE3 4Å; R65-W76 HydrophobicContact CG-CH2 3.9Å; R65-W76 HydrophobicContact CG-CZ2 4.13Å; R65-W76 HydrophobicContact CG-CZ3 3.83Å
66	K	90.7	Very high	90.1	Very high	122 Å²	122	99.1 Å²	99.1	53%	0.53	53%	0.531	S	S	.	.	S	Bend	trans	-65.8	-43.3	172.1	-69.9	-170.8	174.4	179.7	0	112.1	T75 D77	K66-T75 PolarHBondContact N-O 3Å; K66-D77 WeakPolarHBondContact CE-OD1 3.43Å; K66-D77 WeakPolarHBondContact CG-OD1 3.43Å; K66-D77 WeakPolarHBondContact CG-OD2 3.49Å; K66-D77 IonicContact NZ-OD1 3.74Å
67	T	88.5	Confident	90	Very high	36 Å²	36	95.8 Å²	95.8	22%	0.221	51%	0.507	C	S	.	.	S	Bend	trans	-80.2	133.2	-176.4	49.6	0	0	0	0	111.5	R65	R65-T67 PolarHBondContact NE-OG1 2.79Å; R65-T67 PolarHBondContact NH2-OG1 2.91Å
68	P	86.7	Confident	90	Very high	137 Å²	137	102.6 Å²	102.6	89%	0.89	53%	0.526	S	S	*	.	T	Hydrogen-bonded Turn	trans	-72.2	-35.2	-178.7	28.6	-34.8	0	0	0	113.5	G70	P68-G70 PolarHBondContact O-N 3.05Å
69	C	82.8	Confident	90	Very high	95 Å²	95	101.8 Å²	101.8	64%	0.642	52%	0.519	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86	1	-170.5	55.8	0	0	0	0	115	E71	C69-E71 PolarHBondContact O-N 3.37Å
70	G	78.5	Confident	90	Very high	31 Å²	31	102.7 Å²	102.7	32%	0.32	52%	0.522	S	S	.	.	S	Bend	trans	68.1	-10.4	-174.6	0	0	0	0	0	115.1	R65 P68	R65-G70 PolarHBondContact NH1-O 3.42Å; R65-G70 PolarHBondContact NH2-O 2.85Å; P68-G70 PolarHBondContact O-N 3.05Å
71	E	81.5	Confident	90	Very high	150 Å²	150	103.2 Å²	103.2	70%	0.701	52%	0.523	S	S	*	.			trans	-95.7	150.4	174.3	-68.7	-58.3	150.9	0	0	111.7	C69	C69-E71 PolarHBondContact O-N 3.37Å
72	G	79.1	Confident	90	Very high	60 Å²	60	101.5 Å²	101.5	62%	0.619	52%	0.517	S	S	*	.	S	Bend	trans	107.2	-164.8	-178.4	0	0	0	0	0	115.4
73	S	83.9	Confident	90	Very high	77 Å²	77	98.5 Å²	98.5	54%	0.538	50%	0.501	S	S	.	.	S	Bend	trans	-61.7	143.3	-174.9	70.9	0	0	0	0	112.3	T75	S73-T75 PolarHBondContact O-N 3.5Å; S73-T75 VanDerWaalsContact OG-CG2 3.31Å; S73-T75 WeakPolarHBondContact OG-CG2 3.47Å
74	K	84.9	Confident	90	Very high	194 Å²	194	95.6 Å²	95.6	84%	0.843	48%	0.482	S	S	*	.			trans	-71.7	56.1	-179.8	-64.5	-179.9	-179	176.9	0	112.1
75	T	91.9	Very high	90.3	Very high	50 Å²	50	97 Å²	97	31%	0.307	48%	0.482	S	S	.	.			trans	-95.8	132.9	179	56.1	0	0	0	0	111.4	K66 S73	K66-T75 PolarHBondContact N-O 3Å; S73-T75 PolarHBondContact O-N 3.5Å; S73-T75 VanDerWaalsContact OG-CG2 3.31Å; S73-T75 WeakPolarHBondContact OG-CG2 3.47Å
76	W	92.3	Very high	90.5	Very high	144 Å²	144	94.2 Å²	94.2	55%	0.545	47%	0.472	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122	139.6	-176	-64.8	83.2	0	0	0	110.5	C64 R65	C64-W76 CarbonylContact O-C 3.58Å; C64-W76 WeakPolarHBondContact O-CA 3.49Å; R65-W76 HydrophobicContact CG-CD2 4.24Å; R65-W76 HydrophobicContact CG-CE3 4Å; R65-W76 HydrophobicContact CG-CH2 3.9Å; R65-W76 HydrophobicContact CG-CZ2 4.13Å; R65-W76 HydrophobicContact CG-CZ3 3.83Å
