A0A077Z6X6_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077Z6X6, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 36 aa.

						>A0A077Z6X6_TRITR|A0A077Z6X6
MAPDFDGHLANYLDDHLRLSNGHSISPRKCLGKNWR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.1	Very low	71.3	Confident	242 Å²	242	111.4 Å²	111.4	100%	1.192	63%	0.627	S	S	*	*				0	101	0	-164	148	142.1	0	0	105.8
2	A	60.8	Low	72.3	Confident	89 Å²	89	112.5 Å²	112.5	74%	0.736	62%	0.616	S	S	*	*			trans	-62.3	137.5	172	0	0	0	0	0	106.8	D4	A2-D4 PolarHBondContact O-N 3.35Å
3	P	61.5	Low	72.9	Confident	114 Å²	114	111.4 Å²	111.4	74%	0.74	61%	0.608	S	S	*	*			trans	-52.3	142.3	166.7	24.6	-32.1	0	0	0	107.6	F5	P3-F5 PolarHBondContact O-N 2.91Å
4	D	64.4	Low	73.8	Confident	122 Å²	122	110.1 Å²	110.1	65%	0.652	60%	0.6	S	S	*	*			trans	-65.2	81.4	178.9	-162.2	-33.6	0	0	0	108.9	A2 D6 G7 H8	A2-D4 PolarHBondContact O-N 3.35Å; D4-D6 PolarHBondContact O-N 2.81Å; D4-G7 PolarHBondContact OD1-N 3.47Å; D4-H8 PolarHBondContact O-N 3.2Å
5	F	67.7	Low	74.3	Confident	139 Å²	139	109.1 Å²	109.1	61%	0.61	59%	0.594	S	S	*	*	H	α-helix	trans	-65.7	-36.4	-176.7	179.5	-96.2	0	0	0	109.4	P3 H8 L9	P3-F5 PolarHBondContact O-N 2.91Å; F5-H8 PolarHBondContact O-N 2.7Å; F5-L9 HydrophobicContact CE1-CD2 4.09Å; F5-L9 WeakPolarHBondContact O-CB 3.35Å; F5-L9 PolarHBondContact O-N 3.23Å
6	D	74.4	Confident	74.1	Confident	121 Å²	121	107.7 Å²	107.7	65%	0.647	58%	0.582	S	S	*	*	H	α-helix	trans	-68.8	-41.1	-179	-62.8	-35.8	0	0	0	111.4	D4 L9 A10	D4-D6 PolarHBondContact O-N 2.81Å; D6-L9 PolarHBondContact O-N 2.85Å; D6-A10 PolarHBondContact O-N 2.9Å; D6-A10 WeakPolarHBondContact O-CB 3.23Å
7	G	82.7	Confident	74	Confident	28 Å²	28	107 Å²	107	29%	0.289	58%	0.577	S	S	.	*	H	α-helix	trans	-65.9	-41.1	175.2	0	0	0	0	0	113.1	D4 N11	D4-G7 PolarHBondContact OD1-N 3.47Å; G7-N11 PolarHBondContact O-N 3.42Å; G7-N11 PolarHBondContact O-ND2 2.88Å
8	H	80.9	Confident	74	Confident	140 Å²	140	112.1 Å²	112.1	65%	0.648	59%	0.587	S	S	*	*	H	α-helix	trans	-68.3	-41.3	176.1	-175.8	-105.7	0	0	0	111.8	D4 F5 Y12	D4-H8 PolarHBondContact O-N 3.2Å; F5-H8 PolarHBondContact O-N 2.7Å; H8-Y12 VanDerWaalsContact O-CB 3.31Å; H8-Y12 WeakPolarHBondContact O-CB 3.31Å; H8-Y12 PolarHBondContact O-N 2.75Å
