A0A077Z715_TRITR Loading...

ATP synthase F(0) complex subunit e, mitochondrial

Subunit e, of the mitochondrial membrane ATP synthase complex (F(1)F(0) ATP synthase or Complex V) that produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. ATP synthase complex consist of a soluble F(1) head domain - the catalytic core - and a membrane F(1) domain - the membrane proton channel. These two domains are linked by a central stalk rotating inside the F(1) region and a stationary peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. In vivo, can only synthesize ATP although its ATP hydrolase activity can be activated artificially in vitro. Part of the complex F(0) domain.

AlphaFold DB , UniProt , Accession A0A077Z715, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 108 aa.

						>A0A077Z715_TRITR|A0A077Z715
MPIVPEHPNRVILKPPINVSPTIRAARYIFLTLGVAYGAYRQKRLEVVHEKFVRKVGEDHLMDRLEKAKKAAISGKESLAEVGKELGFGRTVEWAGYKYEPIDLKKSL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.6	Very low	71.6	Confident	226 Å²	226	142.1 Å²	142.1	100%	1.113	76%	0.759	S	S	*	*				0	128.4	0	38.3	-170.6	156.1	0	0	108
2	P	60.1	Low	72.3	Confident	119 Å²	119	140.9 Å²	140.9	77%	0.773	75%	0.751	S	S	*	*			trans	-64.1	136.8	-177.9	26.7	-32.6	0	0	0	110	V4	P2-V4 PolarHBondContact O-N 3.38Å; P2-V4 VanDerWaalsContact O-N 3.08Å
3	I	75.7	Confident	73	Confident	170 Å²	170	141.1 Å²	141.1	87%	0.872	75%	0.751	S	S	*	*			trans	-71.9	101.1	175.4	-60.3	156.7	0	0	0	106
4	V	76.1	Confident	73.8	Confident	112 Å²	112	144.9 Å²	144.9	68%	0.679	76%	0.757	S	S	*	*	P	Polyproline II helix	trans	-72	124.2	173.8	-177.7	0	0	0	0	106.9	P2 E6	P2-V4 PolarHBondContact O-N 3.38Å; P2-V4 VanDerWaalsContact O-N 3.08Å; V4-E6 PolarHBondContact O-N 2.93Å; V4-E6 VanDerWaalsContact O-N 3.13Å
5	P	70	Confident	74.6	Confident	120 Å²	120	142.7 Å²	142.7	78%	0.779	76%	0.756	S	S	*	*	P	Polyproline II helix	trans	-59.1	120.5	180	21.4	-30.6	0	0	0	109.9
6	E	69.5	Low	75.1	Confident	136 Å²	136	141.2 Å²	141.2	64%	0.636	76%	0.756	S	S	*	*	P	Polyproline II helix	trans	-75.1	131.3	-179.3	-60.7	-168.7	157.9	0	0	109.8	V4	V4-E6 PolarHBondContact O-N 2.93Å; V4-E6 VanDerWaalsContact O-N 3.13Å
7	H	75	Confident	75.7	Confident	133 Å²	133	141.6 Å²	141.6	62%	0.616	76%	0.756	S	S	*	*	P	Polyproline II helix	trans	-63.1	132.1	174.9	-170.4	-37.3	0	0	0	109	N9 R10	H7-N9 PolarHBondContact ND1-N 3.31Å; H7-N9 PolarHBondContact O-N 3.49Å; H7-R10 VanDerWaalsContact O-CB 3.25Å; H7-R10 WeakPolarHBondContact O-CB 3.39Å; H7-R10 PolarHBondContact O-N 3.14Å
8	P	77.8	Confident	76.3	Confident	123 Å²	123	142.9 Å²	142.9	80%	0.799	76%	0.763	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.1	-21.3	-174.9	17	-32.5	0	0	0	115.5
9	N	80.4	Confident	76.9	Confident	138 Å²	138	138.7 Å²	138.7	74%	0.738	74%	0.743	S	S	*	*	T	Hydrogen-bonded Turn	trans	-103.3	16.3	178.3	-77.1	-2.3	0	0	0	113.1	H7 V11	H7-N9 PolarHBondContact ND1-N 3.31Å; H7-N9 PolarHBondContact O-N 3.49Å; N9-V11 PolarHBondContact O-N 2.9Å
10	R	76.4	Confident	77.6	Confident	168 Å²	168	134 Å²	134	63%	0.634	72%	0.722	S	S	*	*			trans	-66.4	109	176	174.2	177.2	-104.3	-115.1	-1.3	108.8	H7 I12	H7-R10 VanDerWaalsContact O-CB 3.25Å; H7-R10 WeakPolarHBondContact O-CB 3.39Å; H7-R10 PolarHBondContact O-N 3.14Å; R10-I12 HydrophobicContact CG-CG1 4.43Å; R10-I12 PolarHBondContact O-N 3.17Å
11	V	79.3	Confident	78.3	Confident	118 Å²	118	132.8 Å²	132.8	72%	0.715	72%	0.721	S	S	*	*			trans	-66.6	102.9	167.1	-178.5	0	0	0	0	107.4	N9 L13	N9-V11 PolarHBondContact O-N 2.9Å; V11-L13 VanDerWaalsContact C-N 3.32Å; V11-L13 HydrophobicContact CG1-CD2 3.92Å; V11-L13 HydrophobicContact CG1-CG 4.41Å; V11-L13 PolarHBondContact O-N 3.31Å
12	I	79.9	Confident	80.5	Confident	128 Å²	128	126.9 Å²	126.9	66%	0.656	70%	0.698	S	S	*	*			trans	-71.8	94.8	172.6	-56.1	175.5	0	0	0	106.8	R10 K14	R10-I12 HydrophobicContact CG-CG1 4.43Å; R10-I12 PolarHBondContact O-N 3.17Å; I12-K14 PolarHBondContact O-N 3.26Å
13	L	81.4	Confident	82.1	Confident	143 Å²	143	126.2 Å²	126.2	75%	0.749	69%	0.687	S	S	*	*	P	Polyproline II helix	trans	-65.6	132	173.9	-65.2	172.8	0	0	0	108.6	V11	V11-L13 VanDerWaalsContact C-N 3.32Å; V11-L13 HydrophobicContact CG1-CD2 3.92Å; V11-L13 HydrophobicContact CG1-CG 4.41Å; V11-L13 PolarHBondContact O-N 3.31Å
14	K	84.2	Confident	82.8	Confident	194 Å²	194	125.1 Å²	125.1	84%	0.843	67%	0.672	S	S	*	*	P	Polyproline II helix	trans	-55.7	146.3	171.2	-70.6	-179.5	-179.5	177.7	0	109.3	I12	I12-K14 PolarHBondContact O-N 3.26Å
15	P	86	Confident	83.8	Confident	113 Å²	113	122.1 Å²	122.1	73%	0.734	66%	0.659	S	S	*	*	P	Polyproline II helix	trans	-55.2	145.8	178.1	23	-33.2	0	0	0	110.6	I17	P15-I17 PolarHBondContact O-N 3.27Å
16	P	83	Confident	85	Confident	118 Å²	118	118 Å²	118	77%	0.766	64%	0.635	S	S	*	*	P	Polyproline II helix	trans	-60.8	135.4	-178.2	25	-33.1	0	0	0	110.2	N18	P16-N18 PolarHBondContact O-N 3.48Å