77	D	94	Very high	90.7	Very high	41 Å²	41	88.4 Å²	88.4	22%	0.219	45%	0.446	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.6	142.3	164.9	-75.5	-30.3	0	0	0	110.1	T63 C64 K66 Y79	T63-D77 VanDerWaalsContact CA-O 3.31Å; T63-D77 WeakPolarHBondContact CA-O 3.33Å; C64-D77 PolarHBondContact N-O 3.21Å; C64-D77 VanDerWaalsContact N-O 3.15Å; C64-D77 PolarHBondContact O-N 3.27Å; K66-D77 WeakPolarHBondContact CE-OD1 3.43Å; K66-D77 WeakPolarHBondContact CG-OD1 3.43Å; K66-D77 WeakPolarHBondContact CG-OD2 3.49Å; K66-D77 IonicContact NZ-OD1 3.74Å; D77-Y79 HydrophobicContact CB-CD2 4.1Å; D77-Y79 HydrophobicContact CB-CE2 3.43Å; D77-Y79 VanDerWaalsContact CB-CE2 3.43Å; D77-Y79 PolarHBondContact OD2-OH 3.17Å
78	R	95.7	Very high	91	Very high	208 Å²	208	86.7 Å²	86.7	79%	0.785	44%	0.436	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-123.3	96.8	178.1	-61	-175.7	176.7	168.6	-1.2	108.5	T63	T63-R78 HydrophobicContact CG2-CG 4.12Å
79	Y	96.9	Very high	91.3	Very high	135 Å²	135	85 Å²	85	53%	0.529	41%	0.412	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.1	128.9	175.1	-62.7	-78.5	0	0	0	109.5	R61 I62 C64 D77	R61-Y79 WeakPolarHBondContact CA-O 3.39Å; I62-Y79 PolarHBondContact N-O 2.94Å; I62-Y79 PolarHBondContact O-N 3.33Å; C64-Y79 WeakPolarHBondContact SG-CE2 3.41Å; D77-Y79 HydrophobicContact CB-CD2 4.1Å; D77-Y79 HydrophobicContact CB-CE2 3.43Å; D77-Y79 VanDerWaalsContact CB-CE2 3.43Å; D77-Y79 PolarHBondContact OD2-OH 3.17Å
80	E	96.4	Very high	91.7	Very high	86 Å²	86	81 Å²	81	40%	0.402	38%	0.384	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119	135.4	175.6	-62.3	-159.3	147.6	0	0	110.9	I59 L60 R61 R82	I59-E80 HydrophobicContact CG2-CB 4.44Å; I59-E80 HydrophobicContact CG2-CG 4.4Å; L60-E80 CarbonylContact O-C 3.6Å; L60-E80 WeakPolarHBondContact O-CA 3.37Å; R61-E80 HydrophobicContact CG-CG 4.33Å; R61-E80 IonicContact CZ-OE1 3.96Å; R61-E80 IonicContact NE-OE1 3.37Å; R61-E80 PolarHBondContact NE-OE1 3.44Å; R61-E80 IonicContact NH2-OE1 3.73Å; R61-E80 PolarHBondContact NH2-OE1 2.78Å; E80-R82 IonicContact OE2-CZ 2.78Å; E80-R82 IonicContact OE2-NE 3.01Å; E80-R82 PolarHBondContact OE2-NE 3.39Å; E80-R82 IonicContact OE2-NH2 3.27Å; E80-R82 PolarHBondContact OE2-NH2 2.85Å
81	M	96.3	Very high	92.3	Very high	102 Å²	102	84.4 Å²	84.4	50%	0.502	39%	0.393	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.5	125.6	163.5	-179.9	-176.1	-68.4	0	0	108.8	L60	L60-M81 HydrophobicContact CB-CB 4.25Å; L60-M81 HydrophobicContact CD1-SD 4.25Å; L60-M81 PolarHBondContact N-O 3.14Å; L60-M81 PolarHBondContact O-N 3.17Å