9	L	82.7	Confident	73.8	Confident	68 Å²	68	112.7 Å²	112.7	36%	0.356	59%	0.59	S	S	.	*	H	α-helix	trans	-65.4	-42.3	176.2	-179.6	61.3	0	0	0	111.5	F5 D6 Y12 L13	F5-L9 HydrophobicContact CE1-CD2 4.09Å; F5-L9 WeakPolarHBondContact O-CB 3.35Å; F5-L9 PolarHBondContact O-N 3.23Å; D6-L9 PolarHBondContact O-N 2.85Å; L9-Y12 PolarHBondContact O-N 3.34Å; L9-L13 HydrophobicContact CG-CG 4.39Å; L9-L13 PolarHBondContact O-N 2.79Å; L9-L13 WeakPolarHBondContact O-CG 3.11Å; L9-L13 VanDerWaalsContact O-CG 3.28Å; L9-L13 WeakPolarHBondContact O-CB 3.45Å; L9-L13 HydrophobicContact CG-CD1 3.99Å; L9-L13 HydrophobicContact CD1-CG 4.06Å; L9-L13 HydrophobicContact CD1-CD1 4.05Å
10	A	85.8	Confident	73.3	Confident	56 Å²	56	109.6 Å²	109.6	46%	0.463	58%	0.578	S	S	.	*	H	α-helix	trans	-61.8	-46.9	177.6	0	0	0	0	0	111.6	D6 L13 D14	D6-A10 PolarHBondContact O-N 2.9Å; D6-A10 WeakPolarHBondContact O-CB 3.23Å; A10-L13 PolarHBondContact O-N 3.25Å; A10-D14 WeakPolarHBondContact O-CB 3.15Å; A10-D14 PolarHBondContact O-N 2.96Å
11	N	81.1	Confident	72.7	Confident	106 Å²	106	110.3 Å²	110.3	57%	0.567	58%	0.583	S	S	*	*	H	α-helix	trans	-63.2	-44.4	175.8	-78.5	-33	0	0	0	112	G7 L13 D14 D15	G7-N11 PolarHBondContact O-N 3.42Å; G7-N11 PolarHBondContact O-ND2 2.88Å; N11-L13 PolarHBondContact O-N 3.46Å; N11-D14 PolarHBondContact O-N 2.78Å; N11-D15 WeakPolarHBondContact O-CB 3.5Å; N11-D15 PolarHBondContact O-N 3.44Å
12	Y	83.7	Confident	73.7	Confident	125 Å²	125	102.2 Å²	102.2	49%	0.49	56%	0.561	S	S	.	*	H	α-helix	trans	-58.6	-47.6	176.2	179.8	-95.5	0	0	0	111.3	H8 L9 H16	H8-Y12 VanDerWaalsContact O-CB 3.31Å; H8-Y12 WeakPolarHBondContact O-CB 3.31Å; H8-Y12 PolarHBondContact O-N 2.75Å; L9-Y12 PolarHBondContact O-N 3.34Å; Y12-H16 AromaticContact CE2-NE2 3.01Å; Y12-H16 WeakPolarHBondContact CE2-NE2 3.38Å; Y12-H16 AromaticContact CG-CD2 3.78Å; Y12-H16 AromaticContact CZ-CD2 3.26Å; Y12-H16 WeakPolarHBondContact O-CB 3.42Å; Y12-H16 PolarHBondContact O-CD2 2.87Å; Y12-H16 PolarHBondContact O-N 2.9Å; Y12-H16 PolarHBondContact OH-NE2 3.27Å; Y12-H16 AromaticContact CZ-NE2 3.06Å; Y12-H16 VanDerWaalsContact CE2-CD2 3.4Å; Y12-H16 WeakPolarHBondContact CE2-CD2 3.21Å; Y12-H16 AromaticContact CD1-CD2 3.66Å; Y12-H16 AromaticContact CD2-CD2 3.64Å; Y12-H16 AromaticContact CD2-NE2 3.65Å; Y12-H16 WeakPolarHBondContact CE1-CD2 3.4Å; Y12-H16 AromaticContact CE1-NE2 3.75Å; Y12-H16 AromaticContact CE2-CD2 3.4Å; Y12-H16 AromaticContact CE1-CD2 3.4Å
13	L	80.4	Confident	73.8	Confident	98 Å²	98	104.7 Å²	104.7	51%	0.513	56%	0.557	S	S	.	*	H	α-helix	trans	-65.8	-38.5	178.1	-70.6	176.3	0	0	0	112.4	L9 A10 N11 H16 L17	L9-L13 HydrophobicContact CG-CG 4.39Å; L9-L13 PolarHBondContact O-N 2.79Å; L9-L13 WeakPolarHBondContact O-CG 3.11Å; L9-L13 VanDerWaalsContact O-CG 3.28Å; L9-L13 WeakPolarHBondContact O-CB 3.45Å; L9-L13 HydrophobicContact CG-CD1 3.99Å; L9-L13 HydrophobicContact CD1-CG 4.06Å; L9-L13 HydrophobicContact CD1-CD1 4.05Å; A10-L13 PolarHBondContact O-N 3.25Å; N11-L13 PolarHBondContact O-N 3.46Å; L13-H16 PolarHBondContact O-N 2.8Å; L13-L17 WeakPolarHBondContact O-CB 3.18Å; L13-L17 PolarHBondContact O-N 3.44Å
