A0A077Z6T0_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077Z6T0, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 44 aa.

						>A0A077Z6T0_TRITR|A0A077Z6T0
MNLGTIGQPEAVDIEHRFLRVSGVPFAGRSASIELLSIRGRPTG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53.4	Low	68.8	Low	234 Å²	234	136 Å²	136	100%	1.153	78%	0.78	S	S	*	*				0	107.2	0	-172.7	179.3	-73.4	0	0	106.3	L3	M1-L3 PolarHBondContact O-N 3.47Å
2	N	64.4	Low	70	Confident	164 Å²	164	132.9 Å²	132.9	88%	0.877	77%	0.765	S	S	*	*			trans	-83.2	113.8	-175.5	-151.3	-10.6	0	0	0	107.4	G4	N2-G4 PolarHBondContact O-N 2.99Å; N2-G4 VanDerWaalsContact O-N 3.11Å
3	L	65.8	Low	71.5	Confident	161 Å²	161	132.2 Å²	132.2	84%	0.843	76%	0.757	S	S	*	*			trans	-68.2	107.4	171.9	-75.6	157.6	0	0	0	105.8	M1 T5	M1-L3 PolarHBondContact O-N 3.47Å; L3-T5 PolarHBondContact O-N 3.32Å
4	G	69.1	Low	72.8	Confident	62 Å²	62	127.6 Å²	127.6	64%	0.639	73%	0.728	S	S	*	*			trans	-50.5	134.3	174.5	0	0	0	0	0	109.1	N2 I6	N2-G4 PolarHBondContact O-N 2.99Å; N2-G4 VanDerWaalsContact O-N 3.11Å; G4-I6 PolarHBondContact O-N 3.47Å
5	T	69.6	Low	74.3	Confident	141 Å²	141	126 Å²	126	87%	0.865	71%	0.712	S	S	*	*			trans	-53.7	110.1	178.7	-28.5	0	0	0	0	107.6	L3 G7	L3-T5 PolarHBondContact O-N 3.32Å; T5-G7 PolarHBondContact O-N 3.11Å
6	I	71.5	Confident	75.5	Confident	157 Å²	157	124.6 Å²	124.6	81%	0.805	70%	0.697	S	S	*	*			trans	-60.6	108.9	167.2	-61.5	173	0	0	0	103.6	G4 Q8	G4-I6 PolarHBondContact O-N 3.47Å; I6-Q8 PolarHBondContact O-N 2.92Å
7	G	70.1	Confident	76.7	Confident	58 Å²	58	128.2 Å²	128.2	60%	0.598	70%	0.698	S	S	*	*	P	Polyproline II helix	trans	-50.6	129.6	178.6	0	0	0	0	0	108.2	T5	T5-G7 PolarHBondContact O-N 3.11Å
8	Q	70.1	Confident	77.8	Confident	178 Å²	178	127.2 Å²	127.2	83%	0.832	69%	0.686	S	S	*	*	P	Polyproline II helix	trans	-55.2	124.7	173	-68.6	179.9	-13.3	0	0	106.6	I6 E10	I6-Q8 PolarHBondContact O-N 2.92Å; Q8-E10 PolarHBondContact O-N 2.92Å
9	P	67.9	Low	78.8	Confident	123 Å²	123	126.5 Å²	126.5	80%	0.799	68%	0.681	S	S	*	*	P	Polyproline II helix	trans	-60.4	117.2	179.7	23.6	-31.1	0	0	0	107.5	A11	P9-A11 PolarHBondContact O-N 3.22Å
10	E	75.6	Confident	79.6	Confident	175 Å²	175	127.4 Å²	127.4	82%	0.818	67%	0.674	S	S	*	*	P	Polyproline II helix	trans	-58.9	136.9	175.7	-66.8	-177.4	175.7	0	0	108.5	Q8 V12	Q8-E10 PolarHBondContact O-N 2.92Å; E10-V12 WeakPolarHBondContact O-CG2 2.92Å; E10-V12 PolarHBondContact O-N 3Å
11	A	79.8	Confident	80.2	Confident	43 Å²	43	125.6 Å²	125.6	36%	0.355	67%	0.668	S	S	.	*			trans	-63.7	105.1	176.5	0	0	0	0	0	109.4	P9 R41 P42	P9-A11 PolarHBondContact O-N 3.22Å; A11-R41 HydrophobicContact CB-CG 4.32Å; A11-P42 WeakPolarHBondContact CB-O 3.4Å; A11-P42 VanDerWaalsContact CB-O 3.24Å
12	V	82.8	Confident	82.1	Confident	99 Å²	99	116.7 Å²	116.7	60%	0.6	63%	0.628	S	S	*	*			trans	-90.5	132.5	178.4	-179.1	0	0	0	0	109.9	E10 P42	E10-V12 WeakPolarHBondContact O-CG2 2.92Å; E10-V12 PolarHBondContact O-N 3Å; V12-P42 WeakPolarHBondContact O-CD 3.36Å; V12-P42 WeakPolarHBondContact O-CG 3.27Å