82	R	96.2	Very high	92.6	Very high	129 Å²	129	77.7 Å²	77.7	49%	0.487	36%	0.362	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.6	121.4	-180	-61.9	-176.7	-176.5	-177.3	1.4	109.5	C26 I59 E80	C26-R82 WeakPolarHBondContact CA-O 3.45Å; I59-R82 HydrophobicContact CG1-CG 4.44Å; I59-R82 HydrophobicContact CG2-CG 4.49Å; E80-R82 IonicContact OE2-CZ 2.78Å; E80-R82 IonicContact OE2-NE 3.01Å; E80-R82 PolarHBondContact OE2-NE 3.39Å; E80-R82 IonicContact OE2-NH2 3.27Å; E80-R82 PolarHBondContact OE2-NH2 2.85Å
83	I	96.4	Very high	93	Very high	53 Å²	53	75.7 Å²	75.7	27%	0.272	34%	0.338	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.8	113.5	175.3	-58.5	173.1	0	0	0	107.6	K58 L60	K58-I83 HydrophobicContact CB-CB 4.37Å; K58-I83 PolarHBondContact N-O 3.44Å; K58-I83 PolarHBondContact O-N 3.36Å; L60-I83 HydrophobicContact CD1-CD1 3.83Å; L60-I83 HydrophobicContact CG-CD1 4.3Å
84	H	96.5	Very high	93.1	Very high	27 Å²	27	75.4 Å²	75.4	13%	0.125	33%	0.33	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.6	124.1	176.8	-60.7	-88.6	0	0	0	108.8	T24 S25 V28 L31 T57	T24-H84 WeakPolarHBondContact CA-O 3.33Å; S25-H84 PolarHBondContact N-O 3.03Å; S25-H84 VanDerWaalsContact N-O 3.09Å; S25-H84 WeakPolarHBondContact O-CB 3.49Å; S25-H84 PolarHBondContact O-N 3.03Å; V28-H84 VanDerWaalsContact CG2-CE1 3.49Å; V28-H84 WeakPolarHBondContact CG2-CE1 3.4Å; V28-H84 WeakPolarHBondContact CG2-NE2 3.45Å; L31-H84 HydrophobicContact CD2-CB 3.48Å; L31-H84 VanDerWaalsContact CD2-CB 3.48Å; T57-H84 VanDerWaalsContact CG2-CE1 3.49Å; T57-H84 WeakPolarHBondContact CG2-CE1 3.13Å; T57-H84 WeakPolarHBondContact CG2-ND1 3.49Å
85	K	95.9	Very high	93.2	Very high	78 Å²	78	71.1 Å²	71.1	34%	0.339	31%	0.313	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.2	127.5	176.2	-178.1	174.2	-177.1	174.9	0	110.1	L23 T24 F55	L23-K85 CarbonylContact O-C 3.58Å; L23-K85 WeakPolarHBondContact O-CA 3.37Å; T24-K85 HydrophobicContact CG2-CB 4.08Å; T24-K85 HydrophobicContact CG2-CD 4.35Å; T24-K85 HydrophobicContact CG2-CG 3.95Å; F55-K85 HydrophobicContact CB-CB 3.97Å; F55-K85 HydrophobicContact CB-CD 4.41Å; F55-K85 HydrophobicContact CB-CG 4.19Å; F55-K85 HydrophobicContact CD2-CD 4.34Å; F55-K85 HydrophobicContact CD2-CG 4.22Å; F55-K85 HydrophobicContact CG-CD 4.35Å; F55-K85 HydrophobicContact CG-CG 4.41Å; F55-K85 PolarHBondContact N-O 2.92Å
86	R	95.7	Very high	93	Very high	23 Å²	23	74 Å²	74	9%	0.087	32%	0.322	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.7	152.6	171.4	-58.8	-63.9	178.3	94.5	0.1	108.8	A22 L23 L31 E32 I53	A22-R86 CarbonylContact C-O 3.55Å; A22-R86 WeakPolarHBondContact CA-O 3.46Å; L23-R86 HydrophobicContact CB-CB 4.48Å; L23-R86 PolarHBondContact N-O 2.88Å; L23-R86 PolarHBondContact O-N 3.09Å; L31-R86 HydrophobicContact CD1-CG 4.41Å; L31-R86 HydrophobicContact CD2-CG 3.8Å; L31-R86 HydrophobicContact CG-CG 3.96Å; E32-R86 IonicContact OE1-CZ 2.69Å; E32-R86 IonicContact OE1-NH1 3.48Å; E32-R86 PolarHBondContact OE1-NH1 3.41Å; E32-R86 IonicContact OE1-NH2 2.81Å; E32-R86 PolarHBondContact OE1-NH2 3.01Å; I53-R86 CarbonylContact O-C 3.6Å; I53-R86 WeakPolarHBondContact O-CA 3.32Å