17	I	85.4	Confident	86.2	Confident	148 Å²	148	120.5 Å²	120.5	76%	0.759	64%	0.638	S	S	*	*	P	Polyproline II helix	trans	-65.9	127.2	175.9	-59.9	170.7	0	0	0	108.1	P15 V19	P15-I17 PolarHBondContact O-N 3.27Å; I17-V19 VanDerWaalsContact C-N 3.32Å; I17-V19 HydrophobicContact CG2-CG1 4.35Å; I17-V19 PolarHBondContact O-N 3.08Å
18	N	84.9	Confident	87.3	Confident	165 Å²	165	120.8 Å²	120.8	88%	0.882	64%	0.635	S	S	*	*			trans	-68.2	91.9	172.6	-76	-23.3	0	0	0	109.4	P16	P16-N18 PolarHBondContact O-N 3.48Å
19	V	88.3	Confident	88.2	Confident	63 Å²	63	119.5 Å²	119.5	38%	0.382	62%	0.62	S	S	.	*			trans	-85	143	171.3	-67.2	0	0	0	0	109.8	I17	I17-V19 VanDerWaalsContact C-N 3.32Å; I17-V19 HydrophobicContact CG2-CG1 4.35Å; I17-V19 PolarHBondContact O-N 3.08Å
20	S	90.2	Very high	89.1	Confident	44 Å²	44	120 Å²	120	31%	0.308	62%	0.616	S	S	.	*			trans	-60.6	148.8	175.7	71	0	0	0	0	110.7	T22 I23 R24	S20-T22 PolarHBondContact O-N 3.4Å; S20-T22 VanDerWaalsContact O-N 3.16Å; S20-T22 PolarHBondContact OG-OG1 3.11Å; S20-I23 PolarHBondContact O-N 3.2Å; S20-I23 WeakPolarHBondContact OG-CD1 3.34Å; S20-I23 VanDerWaalsContact OG-CG1 3.28Å; S20-I23 WeakPolarHBondContact OG-CG1 3.35Å; S20-I23 PolarHBondContact OG-N 3.01Å; S20-R24 PolarHBondContact O-N 3.02Å
21	P	92.5	Very high	90.1	Very high	110 Å²	110	117 Å²	117	71%	0.714	61%	0.612	S	S	*	*	H	α-helix	trans	-54.9	-31.9	173.5	-26.8	35.2	0	0	0	112.9	R24 A25	P21-R24 PolarHBondContact O-N 3.25Å; P21-A25 WeakPolarHBondContact O-CB 3.35Å; P21-A25 PolarHBondContact O-N 3.06Å
22	T	94.4	Very high	90.9	Very high	102 Å²	102	115.4 Å²	115.4	63%	0.626	60%	0.603	S	S	*	*	H	α-helix	trans	-66.1	-43.6	178.2	53.7	0	0	0	0	112.8	S20 R24 A25 A26	S20-T22 PolarHBondContact O-N 3.4Å; S20-T22 VanDerWaalsContact O-N 3.16Å; S20-T22 PolarHBondContact OG-OG1 3.11Å; T22-R24 VanDerWaalsContact C-N 3.32Å; T22-A25 PolarHBondContact O-N 3.33Å; T22-A26 WeakPolarHBondContact O-CB 3.43Å; T22-A26 PolarHBondContact O-N 2.93Å
23	I	93.6	Very high	91.8	Very high	105 Å²	105	114.4 Å²	114.4	54%	0.538	60%	0.598	S	S	.	*	H	α-helix	trans	-66.9	-39.1	177.3	-67.7	165.9	0	0	0	110.2	S20 A26 R27	S20-I23 PolarHBondContact O-N 3.2Å; S20-I23 WeakPolarHBondContact OG-CD1 3.34Å; S20-I23 VanDerWaalsContact OG-CG1 3.28Å; S20-I23 WeakPolarHBondContact OG-CG1 3.35Å; S20-I23 PolarHBondContact OG-N 3.01Å; I23-A26 PolarHBondContact O-N 2.96Å; I23-R27 PolarHBondContact O-N 3.45Å
24	R	91.1	Very high	92.6	Very high	147 Å²	147	109.7 Å²	109.7	56%	0.555	58%	0.584	S	S	*	*	H	α-helix	trans	-62.8	-45.3	176.6	-166.4	-177.5	-61	176.8	2.2	111.2	S20 P21 T22 R27 Y28	S20-R24 PolarHBondContact O-N 3.02Å; P21-R24 PolarHBondContact O-N 3.25Å; T22-R24 VanDerWaalsContact C-N 3.32Å; R24-R27 PolarHBondContact O-N 2.97Å; R24-Y28 HydrophobicContact CG-CE2 3.99Å; R24-Y28 WeakPolarHBondContact O-CD2 3.23Å; R24-Y28 PolarHBondContact O-N 2.81Å
25	A	95.7	Very high	93.3	Very high	49 Å²	49	105 Å²	105	41%	0.405	57%	0.572	S	S	.	*	H	α-helix	trans	-63.7	-46.4	175.7	0	0	0	0	0	111.9	P21 T22 R27 Y28 I29	P21-A25 WeakPolarHBondContact O-CB 3.35Å; P21-A25 PolarHBondContact O-N 3.06Å; T22-A25 PolarHBondContact O-N 3.33Å; A25-R27 VanDerWaalsContact C-N 3.28Å; A25-R27 PolarHBondContact O-N 2.92Å; A25-Y28 PolarHBondContact O-N 3.1Å; A25-Y28 VanDerWaalsContact O-N 3.08Å; A25-I29 WeakPolarHBondContact O-CG1 3.34Å; A25-I29 PolarHBondContact O-N 3.32Å
26	A	96.6	Very high	93.8	Very high	33 Å²	33	102.5 Å²	102.5	27%	0.273	56%	0.56	S	S	.	*	H	α-helix	trans	-55.4	-43.4	177.9	0	0	0	0	0	111.6	T22 I23 Y28 I29 F30	T22-A26 WeakPolarHBondContact O-CB 3.43Å; T22-A26 PolarHBondContact O-N 2.93Å; I23-A26 PolarHBondContact O-N 2.96Å; A26-Y28 VanDerWaalsContact C-N 3.32Å; A26-Y28 PolarHBondContact O-N 2.92Å; A26-I29 PolarHBondContact O-N 3.2Å; A26-I29 VanDerWaalsContact O-N 3.16Å; A26-F30 HydrophobicContact CB-CD2 4.38Å; A26-F30 HydrophobicContact CB-CE2 4.3Å; A26-F30 WeakPolarHBondContact O-CD2 3.44Å; A26-F30 PolarHBondContact O-N 3.45Å
27	R	95.1	Very high	94.5	Very high	188 Å²	188	103.9 Å²	103.9	71%	0.709	55%	0.551	S	S	*	*	H	α-helix	trans	-55.6	-45.3	176.6	-178.2	179.9	174.9	179.6	-1.5	112.4	I23 R24 A25 L31	I23-R27 PolarHBondContact O-N 3.45Å; R24-R27 PolarHBondContact O-N 2.97Å; A25-R27 VanDerWaalsContact C-N 3.28Å; A25-R27 PolarHBondContact O-N 2.92Å; R27-L31 WeakPolarHBondContact O-CB 3.46Å; R27-L31 PolarHBondContact O-N 3.04Å
28	Y	96.6	Very high	95.1	Very high	140 Å²	140	98.6 Å²	98.6	55%	0.549	53%	0.533	S	S	.	.	H	α-helix	trans	-72.1	-34.8	178.5	-67.7	-66.2	0	0	0	112.3	R24 A25 A26 L31 T32	R24-Y28 HydrophobicContact CG-CE2 3.99Å; R24-Y28 WeakPolarHBondContact O-CD2 3.23Å; R24-Y28 PolarHBondContact O-N 2.81Å; A25-Y28 PolarHBondContact O-N 3.1Å; A25-Y28 VanDerWaalsContact O-N 3.08Å; A26-Y28 VanDerWaalsContact C-N 3.32Å; A26-Y28 PolarHBondContact O-N 2.92Å; Y28-L31 PolarHBondContact O-N 3.09Å; Y28-T32 WeakPolarHBondContact O-CB 3.48Å; Y28-T32 VanDerWaalsContact O-CG2 3.23Å; Y28-T32 WeakPolarHBondContact O-CG2 3.29Å; Y28-T32 PolarHBondContact O-N 3.19Å; Y28-T32 PolarHBondContact O-OG1 2.86Å