13	D	89.3	Confident	83.4	Confident	123 Å²	123	111.6 Å²	111.6	66%	0.658	62%	0.615	S	S	*	*			trans	-66.5	134.6	171.8	-67.5	-38.6	0	0	0	111	R41	D13-R41 WeakPolarHBondContact OD1-CD 3.4Å; D13-R41 WeakPolarHBondContact OD1-CG 3.34Å; D13-R41 IonicContact OD1-NE 3.97Å
14	I	90.4	Very high	84.3	Confident	69 Å²	69	109.5 Å²	109.5	35%	0.354	61%	0.608	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-119.7	133.2	-178.1	-58.8	173.2	0	0	0	109.6	H16 R39 G40 P42	I14-H16 WeakPolarHBondContact CG2-CD2 3.44Å; I14-H16 WeakPolarHBondContact CG2-NE2 3.24Å; I14-R39 WeakPolarHBondContact O-CA 3.36Å; I14-G40 PolarHBondContact N-O 3.36Å; I14-G40 PolarHBondContact O-N 2.99Å; I14-P42 HydrophobicContact CD1-CG 4.08Å
15	E	95.5	Very high	84.7	Confident	103 Å²	103	111.2 Å²	111.2	48%	0.481	61%	0.608	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-123.3	124.9	171	-179	169.5	-143.6	0	0	110	R17 R39	E15-R17 HydrophobicContact CG-CG 4.36Å; E15-R39 IonicContact OE1-NH2 3.58Å; E15-R39 PolarHBondContact OE1-NH2 2.87Å; E15-R39 VanDerWaalsContact OE1-NE 3.1Å; E15-R39 PolarHBondContact OE1-NE 2.98Å; E15-R39 IonicContact OE1-NE 3.1Å; E15-R39 IonicContact OE1-CZ 3.45Å; E15-R39 HydrophobicContact CG-CG 4.24Å; E15-R39 HydrophobicContact CB-CG 4.46Å
16	H	93.1	Very high	85.6	Confident	104 Å²	104	112 Å²	112	48%	0.481	60%	0.6	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-120.7	136.4	172.9	-67	-74	0	0	0	110	I14 F18 S37 I38	I14-H16 WeakPolarHBondContact CG2-CD2 3.44Å; I14-H16 WeakPolarHBondContact CG2-NE2 3.24Å; H16-F18 HydrophobicContact CB-CE2 3.94Å; H16-F18 HydrophobicContact CB-CZ 4.22Å; H16-S37 WeakPolarHBondContact O-CA 3.47Å; H16-I38 HydrophobicContact CB-CB 4.48Å; H16-I38 PolarHBondContact N-O 2.8Å; H16-I38 PolarHBondContact O-N 2.89Å
17	R	95.8	Very high	86.3	Confident	186 Å²	186	108.6 Å²	108.6	70%	0.702	60%	0.595	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-124.7	121.4	178.9	-60.1	178.6	76.6	-179.1	3.7	109	E15	E15-R17 HydrophobicContact CG-CG 4.36Å
18	F	96.5	Very high	87.2	Confident	110 Å²	110	110 Å²	110	48%	0.482	61%	0.61	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-105.1	133.6	176.7	-56	-89.5	0	0	0	109.2	H16 L36 I38	H16-F18 HydrophobicContact CB-CE2 3.94Å; H16-F18 HydrophobicContact CB-CZ 4.22Å; F18-L36 PolarHBondContact O-N 2.89Å; F18-L36 PolarHBondContact N-O 2.8Å; F18-L36 HydrophobicContact CD2-CD2 4.27Å; F18-L36 HydrophobicContact CB-CB 4.3Å; F18-L36 HydrophobicContact CD2-CG 4.36Å; F18-I38 HydrophobicContact CD2-CD1 4.32Å; F18-I38 HydrophobicContact CD2-CG1 4.39Å; F18-I38 HydrophobicContact CE2-CD1 3.59Å; F18-I38 HydrophobicContact CE2-CG1 3.93Å; F18-I38 HydrophobicContact CZ-CD1 4.39Å