87	T	95.1	Very high	92.8	Very high	0 Å²	0	67.3 Å²	67.3	0%	0	30%	0.297	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.7	129.9	-179.3	-63.5	0	0	0	0	110.5	Q20 V21 I53 F55 R89	Q20-T87 HydrophobicContact CG-CG2 3.14Å; V21-T87 CarbonylContact O-C 3.6Å; V21-T87 VanDerWaalsContact O-CA 3.3Å; V21-T87 WeakPolarHBondContact O-CA 3.48Å; I53-T87 PolarHBondContact N-O 3.02Å; I53-T87 PolarHBondContact O-N 3.19Å; F55-T87 HydrophobicContact CE2-CG2 4.49Å; F55-T87 WeakPolarHBondContact CE2-OG1 3.44Å; T87-R89 HydrophobicContact CG2-CG 4.24Å
88	V	94	Very high	92.5	Very high	1 Å²	1	70 Å²	70	1%	0.006	31%	0.306	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.9	128.1	173.2	-175.4	0	0	0	0	107.2	V21 L38 I39 V49	V21-V88 PolarHBondContact N-O 3.06Å; V21-V88 PolarHBondContact O-N 2.85Å; L38-V88 HydrophobicContact CD2-CB 4.18Å; L38-V88 HydrophobicContact CD2-CG2 3.98Å; I39-V88 HydrophobicContact CG1-CG2 4.4Å; V49-V88 HydrophobicContact CG1-CG1 3.47Å; V49-V88 VanDerWaalsContact CG1-CG1 3.47Å
89	R	93.8	Very high	92.2	Very high	101 Å²	101	65.6 Å²	65.6	38%	0.381	30%	0.295	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.5	133.5	177.1	-62.5	177.9	174.2	173.1	2.9	108.9	I19 Q20 K50 I53 T87	I19-R89 WeakPolarHBondContact O-CA 3.37Å; Q20-R89 HydrophobicContact CB-CG 4.38Å; Q20-R89 HydrophobicContact CG-CG 4.03Å; K50-R89 HydrophobicContact CB-CB 4.11Å; K50-R89 PolarHBondContact N-O 3.05Å; K50-R89 PolarHBondContact O-N 3.28Å; I53-R89 HydrophobicContact CD1-CG 4.3Å; T87-R89 HydrophobicContact CG2-CG 4.24Å
90	M	91.7	Very high	91.7	Very high	10 Å²	10	59.2 Å²	59.2	5%	0.049	27%	0.27	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-147.1	160.3	179.7	59	-170.1	-173.2	0	0	111.6	I19 V21 V47 K48 V49 T92 L97 L100	I19-M90 PolarHBondContact N-O 2.9Å; I19-M90 PolarHBondContact O-N 2.82Å; I19-M90 VanDerWaalsContact O-O 3.13Å; V21-M90 HydrophobicContact CG2-CE 4.09Å; V47-M90 HydrophobicContact CG1-CB 3.87Å; V47-M90 HydrophobicContact CG1-CG 4.41Å; V47-M90 HydrophobicContact CG1-SD 4.22Å; K48-M90 WeakPolarHBondContact O-CA 3.35Å; V49-M90 HydrophobicContact CG2-CB 4.24Å; M90-T92 HydrophobicContact CE-CG2 3.91Å; M90-T92 HydrophobicContact CG-CG2 4.04Å; M90-T92 HydrophobicContact SD-CG2 4.32Å; M90-L97 HydrophobicContact CE-CB 4.48Å; M90-L97 HydrophobicContact CE-CD1 3.06Å; M90-L97 HydrophobicContact CE-CG 4.33Å; M90-L100 HydrophobicContact CE-CD1 3.69Å; M90-L100 HydrophobicContact SD-CD1 3.94Å
91	M	89.9	Confident	91.2	Very high	104 Å²	104	57.2 Å²	57.2	51%	0.512	26%	0.263	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.8	103.1	177.7	-177.2	165.8	-175.6	0	0	108.2	P16 K17	P16-M91 HydrophobicContact CB-CE 3.9Å; P16-M91 HydrophobicContact CB-CG 3.89Å; P16-M91 HydrophobicContact CG-CE 3.81Å; K17-M91 WeakPolarHBondContact O-CA 3.47Å