29	I	97.7	Very high	95.7	Very high	95 Å²	95	93.1 Å²	93.1	49%	0.487	51%	0.511	S	S	.	.	H	α-helix	trans	-62.3	-48.2	173.5	-66.8	166.4	0	0	0	110.4	A25 A26 L31 T32 L33	A25-I29 WeakPolarHBondContact O-CG1 3.34Å; A25-I29 PolarHBondContact O-N 3.32Å; A26-I29 PolarHBondContact O-N 3.2Å; A26-I29 VanDerWaalsContact O-N 3.16Å; I29-L31 VanDerWaalsContact C-N 3.34Å; I29-L31 PolarHBondContact O-N 2.98Å; I29-T32 WeakPolarHBondContact CA-OG1 3.46Å; I29-T32 PolarHBondContact O-N 2.99Å; I29-T32 PolarHBondContact O-OG1 2.93Å; I29-L33 HydrophobicContact CG2-CD1 3.86Å; I29-L33 HydrophobicContact CG2-CG 4.36Å; I29-L33 WeakPolarHBondContact O-CB 3.3Å; I29-L33 VanDerWaalsContact O-CG 3.28Å; I29-L33 WeakPolarHBondContact O-CG 3.35Å; I29-L33 PolarHBondContact O-N 3.26Å
30	F	98.1	Very high	96.1	Very high	150 Å²	150	97.3 Å²	97.3	66%	0.658	52%	0.521	S	S	*	.	H	α-helix	trans	-63.3	-39.9	176.4	-76.9	-66.3	0	0	0	112.5	A26 G34	A26-F30 HydrophobicContact CB-CD2 4.38Å; A26-F30 HydrophobicContact CB-CE2 4.3Å; A26-F30 WeakPolarHBondContact O-CD2 3.44Å; A26-F30 PolarHBondContact O-N 3.45Å; F30-G34 PolarHBondContact O-N 3.03Å
31	L	97.4	Very high	96.3	Very high	103 Å²	103	102.2 Å²	102.2	54%	0.539	53%	0.533	S	S	.	.	H	α-helix	trans	-62.1	-47.8	176	-177.2	65.5	0	0	0	111.3	R27 Y28 I29 G34 V35	R27-L31 WeakPolarHBondContact O-CB 3.46Å; R27-L31 PolarHBondContact O-N 3.04Å; Y28-L31 PolarHBondContact O-N 3.09Å; I29-L31 VanDerWaalsContact C-N 3.34Å; I29-L31 PolarHBondContact O-N 2.98Å; L31-G34 PolarHBondContact O-N 2.95Å; L31-V35 VanDerWaalsContact O-CG2 3.31Å; L31-V35 WeakPolarHBondContact O-CG2 3.27Å; L31-V35 PolarHBondContact O-N 2.91Å
32	T	97.9	Very high	96.4	Very high	86 Å²	86	102.6 Å²	102.6	53%	0.528	53%	0.525	S	S	.	.	H	α-helix	trans	-65.2	-43	-179.9	51.3	0	0	0	0	111.8	Y28 I29 G34 V35 A36	Y28-T32 WeakPolarHBondContact O-CB 3.48Å; Y28-T32 VanDerWaalsContact O-CG2 3.23Å; Y28-T32 WeakPolarHBondContact O-CG2 3.29Å; Y28-T32 PolarHBondContact O-N 3.19Å; Y28-T32 PolarHBondContact O-OG1 2.86Å; I29-T32 WeakPolarHBondContact CA-OG1 3.46Å; I29-T32 PolarHBondContact O-N 2.99Å; I29-T32 PolarHBondContact O-OG1 2.93Å; T32-G34 PolarHBondContact O-N 3.06Å; T32-V35 PolarHBondContact O-N 2.92Å; T32-A36 VanDerWaalsContact O-CB 3.3Å; T32-A36 WeakPolarHBondContact O-CB 3.38Å; T32-A36 PolarHBondContact O-N 3.17Å
33	L	98.2	Very high	96.3	Very high	107 Å²	107	104.5 Å²	104.5	56%	0.56	52%	0.524	S	S	*	.	H	α-helix	trans	-61.8	-42.3	173.5	-72.5	173.9	0	0	0	111.9	I29 A36 Y37	I29-L33 HydrophobicContact CG2-CD1 3.86Å; I29-L33 HydrophobicContact CG2-CG 4.36Å; I29-L33 WeakPolarHBondContact O-CB 3.3Å; I29-L33 VanDerWaalsContact O-CG 3.28Å; I29-L33 WeakPolarHBondContact O-CG 3.35Å; I29-L33 PolarHBondContact O-N 3.26Å; L33-A36 PolarHBondContact O-N 3.28Å; L33-Y37 VanDerWaalsContact O-CB 3.26Å; L33-Y37 WeakPolarHBondContact O-CB 3.31Å; L33-Y37 PolarHBondContact O-N 2.91Å
34	G	97.9	Very high	96.3	Very high	44 Å²	44	106.8 Å²	106.8	45%	0.454	53%	0.526	S	S	.	.	H	α-helix	trans	-61.8	-45.9	176.8	0	0	0	0	0	112.4	F30 L31 T32 Y37 G38	F30-G34 PolarHBondContact O-N 3.03Å; L31-G34 PolarHBondContact O-N 2.95Å; T32-G34 PolarHBondContact O-N 3.06Å; G34-Y37 PolarHBondContact O-N 3.01Å; G34-G38 PolarHBondContact O-N 3.08Å
35	V	98	Very high	96.2	Very high	95 Å²	95	105 Å²	105	58%	0.576	53%	0.527	S	S	*	.	H	α-helix	trans	-64.3	-45.9	176.6	173	0	0	0	0	111.1	L31 T32 Y37 G38 A39	L31-V35 VanDerWaalsContact O-CG2 3.31Å; L31-V35 WeakPolarHBondContact O-CG2 3.27Å; L31-V35 PolarHBondContact O-N 2.91Å; T32-V35 PolarHBondContact O-N 2.92Å; V35-Y37 PolarHBondContact O-N 3.3Å; V35-G38 PolarHBondContact O-N 2.98Å; V35-A39 PolarHBondContact O-N 3.41Å
36	A	98	Very high	95.9	Very high	60 Å²	60	107.6 Å²	107.6	50%	0.496	53%	0.531	S	S	.	.	H	α-helix	trans	-61.6	-43.1	178.2	0	0	0	0	0	111.9	T32 L33 A39 Y40	T32-A36 VanDerWaalsContact O-CB 3.3Å; T32-A36 WeakPolarHBondContact O-CB 3.38Å; T32-A36 PolarHBondContact O-N 3.17Å; L33-A36 PolarHBondContact O-N 3.28Å; A36-A39 PolarHBondContact O-N 3.3Å; A36-Y40 WeakPolarHBondContact O-CB 3.41Å; A36-Y40 PolarHBondContact O-N 3.47Å
37	Y	97.9	Very high	95.5	Very high	148 Å²	148	109.2 Å²	109.2	58%	0.58	54%	0.538	S	S	*	.	H	α-helix	trans	-64.5	-42.7	175.8	-179.9	-106.1	0	0	0	112.1	L33 G34 V35 Y40 R41	L33-Y37 VanDerWaalsContact O-CB 3.26Å; L33-Y37 WeakPolarHBondContact O-CB 3.31Å; L33-Y37 PolarHBondContact O-N 2.91Å; G34-Y37 PolarHBondContact O-N 3.01Å; V35-Y37 PolarHBondContact O-N 3.3Å; Y37-Y40 PolarHBondContact O-N 3.39Å; Y37-R41 VanDerWaalsContact O-CB 3.3Å; Y37-R41 WeakPolarHBondContact O-CB 3.33Å; Y37-R41 PolarHBondContact O-N 2.97Å