14	D	85.6	Confident	73.7	Confident	93 Å²	93	104.8 Å²	104.8	50%	0.497	56%	0.561	S	S	.	*	H	α-helix	trans	-66.4	-44.7	176.4	-172.8	-105.4	0	0	0	111.9	A10 N11 H16 L17 R18	A10-D14 WeakPolarHBondContact O-CB 3.15Å; A10-D14 PolarHBondContact O-N 2.96Å; N11-D14 PolarHBondContact O-N 2.78Å; D14-H16 VanDerWaalsContact C-N 3.34Å; D14-H16 PolarHBondContact O-N 2.86Å; D14-L17 PolarHBondContact O-N 3.38Å; D14-R18 VanDerWaalsContact O-CB 3.23Å; D14-R18 PolarHBondContact O-N 2.86Å; D14-R18 WeakPolarHBondContact O-CB 3.4Å
15	D	81.1	Confident	73.6	Confident	95 Å²	95	103.2 Å²	103.2	51%	0.508	55%	0.551	S	S	.	*	H	α-helix	trans	-59.2	-46.3	174	-81.5	-43	0	0	0	110.7	N11 R18 L19	N11-D15 WeakPolarHBondContact O-CB 3.5Å; N11-D15 PolarHBondContact O-N 3.44Å; D15-R18 PolarHBondContact O-N 3.06Å; D15-L19 VanDerWaalsContact O-CB 3.31Å; D15-L19 WeakPolarHBondContact O-CB 3.31Å; D15-L19 WeakPolarHBondContact O-CD1 3.18Å; D15-L19 WeakPolarHBondContact O-CG 3.4Å; D15-L19 PolarHBondContact O-N 2.95Å
16	H	70.9	Confident	73.2	Confident	87 Å²	87	100.9 Å²	100.9	40%	0.403	55%	0.552	S	S	.	*	H	α-helix	trans	-68.5	-34.9	178	-81.2	-67.8	0	0	0	113.2	Y12 L13 D14 S20	Y12-H16 AromaticContact CE2-NE2 3.01Å; Y12-H16 WeakPolarHBondContact CE2-NE2 3.38Å; Y12-H16 AromaticContact CG-CD2 3.78Å; Y12-H16 AromaticContact CZ-CD2 3.26Å; Y12-H16 WeakPolarHBondContact O-CB 3.42Å; Y12-H16 PolarHBondContact O-CD2 2.87Å; Y12-H16 PolarHBondContact O-N 2.9Å; Y12-H16 PolarHBondContact OH-NE2 3.27Å; Y12-H16 AromaticContact CZ-NE2 3.06Å; Y12-H16 VanDerWaalsContact CE2-CD2 3.4Å; Y12-H16 WeakPolarHBondContact CE2-CD2 3.21Å; Y12-H16 AromaticContact CD1-CD2 3.66Å; Y12-H16 AromaticContact CD2-CD2 3.64Å; Y12-H16 AromaticContact CD2-NE2 3.65Å; Y12-H16 WeakPolarHBondContact CE1-CD2 3.4Å; Y12-H16 AromaticContact CE1-NE2 3.75Å; Y12-H16 AromaticContact CE2-CD2 3.4Å; Y12-H16 AromaticContact CE1-CD2 3.4Å; L13-H16 PolarHBondContact O-N 2.8Å; D14-H16 VanDerWaalsContact C-N 3.34Å; D14-H16 PolarHBondContact O-N 2.86Å; H16-S20 PolarHBondContact O-N 3.38Å; H16-S20 WeakPolarHBondContact O-CB 3.28Å