92	T	87	Confident	90.7	Very high	8 Å²	8	60.1 Å²	60.1	5%	0.049	27%	0.273	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-154.3	165.1	-172.7	-169.8	0	0	0	0	111.3	K17 I19 M90 K96 L97	K17-T92 PolarHBondContact N-O 2.88Å; K17-T92 VanDerWaalsContact N-O 3.13Å; K17-T92 PolarHBondContact O-N 2.91Å; K17-T92 VanDerWaalsContact O-N 3.09Å; I19-T92 HydrophobicContact CD1-CG2 3.85Å; M90-T92 HydrophobicContact CE-CG2 3.91Å; M90-T92 HydrophobicContact CG-CG2 4.04Å; M90-T92 HydrophobicContact SD-CG2 4.32Å; T92-K96 WeakPolarHBondContact OG1-CB 3.47Å; T92-L97 HydrophobicContact CG2-CB 4.34Å
93	S	89	Confident	89.9	Confident	18 Å²	18	56.6 Å²	56.6	13%	0.126	26%	0.264	C	S	.	.			trans	-74.4	158.4	168.3	61	0	0	0	0	111.4	D13 E95 K96 L97	D13-S93 VanDerWaalsContact O-CB 3.28Å; D13-S93 WeakPolarHBondContact O-CB 3.33Å; S93-E95 VanDerWaalsContact C-N 3.3Å; S93-E95 PolarHBondContact O-N 2.9Å; S93-K96 WeakPolarHBondContact OG-CG 3.02Å; S93-L97 PolarHBondContact O-N 2.94Å
94	L	86.1	Confident	89	Confident	71 Å²	71	59.1 Å²	59.1	37%	0.372	28%	0.284	S	S	.	.	H	α-helix	trans	-65.5	-32.2	-179.5	-176	61.9	0	0	0	112.6	L97 K98	L94-L97 HydrophobicContact CD1-CD2 4.04Å; L94-L97 WeakPolarHBondContact O-CB 3.16Å; L94-L97 PolarHBondContact O-N 2.86Å; L94-K98 WeakPolarHBondContact O-CG 3.39Å; L94-K98 PolarHBondContact O-N 3.48Å; L94-K98 VanDerWaalsContact O-N 3.13Å
95	E	86.4	Confident	88.4	Confident	104 Å²	104	60.2 Å²	60.2	49%	0.486	29%	0.29	S	S	.	.	H	α-helix	trans	-66.3	-50.4	179	-64.9	178.1	169.2	0	0	111.8	A12 S93 L97 K98 E99	A12-E95 WeakPolarHBondContact CB-OE1 3.38Å; S93-E95 VanDerWaalsContact C-N 3.3Å; S93-E95 PolarHBondContact O-N 2.9Å; E95-L97 PolarHBondContact O-N 2.93Å; E95-K98 WeakPolarHBondContact O-CB 3.44Å; E95-K98 PolarHBondContact O-N 3.5Å; E95-E99 PolarHBondContact O-N 2.82Å
96	K	88.1	Confident	87.9	Confident	110 Å²	110	60.3 Å²	60.3	48%	0.478	29%	0.292	S	S	.	.	H	α-helix	trans	-59.4	-35.3	174.7	-71.2	-174	177.5	-168.7	0	111.8	T92 S93 E99 L100	T92-K96 WeakPolarHBondContact OG1-CB 3.47Å; S93-K96 WeakPolarHBondContact OG-CG 3.02Å; K96-E99 PolarHBondContact O-N 3.17Å; K96-L100 VanDerWaalsContact O-CG 3.32Å; K96-L100 WeakPolarHBondContact O-CG 3.31Å; K96-L100 PolarHBondContact O-N 2.84Å
97	L	88.6	Confident	87.5	Confident	5 Å²	5	65.3 Å²	65.3	3%	0.026	33%	0.327	C	S	.	.	