38	G	97.2	Very high	95.1	Very high	37 Å²	37	104 Å²	104	38%	0.381	53%	0.527	S	S	.	.	H	α-helix	trans	-57.1	-48.9	174.5	0	0	0	0	0	112.1	G34 V35 R41 Q42	G34-G38 PolarHBondContact O-N 3.08Å; V35-G38 PolarHBondContact O-N 2.98Å; G38-R41 PolarHBondContact O-N 2.87Å; G38-Q42 WeakPolarHBondContact O-CB 3.41Å; G38-Q42 PolarHBondContact O-N 3.39Å
39	A	97.3	Very high	94.4	Very high	50 Å²	50	103.3 Å²	103.3	41%	0.413	53%	0.528	S	S	.	.	H	α-helix	trans	-63.4	-43.8	177.9	0	0	0	0	0	112.6	V35 A36 Q42 K43	V35-A39 PolarHBondContact O-N 3.41Å; A36-A39 PolarHBondContact O-N 3.3Å; A39-Q42 PolarHBondContact O-N 2.87Å; A39-K43 WeakPolarHBondContact O-CG 3.4Å; A39-K43 PolarHBondContact O-N 3.42Å
40	Y	96.7	Very high	93.7	Very high	150 Å²	150	105.1 Å²	105.1	59%	0.588	53%	0.534	S	S	*	.	H	α-helix	trans	-60.9	-44.7	175.5	170.4	-105.2	0	0	0	112	A36 Y37 K43 R44	A36-Y40 WeakPolarHBondContact O-CB 3.41Å; A36-Y40 PolarHBondContact O-N 3.47Å; Y37-Y40 PolarHBondContact O-N 3.39Å; Y40-K43 PolarHBondContact O-N 2.87Å; Y40-R44 HydrophobicContact CE2-CG 4.5Å; Y40-R44 PolarHBondContact O-N 3.33Å
41	R	95	Very high	93.1	Very high	147 Å²	147	104 Å²	104	56%	0.555	53%	0.529	S	S	*	.	H	α-helix	trans	-63.9	-41.7	178.7	-176.2	178.9	179.5	-178.8	0.6	111.7	Y37 G38 R44 L45	Y37-R41 VanDerWaalsContact O-CB 3.3Å; Y37-R41 WeakPolarHBondContact O-CB 3.33Å; Y37-R41 PolarHBondContact O-N 2.97Å; G38-R41 PolarHBondContact O-N 2.87Å; R41-R44 WeakPolarHBondContact O-CB 3.26Å; R41-R44 PolarHBondContact O-N 2.91Å; R41-L45 HydrophobicContact CG-CD1 4.34Å; R41-L45 WeakPolarHBondContact O-CG 3.35Å; R41-L45 PolarHBondContact O-N 3.18Å
42	Q	93.6	Very high	92.5	Very high	118 Å²	118	105.4 Å²	105.4	55%	0.551	53%	0.531	S	S	*	.	H	α-helix	trans	-61.2	-47.8	176.6	-175	177.8	-19.8	0	0	111.2	G38 A39 R44 L45 E46	G38-Q42 WeakPolarHBondContact O-CB 3.41Å; G38-Q42 PolarHBondContact O-N 3.39Å; A39-Q42 PolarHBondContact O-N 2.87Å; Q42-R44 VanDerWaalsContact C-N 3.28Å; Q42-R44 PolarHBondContact O-N 3.5Å; Q42-L45 PolarHBondContact O-N 3.45Å; Q42-E46 WeakPolarHBondContact CG-OE1 3.48Å; Q42-E46 PolarHBondContact NE2-OE1 3.43Å; Q42-E46 PolarHBondContact O-N 3.36Å
43	K	92.7	Very high	91.8	Very high	142 Å²	142	104.9 Å²	104.9	62%	0.617	53%	0.528	S	S	*	.	H	α-helix	trans	-57.1	-40.4	174.8	-73.5	-175.6	175.3	-173.8	0	112.7	A39 Y40 L45 E46 V47	A39-K43 WeakPolarHBondContact O-CG 3.4Å; A39-K43 PolarHBondContact O-N 3.42Å; Y40-K43 PolarHBondContact O-N 2.87Å; K43-L45 VanDerWaalsContact C-N 3.35Å; K43-L45 PolarHBondContact O-N 2.89Å; K43-E46 PolarHBondContact O-N 3.01Å; K43-V47 WeakPolarHBondContact O-CG2 3.29Å; K43-V47 PolarHBondContact O-N 3.04Å; K43-V47 VanDerWaalsContact O-N 3.12Å
44	R	92.9	Very high	91	Very high	154 Å²	154	107.3 Å²	107.3	58%	0.581	53%	0.529	S	S	*	.	H	α-helix	trans	-61.6	-42	174.8	-98.6	-157.7	75	-150.8	3.9	112.4	Y40 R41 Q42 V48	Y40-R44 HydrophobicContact CE2-CG 4.5Å; Y40-R44 PolarHBondContact O-N 3.33Å; R41-R44 WeakPolarHBondContact O-CB 3.26Å; R41-R44 PolarHBondContact O-N 2.91Å; Q42-R44 VanDerWaalsContact C-N 3.28Å; Q42-R44 PolarHBondContact O-N 3.5Å; R44-V48 VanDerWaalsContact O-CG2 3.23Å; R44-V48 WeakPolarHBondContact O-CG2 3.21Å; R44-V48 PolarHBondContact O-N 3.27Å; R44-V48 VanDerWaalsContact O-N 3.08Å
45	L	89.9	Confident	90.2	Very high	109 Å²	109	111.8 Å²	111.8	57%	0.571	54%	0.536	S	S	*	.	H	α-helix	trans	-67.5	-40.9	-179.9	-73.6	164.8	0	0	0	111.6	R41 Q42 K43 V48 H49	R41-L45 HydrophobicContact CG-CD1 4.34Å; R41-L45 WeakPolarHBondContact O-CG 3.35Å; R41-L45 PolarHBondContact O-N 3.18Å; Q42-L45 PolarHBondContact O-N 3.45Å; K43-L45 VanDerWaalsContact C-N 3.35Å; K43-L45 PolarHBondContact O-N 2.89Å; L45-V48 PolarHBondContact O-N 3.24Å; L45-H49 VanDerWaalsContact O-CB 3.32Å; L45-H49 WeakPolarHBondContact O-CB 3.32Å; L45-H49 PolarHBondContact O-N 3.16Å
46	E	88.8	Confident	89.4	Confident	103 Å²	103	109.9 Å²	109.9	48%	0.481	53%	0.525	S	S	.	.	H	α-helix	trans	-59.6	-48.7	175.7	-72.7	169.3	-170.7	0	0	111.3	Q42 K43 V48 H49 E50	Q42-E46 WeakPolarHBondContact CG-OE1 3.48Å; Q42-E46 PolarHBondContact NE2-OE1 3.43Å; Q42-E46 PolarHBondContact O-N 3.36Å; K43-E46 PolarHBondContact O-N 3.01Å; E46-V48 VanDerWaalsContact C-N 3.32Å; E46-V48 PolarHBondContact O-N 3.43Å; E46-H49 PolarHBondContact O-N 3Å; E46-E50 WeakPolarHBondContact O-CB 3.46Å; E46-E50 PolarHBondContact O-N 2.89Å
47	V	87.9	Confident	88.6	Confident	68 Å²	68	108.5 Å²	108.5	41%	0.412	52%	0.516	S	S	.	.	H	α-helix	trans	-63.4	-37.4	178.1	173	0	0	0	0	112.2	K43 K51	K43-V47 WeakPolarHBondContact O-CG2 3.29Å; K43-V47 PolarHBondContact O-N 3.04Å; K43-V47 VanDerWaalsContact O-N 3.12Å; V47-K51 HydrophobicContact CG1-CD 4.24Å; V47-K51 WeakPolarHBondContact O-CB 3.25Å; V47-K51 VanDerWaalsContact O-CG 3.24Å; V47-K51 WeakPolarHBondContact O-CG 3.33Å; V47-K51 PolarHBondContact O-N 2.99Å; V47-K51 VanDerWaalsContact O-N 3.11Å