17	L	72.9	Confident	72.6	Confident	96 Å²	96	101.5 Å²	101.5	50%	0.503	56%	0.563	S	S	.	*	H	α-helix	trans	-70	-42.4	175.4	-175	67.3	0	0	0	110.7	L13 D14 L19 S20 N21	L13-L17 WeakPolarHBondContact O-CB 3.18Å; L13-L17 PolarHBondContact O-N 3.44Å; D14-L17 PolarHBondContact O-N 3.38Å; L17-L19 VanDerWaalsContact C-N 3.35Å; L17-S20 CarbonylContact O-C 3.55Å; L17-S20 PolarHBondContact O-N 3.28Å; L17-N21 WeakPolarHBondContact O-CB 3.01Å; L17-N21 PolarHBondContact O-N 2.84Å
18	R	73.4	Confident	71.8	Confident	198 Å²	198	110.1 Å²	110.1	75%	0.747	59%	0.587	S	S	*	*	H	α-helix	trans	-64.3	-40.3	175.9	-177.7	179.1	159.4	97.7	1.6	111.4	D14 D15	D14-R18 VanDerWaalsContact O-CB 3.23Å; D14-R18 PolarHBondContact O-N 2.86Å; D14-R18 WeakPolarHBondContact O-CB 3.4Å; D15-R18 PolarHBondContact O-N 3.06Å
19	L	69.4	Low	70.9	Confident	124 Å²	124	112.7 Å²	112.7	65%	0.649	60%	0.596	S	S	*	*	H	α-helix	trans	-67.7	-36.5	173.6	-69.3	171.8	0	0	0	112	D15 L17	D15-L19 VanDerWaalsContact O-CB 3.31Å; D15-L19 WeakPolarHBondContact O-CB 3.31Å; D15-L19 WeakPolarHBondContact O-CD1 3.18Å; D15-L19 WeakPolarHBondContact O-CG 3.4Å; D15-L19 PolarHBondContact O-N 2.95Å; L17-L19 VanDerWaalsContact C-N 3.35Å
20	S	64	Low	70	Confident	50 Å²	50	115.4 Å²	115.4	35%	0.35	62%	0.619	S	S	.	*	H	α-helix	trans	-79.9	-31.1	178.7	-171	0	0	0	0	113.4	H16 L17 G22 H23	H16-S20 PolarHBondContact O-N 3.38Å; H16-S20 WeakPolarHBondContact O-CB 3.28Å; L17-S20 CarbonylContact O-C 3.55Å; L17-S20 PolarHBondContact O-N 3.28Å; S20-G22 PolarHBondContact O-N 3.14Å; S20-H23 WeakPolarHBondContact O-CA 3.38Å; S20-H23 WeakPolarHBondContact O-CB 3.21Å; S20-H23 PolarHBondContact O-N 3.34Å
21	N	61.4	Low	69.1	Low	126 Å²	126	120.4 Å²	120.4	67%	0.674	64%	0.637	S	S	*	*	H	α-helix	trans	-70.8	-19.9	-179.3	-95.2	19.9	0	0	0	112.4	L17 H23	L17-N21 WeakPolarHBondContact O-CB 3.01Å; L17-N21 PolarHBondContact O-N 2.84Å; N21-H23 PolarHBondContact O-N 3.06Å
22	G	63.1	Low	68.4	Low	72 Å²	72	118.1 Å²	118.1	74%	0.742	64%	0.639	S	S	*	*	T	Hydrogen-bonded Turn	trans	-70.8	-15.3	166.7	0	0	0	0	0	113.4	S20	S20-G22 PolarHBondContact O-N 3.14Å
23	H	61.9	Low	67.8	Low	140 Å²	140	121.9 Å²	121.9	65%	0.648	66%	0.658	S	S	*	*	S	Bend	trans	-96.6	114.1	175	-95.2	91.5	0	0	0	110	S20 N21 I25	S20-H23 WeakPolarHBondContact O-CA 3.38Å; S20-H23 WeakPolarHBondContact O-CB 3.21Å; S20-H23 PolarHBondContact O-N 3.34Å; N21-H23 PolarHBondContact O-N 3.06Å; H23-I25 PolarHBondContact O-N 3.47Å; H23-I25 HydrophobicContact CB-CG1 4.17Å
24	S	60.7	Low	67.1	Low	117 Å²	117	124.1 Å²	124.1	82%	0.818	67%	0.67	S	S	*	*			trans	-62.7	91.1	160.8	-176.6	0	0	0	0	108.3	S26	S24-S26 PolarHBondContact O-N 2.89Å