H	α-helix	trans	-61.4	-45.7	174.2	174.7	72.6	0	0	0	111.9	I19 V21 M90 T92 S93 L94 E95 E99 L100 T101 V113	I19-L97 HydrophobicContact CD1-CB 4.32Å; I19-L97 HydrophobicContact CD1-CD2 4.02Å; I19-L97 HydrophobicContact CG2-CD1 4.24Å; I19-L97 HydrophobicContact CG2-CD2 3.8Å; V21-L97 HydrophobicContact CG2-CD1 3.7Å; M90-L97 HydrophobicContact CE-CB 4.48Å; M90-L97 HydrophobicContact CE-CD1 3.06Å; M90-L97 HydrophobicContact CE-CG 4.33Å; T92-L97 HydrophobicContact CG2-CB 4.34Å; S93-L97 PolarHBondContact O-N 2.94Å; L94-L97 HydrophobicContact CD1-CD2 4.04Å; L94-L97 WeakPolarHBondContact O-CB 3.16Å; L94-L97 PolarHBondContact O-N 2.86Å; E95-L97 PolarHBondContact O-N 2.93Å; L97-E99 PolarHBondContact O-N 2.9Å; L97-L100 PolarHBondContact O-N 3.09Å; L97-T101 HydrophobicContact CD1-CG2 4.24Å; L97-T101 HydrophobicContact CG-CG2 4.49Å; L97-T101 WeakPolarHBondContact O-CG2 3.44Å; L97-T101 PolarHBondContact O-N 3.37Å; L97-T101 PolarHBondContact O-OG1 2.88Å; L97-V113 HydrophobicContact CD2-CG1 3.54Å; L97-V113 HydrophobicContact CD2-CG2 4.16Å
98	K	87.7	Confident	87.3	Confident	97 Å²	97	68.8 Å²	68.8	42%	0.422	35%	0.348	S	S	.	.	H	α-helix	trans	-57.6	-41.2	179.2	-70.1	174.7	-176.5	174.3	0	110.2	E10 L94 E95 T101 K102	E10-K98 IonicContact OE1-NZ 3.03Å; L94-K98 WeakPolarHBondContact O-CG 3.39Å; L94-K98 PolarHBondContact O-N 3.48Å; L94-K98 VanDerWaalsContact O-N 3.13Å; E95-K98 WeakPolarHBondContact O-CB 3.44Å; E95-K98 PolarHBondContact O-N 3.5Å; K98-T101 WeakPolarHBondContact CA-OG1 3.34Å; K98-T101 PolarHBondContact O-N 3.15Å; K98-T101 PolarHBondContact O-OG1 2.86Å; K98-K102 WeakPolarHBondContact O-CG 3.43Å; K98-K102 PolarHBondContact O-N 2.88Å
99	E	87.8	Confident	87.3	Confident	115 Å²	115	69.2 Å²	69.2	54%	0.537	35%	0.351	S	S	.	.	H	α-helix	trans	-62.5	-47.8	175.8	-65.5	174.5	171.5	0	0	112.6	E95 K96 L97 T101 K102	E95-E99 PolarHBondContact O-N 2.82Å; K96-E99 PolarHBondContact O-N 3.17Å; L97-E99 PolarHBondContact O-N 2.9Å; E99-T101 PolarHBondContact O-N 2.94Å; E99-K102 WeakPolarHBondContact O-CB 2.84Å; E99-K102 PolarHBondContact O-N 3.25Å; E99-K102 VanDerWaalsContact O-N 3.14Å
100	L	88	Confident	87.2	Confident	2 Å²	2	67.3 Å²	67.3	1%	0.01	35%	0.353	C	S	.	.	H	α-helix	trans	-60.5	-31.8	177.6	-67.7	172.7	0	0	0	112.9	L38 S41 A42 N45 V47 M90 K96 L97 L103	L38-L100 HydrophobicContact CD1-CB 4.41Å; S41-L100 VanDerWaalsContact OG-CD2 3.27Å; S41-L100 WeakPolarHBondContact OG-CD2 3.44Å; A42-L100 HydrophobicContact CB-CD1 4.31Å; A42-L100 HydrophobicContact CB-CD2 4.33Å; N45-L100 HydrophobicContact CB-CD2 4.47Å; N45-L100 WeakPolarHBondContact ND2-CD2 3.19Å; V47-L100 HydrophobicContact CG2-CD1 4.49Å; M90-L100 HydrophobicContact CE-CD1 3.69Å; M90-L100 HydrophobicContact SD-CD1 3.94Å; K96-L100 VanDerWaalsContact O-CG 3.32Å; K96-L100 WeakPolarHBondContact O-CG 3.31Å; K96-L100 PolarHBondContact O-N 2.84Å; L97-L100 PolarHBondContact O-N 3.09Å; L100-L103 WeakPolarHBondContact O-CD1 3.31Å; L100-L103 WeakPolarHBondContact O-CG 3.34Å