48	V	87.1	Confident	87.7	Confident	79 Å²	79	105.8 Å²	105.8	48%	0.479	51%	0.509	S	S	.	.	H	α-helix	trans	-68.7	-41.2	176.6	170.6	0	0	0	0	110.7	R44 L45 E46 K51 F52	R44-V48 VanDerWaalsContact O-CG2 3.23Å; R44-V48 WeakPolarHBondContact O-CG2 3.21Å; R44-V48 PolarHBondContact O-N 3.27Å; R44-V48 VanDerWaalsContact O-N 3.08Å; L45-V48 PolarHBondContact O-N 3.24Å; E46-V48 VanDerWaalsContact C-N 3.32Å; E46-V48 PolarHBondContact O-N 3.43Å; V48-K51 PolarHBondContact O-N 3.48Å; V48-F52 WeakPolarHBondContact O-CB 3.36Å; V48-F52 PolarHBondContact O-N 3.3Å
49	H	83.2	Confident	87	Confident	124 Å²	124	109.2 Å²	109.2	57%	0.574	52%	0.518	S	S	*	.	H	α-helix	trans	-65.5	-46	178.3	-173.5	73.3	0	0	0	111.5	L45 E46 K51 F52 V53	L45-H49 VanDerWaalsContact O-CB 3.32Å; L45-H49 WeakPolarHBondContact O-CB 3.32Å; L45-H49 PolarHBondContact O-N 3.16Å; E46-H49 PolarHBondContact O-N 3Å; H49-K51 VanDerWaalsContact C-N 3.33Å; H49-K51 PolarHBondContact O-N 2.99Å; H49-F52 WeakPolarHBondContact O-CB 3.48Å; H49-F52 PolarHBondContact O-N 2.84Å; H49-F52 VanDerWaalsContact O-N 3.09Å; H49-V53 WeakPolarHBondContact O-CG2 3.36Å; H49-V53 PolarHBondContact O-N 3.45Å
50	E	82.8	Confident	86.3	Confident	134 Å²	134	112.2 Å²	112.2	63%	0.626	52%	0.524	S	S	*	.	H	α-helix	trans	-59.2	-45.2	176.5	-171.8	-174.8	173.4	0	0	111.2	E46 F52 V53 R54	E46-E50 WeakPolarHBondContact O-CB 3.46Å; E46-E50 PolarHBondContact O-N 2.89Å; E50-F52 VanDerWaalsContact C-N 3.28Å; E50-F52 PolarHBondContact O-N 3.42Å; E50-V53 PolarHBondContact O-N 3.21Å; E50-R54 VanDerWaalsContact O-CB 3.29Å; E50-R54 WeakPolarHBondContact O-CB 3.43Å; E50-R54 PolarHBondContact O-N 3.16Å
51	K	84.6	Confident	85.4	Confident	126 Å²	126	110 Å²	110	55%	0.548	52%	0.522	S	S	.	.	H	α-helix	trans	-61.3	-37	175	-75.6	176.1	-178.1	-177.4	0	112.7	V47 V48 H49 K55	V47-K51 HydrophobicContact CG1-CD 4.24Å; V47-K51 WeakPolarHBondContact O-CB 3.25Å; V47-K51 VanDerWaalsContact O-CG 3.24Å; V47-K51 WeakPolarHBondContact O-CG 3.33Å; V47-K51 PolarHBondContact O-N 2.99Å; V47-K51 VanDerWaalsContact O-N 3.11Å; V48-K51 PolarHBondContact O-N 3.48Å; H49-K51 VanDerWaalsContact C-N 3.33Å; H49-K51 PolarHBondContact O-N 2.99Å; K51-K55 WeakPolarHBondContact O-CG 3.29Å; K51-K55 PolarHBondContact O-N 3.11Å; K51-K55 VanDerWaalsContact O-N 3.11Å
52	F	85.2	Confident	84.7	Confident	132 Å²	132	107.9 Å²	107.9	58%	0.579	52%	0.519	S	S	*	.	H	α-helix	trans	-69.2	-50	177.7	179.4	-97.4	0	0	0	111.4	V48 H49 E50 R54 K55 V56	V48-F52 WeakPolarHBondContact O-CB 3.36Å; V48-F52 PolarHBondContact O-N 3.3Å; H49-F52 WeakPolarHBondContact O-CB 3.48Å; H49-F52 PolarHBondContact O-N 2.84Å; H49-F52 VanDerWaalsContact O-N 3.09Å; E50-F52 VanDerWaalsContact C-N 3.28Å; E50-F52 PolarHBondContact O-N 3.42Å; F52-R54 VanDerWaalsContact C-N 3.26Å; F52-R54 PolarHBondContact O-N 2.95Å; F52-K55 PolarHBondContact O-N 3.38Å; F52-V56 HydrophobicContact CD1-CG2 4.24Å; F52-V56 HydrophobicContact CD2-CG2 4.42Å; F52-V56 HydrophobicContact CE1-CG2 3.82Å; F52-V56 HydrophobicContact CE2-CG2 4.01Å; F52-V56 HydrophobicContact CZ-CG2 3.69Å; F52-V56 WeakPolarHBondContact O-CG2 3.38Å; F52-V56 PolarHBondContact O-N 3.24Å
53	V	83.4	Confident	84.3	Confident	75 Å²	75	106.2 Å²	106.2	46%	0.455	51%	0.514	S	S	.	.	H	α-helix	trans	-59.7	-40.7	177.6	173.4	0	0	0	0	110.6	H49 E50 V56 G57	H49-V53 WeakPolarHBondContact O-CG2 3.36Å; H49-V53 PolarHBondContact O-N 3.45Å; E50-V53 PolarHBondContact O-N 3.21Å; V53-V56 PolarHBondContact O-N 2.81Å; V53-G57 PolarHBondContact O-N 3.49Å
54	R	80.8	Confident	83.7	Confident	158 Å²	158	108.5 Å²	108.5	60%	0.596	52%	0.519	S	S	*	.	H	α-helix	trans	-63.6	-45.9	177.4	-157	-177.9	81.7	-166.3	1.5	112.1	E50 F52 G57 E58	E50-R54 VanDerWaalsContact O-CB 3.29Å; E50-R54 WeakPolarHBondContact O-CB 3.43Å; E50-R54 PolarHBondContact O-N 3.16Å; F52-R54 VanDerWaalsContact C-N 3.26Å; F52-R54 PolarHBondContact O-N 2.95Å; R54-G57 PolarHBondContact O-N 3.22Å; R54-E58 HydrophobicContact CG-CG 4.49Å; R54-E58 WeakPolarHBondContact CG-OE1 3.24Å; R54-E58 IonicContact CZ-OE1 3.96Å; R54-E58 IonicContact NE-OE1 3.04Å; R54-E58 PolarHBondContact NE-OE1 3.09Å; R54-E58 WeakPolarHBondContact O-CB 3.42Å; R54-E58 WeakPolarHBondContact O-CG 3.39Å; R54-E58 PolarHBondContact O-N 3.36Å
55	K	80.2	Confident	83.1	Confident	139 Å²	139	103.7 Å²	103.7	60%	0.604	51%	0.505	S	S	*	.	H	α-helix	trans	-61.1	-48.7	176.1	-78.3	-174.4	175.9	-166.9	0	112.3	K51 F52 G57 E58 D59	K51-K55 WeakPolarHBondContact O-CG 3.29Å; K51-K55 PolarHBondContact O-N 3.11Å; K51-K55 VanDerWaalsContact O-N 3.11Å; F52-K55 PolarHBondContact O-N 3.38Å; K55-G57 VanDerWaalsContact C-N 3.3Å; K55-G57 PolarHBondContact O-N 3.05Å; K55-E58 PolarHBondContact O-N 3.11Å; K55-D59 PolarHBondContact O-N 3.45Å