19	L	96.2	Very high	88.1	Confident	114 Å²	114	110.9 Å²	110.9	60%	0.597	61%	0.605	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-115.5	119.2	172.5	175.8	67	0	0	0	107.4	V21 I33 L35	L19-V21 HydrophobicContact CD2-CG2 4.4Å; L19-V21 HydrophobicContact CG-CG2 4.21Å; L19-I33 HydrophobicContact CD1-CG2 3.54Å; L19-L35 HydrophobicContact CB-CD2 4.48Å; L19-L35 HydrophobicContact CD1-CD2 3.64Å; L19-L35 HydrophobicContact CD1-CG 4.3Å
20	R	94.4	Very high	89.3	Confident	144 Å²	144	110.4 Å²	110.4	54%	0.543	61%	0.605	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-106.9	123	169.9	-177	171.5	77.4	178.1	4.3	108.6	E34	R20-E34 PolarHBondContact O-N 3.43Å; R20-E34 PolarHBondContact NH2-OE2 2.95Å; R20-E34 IonicContact NH2-OE2 2.77Å; R20-E34 PolarHBondContact NH2-OE1 3Å; R20-E34 IonicContact NH2-OE1 3.8Å; R20-E34 IonicContact NE-OE2 2.8Å; R20-E34 IonicContact NE-OE1 2.89Å; R20-E34 PolarHBondContact N-O 2.8Å; R20-E34 IonicContact CZ-OE2 3.16Å; R20-E34 IonicContact CZ-OE1 2.68Å; R20-E34 HydrophobicContact CB-CB 4.32Å; R20-E34 PolarHBondContact NE-OE1 2.68Å
21	V	93.5	Very high	90.1	Very high	90 Å²	90	103.9 Å²	103.9	55%	0.545	58%	0.581	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-109.9	123.2	169.3	-176.7	0	0	0	0	107.3	L19 S32	L19-V21 HydrophobicContact CD2-CG2 4.4Å; L19-V21 HydrophobicContact CG-CG2 4.21Å; V21-S32 WeakPolarHBondContact CA-O 3.36Å
22	S	93.1	Very high	90.8	Very high	46 Å²	46	104.4 Å²	104.4	32%	0.322	58%	0.582	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-125.2	144.7	177.8	-54.4	0	0	0	0	110.8	A31 S32	S22-A31 CarbonylContact O-C 3.52Å; S22-A31 WeakPolarHBondContact O-CA 3.44Å; S22-S32 PolarHBondContact N-O 2.99Å; S22-S32 PolarHBondContact O-N 2.84Å
23	G	91.5	Very high	91.4	Very high	57 Å²	57	105.5 Å²	105.5	59%	0.588	58%	0.583	S	S	*	*	S	Bend	trans	89.3	156.4	-177	0	0	0	0	0	113.3
24	V	85	Confident	91.6	Very high	117 Å²	117	103.4 Å²	103.4	71%	0.709	57%	0.569	S	S	*	*			trans	-110.1	120.5	175.1	179.9	0	0	0	0	106.8	F26	V24-F26 PolarHBondContact O-N 2.83Å
25	P	76.7	Confident	92	Very high	99 Å²	99	106.2 Å²	106.2	64%	0.643	58%	0.584	S	S	*	*			trans	-69.2	104.8	178.2	28	-31.1	0	0	0	109.1	R29	P25-R29 WeakPolarHBondContact CA-O 3.44Å
26	F	89.4	Confident	92	Very high	158 Å²	158	106.2 Å²	106.2	69%	0.693	59%	0.587	S	S	*	*			trans	-145.1	139.9	178.8	-175.9	-98.6	0	0	0	110.7	V24 G28 R29	V24-F26 PolarHBondContact O-N 2.83Å; F26-G28 PolarHBondContact O-N 2.86Å; F26-R29 VanDerWaalsContact O-CB 3.27Å; F26-R29 WeakPolarHBondContact O-CB 3.44Å; F26-R29 WeakPolarHBondContact O-CG 3.1Å; F26-R29 PolarHBondContact O-N 3.1Å
27	A	86.5	Confident	92.1	Very high	85 Å²	85	104.5 Å²	104.5	70%	0.702	59%	0.587	S	S	*	*	T	Hydrogen-bonded Turn	trans	46.1	51.8	174.9	0	0	0	0	0	114.5	R29	A27-R29 VanDerWaalsContact C-N 3.28Å; A27-R29 PolarHBondContact O-N 2.77Å
28	G	88.7	Confident	92.1	Very high	87 Å²	87	99.5 Å²	99.5	90%	0.897	57%	0.573	S	S	*	*	T	Hydrogen-bonded Turn	trans	76.7	7.1	178.4	0	0	0	0	0	115.3	F26	F26-G28 PolarHBondContact O-N 2.86Å