101	T	85.9	Confident	87.2	Confident	43 Å²	43	69.8 Å²	69.8	26%	0.264	37%	0.366	S	S	.	.	H	α-helix	trans	-81.4	-11.2	179.4	53.1	0	0	0	0	114.7	L97 K98 E99 L103	L97-T101 HydrophobicContact CD1-CG2 4.24Å; L97-T101 HydrophobicContact CG-CG2 4.49Å; L97-T101 WeakPolarHBondContact O-CG2 3.44Å; L97-T101 PolarHBondContact O-N 3.37Å; L97-T101 PolarHBondContact O-OG1 2.88Å; K98-T101 WeakPolarHBondContact CA-OG1 3.34Å; K98-T101 PolarHBondContact O-N 3.15Å; K98-T101 PolarHBondContact O-OG1 2.86Å; E99-T101 PolarHBondContact O-N 2.94Å; T101-L103 PolarHBondContact O-N 2.76Å
102	K	85	Confident	87.4	Confident	164 Å²	164	71.8 Å²	71.8	71%	0.713	37%	0.369	S	S	*	.	T	Hydrogen-bonded Turn	trans	-73	-2.6	179.4	-73.6	169.6	-171.1	175.1	0	113.8	K98 E99	K98-K102 WeakPolarHBondContact O-CG 3.43Å; K98-K102 PolarHBondContact O-N 2.88Å; E99-K102 WeakPolarHBondContact O-CB 2.84Å; E99-K102 PolarHBondContact O-N 3.25Å; E99-K102 VanDerWaalsContact O-N 3.14Å
103	L	78.8	Confident	87.6	Confident	54 Å²	54	74.6 Å²	74.6	28%	0.283	39%	0.385	S	S	.	.	S	Bend	trans	-59.2	152.3	175.9	-63.8	173	0	0	0	111.3	E37 L100 T101 I105	E37-L103 HydrophobicContact CB-CD1 4.45Å; L100-L103 WeakPolarHBondContact O-CD1 3.31Å; L100-L103 WeakPolarHBondContact O-CG 3.34Å; T101-L103 PolarHBondContact O-N 2.76Å; L103-I105 PolarHBondContact O-N 3.29Å
104	P	77.7	Confident	87.8	Confident	107 Å²	107	77.5 Å²	77.5	70%	0.695	40%	0.402	S	S	*	.			trans	-66.9	101	179.6	28.1	-34.5	0	0	0	110.3
105	I	84.2	Confident	87.9	Confident	50 Å²	50	77.4 Å²	77.4	26%	0.256	41%	0.405	S	S	.	.			trans	-98.6	128.7	177.2	-66.5	170	0	0	0	108.4	L103 V109 I111	L103-I105 PolarHBondContact O-N 3.29Å; I105-V109 HydrophobicContact CG2-CB 3.82Å; I105-V109 HydrophobicContact CG2-CG1 4.24Å; I105-I111 HydrophobicContact CD1-CD1 3.18Å; I105-I111 HydrophobicContact CD1-CG1 4.19Å; I105-I111 HydrophobicContact CG1-CD1 4.45Å; I105-I111 HydrophobicContact CG2-CD1 4.45Å
106	E	86.1	Confident	87.6	Confident	80 Å²	80	78.4 Å²	78.4	37%	0.374	43%	0.431	S	S	.	.			trans	-58.8	133.8	175.8	-166.8	174.7	163.3	0	0	109.5	A30 V108 V109	A30-E106 HydrophobicContact CB-CB 4.46Å; A30-E106 WeakPolarHBondContact CB-OE2 3.42Å; E106-V108 PolarHBondContact O-N 2.81Å; E106-V109 PolarHBondContact O-N 2.88Å
107	P	87.1	Confident	87.6	Confident	128 Å²	128	76.9 Å²	76.9	83%	0.831	43%	0.429	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.4	-14	-170.4	23.1	-35.3	0	0	0	114.4	V109	P107-V109 VanDerWaalsContact C-N 3.27Å; P107-V109 PolarHBondContact O-N 2.88Å
108	V	90.5	Very high	87.5	Confident	72 Å²	72	80.6 Å²	80.6	44%	0.436	45%	0.45	S	S	.	.	T	Hydrogen-bonded Turn	trans	-78	-9	177.1	-169.7	0	0	0	0	112.5	S25 N27 E106	S25-V108 PolarHBondContact OG-O 3.32Å; N27-V108 HydrophobicContact CB-CG1 4.21Å; E106-V108 PolarHBondContact O-N 2.81Å