56	V	82.6	Confident	82.9	Confident	54 Å²	54	103 Å²	103	33%	0.327	50%	0.498	S	S	.	.	H	α-helix	trans	-63.8	-38.8	179.3	173	0	0	0	0	111.3	F52 V53 H60	F52-V56 HydrophobicContact CD1-CG2 4.24Å; F52-V56 HydrophobicContact CD2-CG2 4.42Å; F52-V56 HydrophobicContact CE1-CG2 3.82Å; F52-V56 HydrophobicContact CE2-CG2 4.01Å; F52-V56 HydrophobicContact CZ-CG2 3.69Å; F52-V56 WeakPolarHBondContact O-CG2 3.38Å; F52-V56 PolarHBondContact O-N 3.24Å; V53-V56 PolarHBondContact O-N 2.81Å; V56-H60 WeakPolarHBondContact O-CB 3.37Å; V56-H60 PolarHBondContact O-CD2 2.94Å; V56-H60 VanDerWaalsContact O-CD2 3.24Å; V56-H60 PolarHBondContact O-N 2.98Å
57	G	80.6	Confident	82.6	Confident	31 Å²	31	105 Å²	105	32%	0.32	51%	0.505	S	S	.	.	H	α-helix	trans	-64.9	-45.5	174.9	0	0	0	0	0	112.7	V53 R54 K55 H60 L61	V53-G57 PolarHBondContact O-N 3.49Å; R54-G57 PolarHBondContact O-N 3.22Å; K55-G57 VanDerWaalsContact C-N 3.3Å; K55-G57 PolarHBondContact O-N 3.05Å; G57-H60 PolarHBondContact O-N 3.41Å; G57-L61 WeakPolarHBondContact O-CB 3.45Å; G57-L61 VanDerWaalsContact O-CG 3.25Å; G57-L61 WeakPolarHBondContact O-CG 3.38Å; G57-L61 PolarHBondContact O-N 3.46Å
58	E	80	Confident	82.1	Confident	91 Å²	91	103.9 Å²	103.9	43%	0.425	50%	0.503	S	S	.	.	H	α-helix	trans	-59	-48.8	175.5	-75.4	167.7	-169.2	0	0	111	R54 K55 H60 L61 M62	R54-E58 HydrophobicContact CG-CG 4.49Å; R54-E58 WeakPolarHBondContact CG-OE1 3.24Å; R54-E58 IonicContact CZ-OE1 3.96Å; R54-E58 IonicContact NE-OE1 3.04Å; R54-E58 PolarHBondContact NE-OE1 3.09Å; R54-E58 WeakPolarHBondContact O-CB 3.42Å; R54-E58 WeakPolarHBondContact O-CG 3.39Å; R54-E58 PolarHBondContact O-N 3.36Å; K55-E58 PolarHBondContact O-N 3.11Å; E58-H60 PolarHBondContact O-N 3.36Å; E58-L61 PolarHBondContact O-N 2.86Å; E58-M62 WeakPolarHBondContact O-CG 3.23Å; E58-M62 PolarHBondContact O-N 2.84Å
59	D	82.1	Confident	81.6	Confident	109 Å²	109	106.5 Å²	106.5	58%	0.583	51%	0.508	S	S	*	.	H	α-helix	trans	-61.9	-44	179.3	-70.5	-20.2	0	0	0	111.9	K55 L61 M62 D63	K55-D59 PolarHBondContact O-N 3.45Å; D59-L61 VanDerWaalsContact C-N 3.34Å; D59-L61 PolarHBondContact O-N 3.4Å; D59-M62 PolarHBondContact O-N 2.85Å; D59-D63 PolarHBondContact O-N 3.37Å
60	H	82.2	Confident	81.5	Confident	113 Å²	113	107 Å²	107	52%	0.523	51%	0.509	S	S	.	.	H	α-helix	trans	-65.1	-35.4	177	-86.8	-53	0	0	0	113.5	V56 G57 E58 R64	V56-H60 WeakPolarHBondContact O-CB 3.37Å; V56-H60 PolarHBondContact O-CD2 2.94Å; V56-H60 VanDerWaalsContact O-CD2 3.24Å; V56-H60 PolarHBondContact O-N 2.98Å; G57-H60 PolarHBondContact O-N 3.41Å; E58-H60 PolarHBondContact O-N 3.36Å; H60-R64 WeakPolarHBondContact O-CG 3.47Å; H60-R64 PolarHBondContact O-N 3.05Å; H60-R64 VanDerWaalsContact O-N 3.16Å
61	L	77	Confident	81.3	Confident	104 Å²	104	103.5 Å²	103.5	55%	0.545	50%	0.503	S	S	.	.	H	α-helix	trans	-66.8	-43.9	175.1	-73.7	171.8	0	0	0	110.4	G57 E58 D59 D63 R64 L65	G57-L61 WeakPolarHBondContact O-CB 3.45Å; G57-L61 VanDerWaalsContact O-CG 3.25Å; G57-L61 WeakPolarHBondContact O-CG 3.38Å; G57-L61 PolarHBondContact O-N 3.46Å; E58-L61 PolarHBondContact O-N 2.86Å; D59-L61 VanDerWaalsContact C-N 3.34Å; D59-L61 PolarHBondContact O-N 3.4Å; L61-D63 PolarHBondContact O-N 2.84Å; L61-R64 PolarHBondContact O-N 3.49Å; L61-L65 VanDerWaalsContact O-CG 3.26Å; L61-L65 WeakPolarHBondContact O-CG 3.48Å; L61-L65 PolarHBondContact O-N 3.2Å
62	M	81.7	Confident	80.9	Confident	102 Å²	102	99 Å²	99	50%	0.502	49%	0.489	S	S	.	.	H	α-helix	trans	-61.6	-43.9	177.7	-68	-56.2	-65.9	0	0	112.2	E58 D59 R64 L65 E66	E58-M62 WeakPolarHBondContact O-CG 3.23Å; E58-M62 PolarHBondContact O-N 2.84Å; D59-M62 PolarHBondContact O-N 2.85Å; M62-R64 VanDerWaalsContact C-N 3.31Å; M62-R64 PolarHBondContact O-N 3.3Å; M62-L65 WeakPolarHBondContact O-CB 3.42Å; M62-L65 PolarHBondContact O-N 3.08Å; M62-L65 VanDerWaalsContact O-N 3.16Å; M62-L65 HydrophobicContact SD-CD1 4.04Å; M62-E66 PolarHBondContact O-N 3.3Å
63	D	85.3	Confident	80.5	Confident	84 Å²	84	97.2 Å²	97.2	45%	0.449	49%	0.485	S	S	.	.	H	α-helix	trans	-58.3	-42.1	174.5	-90.5	-1.9	0	0	0	112.6	D59 L61 K67	D59-D63 PolarHBondContact O-N 3.37Å; L61-D63 PolarHBondContact O-N 2.84Å; D63-K67 WeakPolarHBondContact O-CB 3.32Å; D63-K67 VanDerWaalsContact O-CG 3.29Å; D63-K67 WeakPolarHBondContact O-CG 3.42Å; D63-K67 PolarHBondContact O-N 3.06Å
64	R	80.5	Confident	80.3	Confident	189 Å²	189	96.7 Å²	96.7	71%	0.713	48%	0.484	S	S	*	.	H	α-helix	trans	-67.9	-39.1	177.4	-75.1	-177.6	177.1	-154.1	0.7	111.4	H60 L61 M62 K67 A68	H60-R64 WeakPolarHBondContact O-CG 3.47Å; H60-R64 PolarHBondContact O-N 3.05Å; H60-R64 VanDerWaalsContact O-N 3.16Å; L61-R64 PolarHBondContact O-N 3.49Å; M62-R64 VanDerWaalsContact C-N 3.31Å; M62-R64 PolarHBondContact O-N 3.3Å; R64-K67 PolarHBondContact O-N 3.12Å; R64-A68 WeakPolarHBondContact O-CB 3.46Å; R64-A68 PolarHBondContact O-N 3.03Å