29	R	89	Confident	92	Very high	197 Å²	197	103.3 Å²	103.3	74%	0.743	58%	0.584	S	S	*	*	P	Polyproline II helix	trans	-87.1	134.6	170.7	-59.8	-176	177	-160.6	-1.2	110.7	P25 F26 A27	P25-R29 WeakPolarHBondContact CA-O 3.44Å; F26-R29 VanDerWaalsContact O-CB 3.27Å; F26-R29 WeakPolarHBondContact O-CB 3.44Å; F26-R29 WeakPolarHBondContact O-CG 3.1Å; F26-R29 PolarHBondContact O-N 3.1Å; A27-R29 VanDerWaalsContact C-N 3.28Å; A27-R29 PolarHBondContact O-N 2.77Å
30	S	92.4	Very high	91.8	Very high	113 Å²	113	99.8 Å²	99.8	79%	0.79	58%	0.576	S	S	*	*	P	Polyproline II helix	trans	-83.3	143.8	173.4	-57.7	0	0	0	0	111.1
31	A	92.5	Very high	91.5	Very high	37 Å²	37	100.8 Å²	100.8	31%	0.306	58%	0.579	S	S	.	*	P	Polyproline II helix	trans	-77.8	151.9	156.7	0	0	0	0	0	109.3	S22	S22-A31 CarbonylContact O-C 3.52Å; S22-A31 WeakPolarHBondContact O-CA 3.44Å
32	S	94.7	Very high	90.7	Very high	54 Å²	54	99.6 Å²	99.6	38%	0.378	57%	0.573	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-97.3	143.9	170.6	68.3	0	0	0	0	110.5	V21 S22	V21-S32 WeakPolarHBondContact CA-O 3.36Å; S22-S32 PolarHBondContact N-O 2.99Å; S22-S32 PolarHBondContact O-N 2.84Å
33	I	95	Very high	89.8	Confident	122 Å²	122	103.5 Å²	103.5	63%	0.626	60%	0.595	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-120.2	127.4	173.3	-61.6	176.2	0	0	0	107.4	L19	L19-I33 HydrophobicContact CD1-CG2 3.54Å
34	E	94.1	Very high	88.5	Confident	79 Å²	79	107.8 Å²	107.8	37%	0.369	64%	0.64	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-127.9	136.3	178.2	-64.5	168.3	-88.5	0	0	109.5	R20	R20-E34 PolarHBondContact O-N 3.43Å; R20-E34 PolarHBondContact NH2-OE2 2.95Å; R20-E34 IonicContact NH2-OE2 2.77Å; R20-E34 PolarHBondContact NH2-OE1 3Å; R20-E34 IonicContact NH2-OE1 3.8Å; R20-E34 IonicContact NE-OE2 2.8Å; R20-E34 IonicContact NE-OE1 2.89Å; R20-E34 PolarHBondContact N-O 2.8Å; R20-E34 IonicContact CZ-OE2 3.16Å; R20-E34 IonicContact CZ-OE1 2.68Å; R20-E34 HydrophobicContact CB-CB 4.32Å; R20-E34 PolarHBondContact NE-OE1 2.68Å
35	L	97.3	Very high	88.6	Confident	128 Å²	128	107.3 Å²	107.3	67%	0.67	64%	0.636	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-119.7	129.2	-176.7	-71.3	163.3	0	0	0	109.1	L19	L19-L35 HydrophobicContact CB-CD2 4.48Å; L19-L35 HydrophobicContact CD1-CD2 3.64Å; L19-L35 HydrophobicContact CD1-CG 4.3Å
36	L	96.2	Very high	89.3	Confident	103 Å²	103	107.7 Å²	107.7	54%	0.539	64%	0.636	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-126.2	124.5	172.1	174.6	67	0	0	0	109	F18 I38	F18-L36 PolarHBondContact O-N 2.89Å; F18-L36 PolarHBondContact N-O 2.8Å; F18-L36 HydrophobicContact CD2-CD2 4.27Å; F18-L36 HydrophobicContact CB-CB 4.3Å; F18-L36 HydrophobicContact CD2-CG 4.36Å; L36-I38 HydrophobicContact CD2-CD1 4.44Å; L36-I38 HydrophobicContact CD2-CG1 4.49Å; L36-I38 HydrophobicContact CG-CG1 4.32Å