109	V	93	Very high	87.5	Confident	11 Å²	11	79.7 Å²	79.7	7%	0.067	45%	0.451	C	S	.	.			trans	-103.7	118.6	-179.1	-176.4	0	0	0	0	110.2	L23 A30 L31 I105 E106 P107	L23-V109 HydrophobicContact CB-CG1 4.31Å; L23-V109 HydrophobicContact CD2-CG1 4.26Å; A30-V109 HydrophobicContact CB-CG2 4.08Å; L31-V109 HydrophobicContact CD1-CG1 3.99Å; I105-V109 HydrophobicContact CG2-CB 3.82Å; I105-V109 HydrophobicContact CG2-CG1 4.24Å; E106-V109 PolarHBondContact O-N 2.88Å; P107-V109 VanDerWaalsContact C-N 3.27Å; P107-V109 PolarHBondContact O-N 2.88Å
110	S	92.3	Very high	87.5	Confident	61 Å²	61	77.6 Å²	77.6	43%	0.427	45%	0.446	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.2	140	174.5	-44.2	0	0	0	0	111.2	L23 T24	L23-S110 WeakPolarHBondContact CA-O 3.5Å; T24-S110 PolarHBondContact N-O 3.3Å; T24-S110 PolarHBondContact O-N 3.47Å; T24-S110 PolarHBondContact OG1-O 2.94Å
111	I	92.5	Very high	87.5	Confident	62 Å²	62	82.4 Å²	82.4	32%	0.318	47%	0.474	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.1	133.6	-177.4	-46.8	168.9	0	0	0	109.2	V21 A22 L23 I105	V21-I111 HydrophobicContact CG1-CG2 3.72Å; A22-I111 CarbonylContact O-C 3.59Å; A22-I111 WeakPolarHBondContact O-CA 3.47Å; L23-I111 HydrophobicContact CD2-CB 4.29Å; L23-I111 HydrophobicContact CD2-CG1 3.76Å; L23-I111 HydrophobicContact CD2-CG2 4.09Å; I105-I111 HydrophobicContact CD1-CD1 3.18Å; I105-I111 HydrophobicContact CD1-CG1 4.19Å; I105-I111 HydrophobicContact CG1-CD1 4.45Å; I105-I111 HydrophobicContact CG2-CD1 4.45Å
112	Y	92.9	Very high	87.6	Confident	146 Å²	146	85 Å²	85	57%	0.573	49%	0.488	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-124.6	129.3	171.5	-66.3	-86.3	0	0	0	109.5	A22	A22-Y112 PolarHBondContact N-O 3.02Å; A22-Y112 PolarHBondContact O-N 3.07Å
113	V	92.4	Very high	87.8	Confident	66 Å²	66	79.4 Å²	79.4	40%	0.4	47%	0.472	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.1	132.7	176.2	176.9	0	0	0	0	109.2	I19 L97 V115	I19-V113 HydrophobicContact CG2-CG1 3.89Å; L97-V113 HydrophobicContact CD2-CG1 3.54Å; L97-V113 HydrophobicContact CD2-CG2 4.16Å; V113-V115 HydrophobicContact CG1-CG2 4.22Å
114	T	91.7	Very high	88.5	Confident	79 Å²	79	81.3 Å²	81.3	49%	0.485	49%	0.486	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.1	120.2	170.7	-51.6	0	0	0	0	108.4	Q20	Q20-T114 PolarHBondContact N-O 3.44Å; Q20-T114 PolarHBondContact O-N 2.62Å
115	V	89.3	Confident	89.4	Confident	70 Å²	70	79.2 Å²	79.2	42%	0.424	47%	0.469	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.1	127.9	171.9	-175.7	0	0	0	0	107	K17 I19 V113	K17-V115 HydrophobicContact CB-CG1 4.16Å; K17-V115 HydrophobicContact CD-CG1 3.82Å; I19-V115 HydrophobicContact CG1-CG2 4.46Å; V113-V115 HydrophobicContact CG1-CG2 4.22Å
116	A	80.3	Confident	89.8	Confident	125 Å²	125	81.8 Å²	81.8	100%	1.033	49%	0.488	S	S	*	.			trans	-93.5	0	171.9	0	0	0	0	0	111.2	K18	K18-A116 HydrophobicContact CB-CB 4.34Å; K18-A116 PolarHBondContact O-N 3.24Å

Retrieved 116 of 116 residues in 135.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).