65	L	79.8	Confident	80.1	Confident	54 Å²	54	89.8 Å²	89.8	28%	0.283	46%	0.463	S	S	.	.	H	α-helix	trans	-64.6	-42.4	175.9	-70.3	174.9	0	0	0	111.8	L61 M62 A68 K69 L104	L61-L65 VanDerWaalsContact O-CG 3.26Å; L61-L65 WeakPolarHBondContact O-CG 3.48Å; L61-L65 PolarHBondContact O-N 3.2Å; M62-L65 WeakPolarHBondContact O-CB 3.42Å; M62-L65 PolarHBondContact O-N 3.08Å; M62-L65 VanDerWaalsContact O-N 3.16Å; M62-L65 HydrophobicContact SD-CD1 4.04Å; L65-A68 PolarHBondContact O-N 3.02Å; L65-K69 WeakPolarHBondContact O-CB 3.3Å; L65-K69 VanDerWaalsContact O-CG 3.3Å; L65-K69 WeakPolarHBondContact O-CG 3.49Å; L65-K69 PolarHBondContact O-N 3.27Å; L65-L104 HydrophobicContact CD2-CD1 4.35Å; L65-L104 HydrophobicContact CD2-CD2 3.29Å; L65-L104 HydrophobicContact CD2-CG 4.42Å
66	E	84.6	Confident	79.8	Confident	94 Å²	94	87.9 Å²	87.9	44%	0.439	45%	0.454	S	S	.	.	H	α-helix	trans	-64.3	-43.7	175.9	-75.2	-166.4	-173.9	0	0	112.1	M62 A68 K69 K70	M62-E66 PolarHBondContact O-N 3.3Å; E66-A68 VanDerWaalsContact C-N 3.34Å; E66-A68 PolarHBondContact O-N 3.39Å; E66-K69 PolarHBondContact O-N 2.98Å; E66-K70 WeakPolarHBondContact O-CB 3.49Å; E66-K70 VanDerWaalsContact O-CG 3.31Å; E66-K70 WeakPolarHBondContact O-CG 3.26Å; E66-K70 PolarHBondContact O-N 2.94Å; E66-K70 IonicContact OE2-NZ 3.82Å
67	K	83	Confident	79.5	Confident	144 Å²	144	91.5 Å²	91.5	63%	0.626	47%	0.467	S	S	*	.	H	α-helix	trans	-61.6	-42.9	175.2	-74	172.5	-176.3	172.9	0	111.5	D63 R64 K70 A71	D63-K67 WeakPolarHBondContact O-CB 3.32Å; D63-K67 VanDerWaalsContact O-CG 3.29Å; D63-K67 WeakPolarHBondContact O-CG 3.42Å; D63-K67 PolarHBondContact O-N 3.06Å; R64-K67 PolarHBondContact O-N 3.12Å; K67-K70 PolarHBondContact O-N 3.4Å; K67-A71 WeakPolarHBondContact O-CB 3.5Å; K67-A71 PolarHBondContact O-N 3.47Å
68	A	77.9	Confident	79.2	Confident	45 Å²	45	92.8 Å²	92.8	37%	0.372	47%	0.472	S	S	.	.	H	α-helix	trans	-64.3	-42.2	176.4	0	0	0	0	0	112	R64 L65 E66 A71 A72	R64-A68 WeakPolarHBondContact O-CB 3.46Å; R64-A68 PolarHBondContact O-N 3.03Å; L65-A68 PolarHBondContact O-N 3.02Å; E66-A68 VanDerWaalsContact C-N 3.34Å; E66-A68 PolarHBondContact O-N 3.39Å; A68-A71 PolarHBondContact O-N 2.94Å; A68-A72 WeakPolarHBondContact O-CB 3.39Å; A68-A72 PolarHBondContact O-N 2.88Å
69	K	77.1	Confident	78.8	Confident	134 Å²	134	90.2 Å²	90.2	58%	0.583	46%	0.461	S	S	*	.	H	α-helix	trans	-62.8	-46.4	174.9	-76.4	176.6	-178.5	179.7	0	111.7	L65 E66 A72 I73	L65-K69 WeakPolarHBondContact O-CB 3.3Å; L65-K69 VanDerWaalsContact O-CG 3.3Å; L65-K69 WeakPolarHBondContact O-CG 3.49Å; L65-K69 PolarHBondContact O-N 3.27Å; E66-K69 PolarHBondContact O-N 2.98Å; K69-A72 PolarHBondContact O-N 3.07Å; K69-I73 VanDerWaalsContact O-CG1 3.29Å; K69-I73 WeakPolarHBondContact O-CG1 3.3Å; K69-I73 PolarHBondContact O-N 3.42Å
70	K	81	Confident	78.1	Confident	136 Å²	136	86.2 Å²	86.2	59%	0.591	44%	0.443	S	S	*	.	H	α-helix	trans	-61.1	-44.8	177.5	-73.9	171.8	-179.6	165.9	0	111.1	E66 K67 A72 I73 S74	E66-K70 WeakPolarHBondContact O-CB 3.49Å; E66-K70 VanDerWaalsContact O-CG 3.31Å; E66-K70 WeakPolarHBondContact O-CG 3.26Å; E66-K70 PolarHBondContact O-N 2.94Å; E66-K70 IonicContact OE2-NZ 3.82Å; K67-K70 PolarHBondContact O-N 3.4Å; K70-A72 VanDerWaalsContact C-N 3.35Å; K70-A72 PolarHBondContact O-N 3.38Å; K70-I73 PolarHBondContact O-N 2.95Å; K70-S74 PolarHBondContact O-N 2.86Å; K70-S74 PolarHBondContact O-OG 3.46Å
71	A	77.2	Confident	77.5	Confident	60 Å²	60	87 Å²	87	50%	0.496	45%	0.447	S	S	.	.	H	α-helix	trans	-63.7	-37.8	176	0	0	0	0	0	112.9	K67 A68 S74 G75	K67-A71 WeakPolarHBondContact O-CB 3.5Å; K67-A71 PolarHBondContact O-N 3.47Å; A68-A71 PolarHBondContact O-N 2.94Å; A71-S74 WeakPolarHBondContact CA-OG 3.4Å; A71-S74 PolarHBondContact O-OG 3.34Å; A71-G75 PolarHBondContact O-N 3.47Å
72	A	76.5	Confident	77.3	Confident	32 Å²	32	85 Å²	85	26%	0.264	44%	0.438	S	S	.	.	H	α-helix	trans	-68.1	-38.9	175.7	0	0	0	0	0	112.3	A68 K69 K70 K76	A68-A72 WeakPolarHBondContact O-CB 3.39Å; A68-A72 PolarHBondContact O-N 2.88Å; K69-A72 PolarHBondContact O-N 3.07Å; K70-A72 VanDerWaalsContact C-N 3.35Å; K70-A72 PolarHBondContact O-N 3.38Å; A72-K76 WeakPolarHBondContact O-CG 3.28Å; A72-K76 PolarHBondContact O-N 2.91Å; A72-K76 VanDerWaalsContact O-N 3.09Å
73	I	76.8	Confident	76.6	Confident	94 Å²	94	80.1 Å²	80.1	48%	0.482	41%	0.414	S	S	.	.	H	α-helix	trans	-67.2	-50.2	176	-67	163.8	0	0	0	110	K69 K70 G75 K76 E77	K69-I73 VanDerWaalsContact O-CG1 3.29Å; K69-I73 WeakPolarHBondContact O-CG1 3.3Å; K69-I73 PolarHBondContact O-N 3.42Å; K70-I73 PolarHBondContact O-N 2.95Å; I73-G75 VanDerWaalsContact C-N 3.25Å; I73-G75 PolarHBondContact O-N 3.44Å; I73-K76 WeakPolarHBondContact O-CB 3.23Å; I73-K76 PolarHBondContact O-N 2.89Å; I73-E77 HydrophobicContact CG2-CG 4.43Å; I73-E77 WeakPolarHBondContact O-CG 3.37Å; I73-E77 PolarHBondContact O-N 2.85Å