37	S	96.1	Very high	89.2	Confident	68 Å²	68	104.9 Å²	104.9	48%	0.476	63%	0.632	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-110.4	128.4	174.4	-61.3	0	0	0	0	109.4	H16	H16-S37 WeakPolarHBondContact O-CA 3.47Å
38	I	95	Very high	89.4	Confident	82 Å²	82	106.1 Å²	106.1	42%	0.421	63%	0.628	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-114	128.9	173.8	-55.7	-175.6	0	0	0	107.6	H16 F18 L36	H16-I38 HydrophobicContact CB-CB 4.48Å; H16-I38 PolarHBondContact N-O 2.8Å; H16-I38 PolarHBondContact O-N 2.89Å; F18-I38 HydrophobicContact CD2-CD1 4.32Å; F18-I38 HydrophobicContact CD2-CG1 4.39Å; F18-I38 HydrophobicContact CE2-CD1 3.59Å; F18-I38 HydrophobicContact CE2-CG1 3.93Å; F18-I38 HydrophobicContact CZ-CD1 4.39Å; L36-I38 HydrophobicContact CD2-CD1 4.44Å; L36-I38 HydrophobicContact CD2-CG1 4.49Å; L36-I38 HydrophobicContact CG-CG1 4.32Å
39	R	94.6	Very high	89.4	Confident	190 Å²	190	107.3 Å²	107.3	72%	0.717	61%	0.612	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-121.3	135.1	171.4	-67.4	179.3	179.7	174.1	-3.1	108.1	I14 E15	I14-R39 WeakPolarHBondContact O-CA 3.36Å; E15-R39 IonicContact OE1-NH2 3.58Å; E15-R39 PolarHBondContact OE1-NH2 2.87Å; E15-R39 VanDerWaalsContact OE1-NE 3.1Å; E15-R39 PolarHBondContact OE1-NE 2.98Å; E15-R39 IonicContact OE1-NE 3.1Å; E15-R39 IonicContact OE1-CZ 3.45Å; E15-R39 HydrophobicContact CG-CG 4.24Å; E15-R39 HydrophobicContact CB-CG 4.46Å
40	G	91.1	Very high	89.5	Confident	40 Å²	40	101.3 Å²	101.3	41%	0.412	60%	0.603	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-147.6	144.3	179.8	0	0	0	0	0	109.9	I14	I14-G40 PolarHBondContact N-O 3.36Å; I14-G40 PolarHBondContact O-N 2.99Å
41	R	88.7	Confident	89.3	Confident	165 Å²	165	100.5 Å²	100.5	62%	0.623	59%	0.589	S	S	*	*			trans	-110.4	111.1	164.5	-173	173.7	-174.6	-177.4	2.7	106.2	A11 D13 T43	A11-R41 HydrophobicContact CB-CG 4.32Å; D13-R41 WeakPolarHBondContact OD1-CD 3.4Å; D13-R41 WeakPolarHBondContact OD1-CG 3.34Å; D13-R41 IonicContact OD1-NE 3.97Å; R41-T43 PolarHBondContact O-N 2.99Å
42	P	76.2	Confident	89	Confident	64 Å²	64	105.4 Å²	105.4	42%	0.416	61%	0.611	S	S	.	*			trans	-61.8	109.5	173.9	25.5	-26.4	0	0	0	107.3	A11 V12 I14 G44	A11-P42 WeakPolarHBondContact CB-O 3.4Å; A11-P42 VanDerWaalsContact CB-O 3.24Å; V12-P42 WeakPolarHBondContact O-CD 3.36Å; V12-P42 WeakPolarHBondContact O-CG 3.27Å; I14-P42 HydrophobicContact CD1-CG 4.08Å; P42-G44 PolarHBondContact O-N 3.27Å
43	T	75.6	Confident	88.5	Confident	128 Å²	128	109.7 Å²	109.7	79%	0.785	63%	0.631	S	S	*	*			trans	-77.3	117.1	166.4	53.9	0	0	0	0	106.4	R41	R41-T43 PolarHBondContact O-N 2.99Å
44	G	62.7	Low	88	Confident	147 Å²	147	108.5 Å²	108.5	100%	1.515	63%	0.631	S	S	*	*			trans	-44.7	0	-172.9	0	0	0	0	0	115.6	P42	P42-G44 PolarHBondContact O-N 3.27Å

Retrieved 44 of 44 residues in 55 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).