25	I	62.1	Low	65.6	Low	89 Å²	89	131.5 Å²	131.5	46%	0.456	69%	0.691	S	S	.	*			trans	-79.8	102.3	172.8	-62.5	170.5	0	0	0	105.6	H23 R28	H23-I25 PolarHBondContact O-N 3.47Å; H23-I25 HydrophobicContact CB-CG1 4.17Å; I25-R28 HydrophobicContact CG2-CG 4.31Å
26	S	59.1	Low	64.5	Low	90 Å²	90	141.6 Å²	141.6	63%	0.629	72%	0.722	S	S	*	*			trans	-50.8	136.3	161.5	-50.6	0	0	0	0	108	S24 R28	S24-S26 PolarHBondContact O-N 2.89Å; S26-R28 PolarHBondContact O-N 3.25Å
27	P	62.8	Low	64.2	Low	133 Å²	133	144.4 Å²	144.4	86%	0.864	74%	0.738	S	S	*	*			trans	-54.4	101.4	-173.8	20.8	-32.3	0	0	0	109.5	K29	P27-K29 PolarHBondContact O-N 3.05Å
28	R	64.5	Low	63.7	Low	210 Å²	210	146.9 Å²	146.9	79%	0.792	75%	0.75	S	S	*	*			trans	-72.1	125.2	172.6	-64.8	-173.6	-163.7	-174.1	6.9	105	I25 S26 C30	I25-R28 HydrophobicContact CG2-CG 4.31Å; S26-R28 PolarHBondContact O-N 3.25Å; R28-C30 PolarHBondContact O-N 3.24Å
29	K	62.4	Low	63.2	Low	194 Å²	194	144.1 Å²	144.1	84%	0.843	75%	0.751	S	S	*	*			trans	-49.6	111.8	166.8	-74	-175.3	177.9	-178.8	0	106.3	P27 L31	P27-K29 PolarHBondContact O-N 3.05Å; K29-L31 PolarHBondContact O-N 2.81Å
30	C	64.6	Low	62.8	Low	125 Å²	125	145.2 Å²	145.2	85%	0.845	76%	0.757	S	S	*	*			trans	-61.4	106.2	174.3	-171.4	0	0	0	0	105.5	R28 G32	R28-C30 PolarHBondContact O-N 3.24Å; C30-G32 PolarHBondContact O-N 3.47Å
31	L	66.9	Low	62.8	Low	161 Å²	161	151.2 Å²	151.2	84%	0.843	78%	0.782	S	S	*	*			trans	-71.8	76.8	169.8	-75.9	168.4	0	0	0	105.8	K29 K33	K29-L31 PolarHBondContact O-N 2.81Å; L31-K33 PolarHBondContact O-N 2.67Å
32	G	66.1	Low	62.9	Low	58 Å²	58	152.9 Å²	152.9	60%	0.598	79%	0.789	S	S	*	*			trans	-61.2	94.4	165.8	0	0	0	0	0	107	C30 N34	C30-G32 PolarHBondContact O-N 3.47Å; G32-N34 PolarHBondContact O-N 2.82Å; G32-N34 VanDerWaalsContact O-N 3.14Å
33	K	71	Confident	62.8	Low	204 Å²	204	158.6 Å²	158.6	89%	0.887	79%	0.793	S	S	*	*			trans	-63.8	113	162.5	-76.6	-173	177.5	178	0	105.5	L31 W35	L31-K33 PolarHBondContact O-N 2.67Å; K33-W35 PolarHBondContact O-N 3.49Å
34	N	65.5	Low	62.9	Low	144 Å²	144	160.1 Å²	160.1	77%	0.77	80%	0.804	S	S	*	*			trans	-57.5	110.9	171.9	-101.1	-72.2	0	0	0	108	G32 R36	G32-N34 PolarHBondContact O-N 2.82Å; G32-N34 VanDerWaalsContact O-N 3.14Å; N34-R36 PolarHBondContact O-N 3.43Å
35	W	53.1	Low	63.1	Low	248 Å²	248	163.7 Å²	163.7	94%	0.939	80%	0.802	S	S	*	*			trans	-65.6	113.9	157.9	75.2	-32.8	0	0	0	106.6	K33	K33-W35 PolarHBondContact O-N 3.49Å
36	R	59.4	Low	63.2	Low	308 Å²	308	170.5 Å²	170.5	100%	1.162	83%	0.834	S	S	*	*			trans	-103.5	0	165.9	-81	-175	163.3	-167.7	-3.7	107.1	N34	N34-R36 PolarHBondContact O-N 3.43Å

Retrieved 36 of 36 residues in 57.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).