74	S	78.4	Confident	75.6	Confident	63 Å²	63	83.7 Å²	83.7	44%	0.441	43%	0.426	S	S	.	.	H	α-helix	trans	-61.2	-35.3	179	62.4	0	0	0	0	112.3	K70 A71 E77 S78	K70-S74 PolarHBondContact O-N 2.86Å; K70-S74 PolarHBondContact O-OG 3.46Å; A71-S74 WeakPolarHBondContact CA-OG 3.4Å; A71-S74 PolarHBondContact O-OG 3.34Å; S74-E77 PolarHBondContact O-N 2.87Å; S74-S78 PolarHBondContact O-N 3.4Å; S74-S78 PolarHBondContact O-OG 2.94Å
75	G	78.5	Confident	74.9	Confident	14 Å²	14	82.2 Å²	82.2	14%	0.144	43%	0.427	C	S	.	.	H	α-helix	trans	-67.8	-35.8	174.3	0	0	0	0	0	113.2	A71 I73 S78 L79	A71-G75 PolarHBondContact O-N 3.47Å; I73-G75 VanDerWaalsContact C-N 3.25Å; I73-G75 PolarHBondContact O-N 3.44Å; G75-S78 PolarHBondContact O-OG 3.27Å; G75-S78 VanDerWaalsContact O-OG 3.06Å; G75-L79 WeakPolarHBondContact O-CB 3.39Å; G75-L79 VanDerWaalsContact O-CG 3.27Å; G75-L79 WeakPolarHBondContact O-CG 3.12Å; G75-L79 PolarHBondContact O-N 3.16Å
76	K	73.3	Confident	74.3	Confident	99 Å²	99	84.5 Å²	84.5	43%	0.43	44%	0.439	S	S	.	.	H	α-helix	trans	-68.9	-40.1	173.2	-74.6	177.7	-179	-171.8	0	111.8	A72 I73 A80 V92	A72-K76 WeakPolarHBondContact O-CG 3.28Å; A72-K76 PolarHBondContact O-N 2.91Å; A72-K76 VanDerWaalsContact O-N 3.09Å; I73-K76 WeakPolarHBondContact O-CB 3.23Å; I73-K76 PolarHBondContact O-N 2.89Å; K76-A80 WeakPolarHBondContact O-CB 3.34Å; K76-A80 PolarHBondContact O-N 3.34Å; K76-V92 HydrophobicContact CB-CG2 4.2Å; K76-V92 HydrophobicContact CG-CG2 4.46Å; K76-V92 WeakPolarHBondContact O-CG2 3.42Å
77	E	76.1	Confident	73.3	Confident	129 Å²	129	83.1 Å²	83.1	60%	0.603	45%	0.45	S	S	*	.	H	α-helix	trans	-64	-46.2	177.6	-72.2	174.2	171.2	0	0	111.5	I73 S74 L79 A80 E81	I73-E77 HydrophobicContact CG2-CG 4.43Å; I73-E77 WeakPolarHBondContact O-CG 3.37Å; I73-E77 PolarHBondContact O-N 2.85Å; S74-E77 PolarHBondContact O-N 2.87Å; E77-L79 PolarHBondContact O-N 3.5Å; E77-A80 PolarHBondContact O-N 2.89Å; E77-E81 PolarHBondContact O-N 2.98Å
78	S	74.1	Confident	72.1	Confident	59 Å²	59	82.7 Å²	82.7	41%	0.413	45%	0.449	S	S	.	.	H	α-helix	trans	-64.5	-38.8	178.1	64.4	0	0	0	0	112.8	S74 G75 E81 V82	S74-S78 PolarHBondContact O-N 3.4Å; S74-S78 PolarHBondContact O-OG 2.94Å; G75-S78 PolarHBondContact O-OG 3.27Å; G75-S78 VanDerWaalsContact O-OG 3.06Å; S78-E81 PolarHBondContact O-N 3.37Å; S78-V82 WeakPolarHBondContact O-CG2 3.43Å; S78-V82 PolarHBondContact O-N 2.84Å
79	L	71.3	Confident	70.9	Confident	36 Å²	36	82.1 Å²	82.1	19%	0.188	45%	0.448	C	S	.	.	H	α-helix	trans	-68.3	-33.7	174.6	-71.8	171.5	0	0	0	112.7	G75 E77 E81 G83 V92 W94 A95 Y99	G75-L79 WeakPolarHBondContact O-CB 3.39Å; G75-L79 VanDerWaalsContact O-CG 3.27Å; G75-L79 WeakPolarHBondContact O-CG 3.12Å; G75-L79 PolarHBondContact O-N 3.16Å; E77-L79 PolarHBondContact O-N 3.5Å; L79-E81 VanDerWaalsContact C-N 3.34Å; L79-G83 PolarHBondContact O-N 2.95Å; L79-V92 HydrophobicContact CB-CG1 3.69Å; L79-V92 HydrophobicContact CB-CG2 4.43Å; L79-V92 HydrophobicContact CD1-CG1 3.59Å; L79-V92 HydrophobicContact CG-CG1 4.28Å; L79-W94 WeakPolarHBondContact O-CZ2 3.31Å; L79-W94 PolarHBondContact O-NE1 3.22Å; L79-W94 VanDerWaalsContact O-NE1 3.11Å; L79-A95 HydrophobicContact CD2-CB 4.24Å; L79-Y99 HydrophobicContact CD1-CE2 3.79Å
80	A	68.4	Low	69.8	Low	25 Å²	25	86.2 Å²	86.2	21%	0.207	46%	0.459	C	S	.	.	H	α-helix	trans	-68.4	-35.4	173.9	0	0	0	0	0	111.8	K76 E77 G83 K84 V92	K76-A80 WeakPolarHBondContact O-CB 3.34Å; K76-A80 PolarHBondContact O-N 3.34Å; E77-A80 PolarHBondContact O-N 2.89Å; A80-G83 PolarHBondContact O-N 2.85Å; A80-K84 PolarHBondContact O-N 3.43Å; A80-K84 VanDerWaalsContact O-N 3.08Å; A80-V92 HydrophobicContact CB-CG2 4.45Å
81	E	69.8	Low	68.7	Low	130 Å²	130	83.6 Å²	83.6	61%	0.607	46%	0.455	S	S	*	.	H	α-helix	trans	-67.8	-48	176.3	-169.4	164.4	-149.4	0	0	111.7	E77 S78 L79 G83 K84 E85	E77-E81 PolarHBondContact O-N 2.98Å; S78-E81 PolarHBondContact O-N 3.37Å; L79-E81 VanDerWaalsContact C-N 3.34Å; E81-G83 VanDerWaalsContact C-N 3.27Å; E81-G83 PolarHBondContact O-N 2.87Å; E81-K84 WeakPolarHBondContact O-CB 3.28Å; E81-K84 PolarHBondContact O-N 3.3Å; E81-E85 PolarHBondContact O-N 3.08Å
82	V	72.7	Confident	67.8	Low	61 Å²	61	82.2 Å²	82.2	37%	0.37	44%	0.44	S	S	.	.	H	α-helix	trans	-61	-37.7	174.4	177.2	0	0	0	0	111.2	S78 K84 E85 L86 W94	S78-V82 WeakPolarHBondContact O-CG2 3.43Å; S78-V82 PolarHBondContact O-N 2.84Å; V82-K84 VanDerWaalsContact C-N 3.29Å; V82-K84 PolarHBondContact O-N 3.29Å; V82-E85 PolarHBondContact O-N 3.37Å; V82-L86 HydrophobicContact CG1-CD1 3.79Å; V82-L86 HydrophobicContact CG1-CG 4.28Å; V82-L86 WeakPolarHBondContact O-CB 3.32Å; V82-L86 WeakPolarHBondContact O-CG 3.1Å; V82-L86 PolarHBondContact O-N 2.86Å; V82-W94 HydrophobicContact CB-CH2 4.31Å; V82-W94 HydrophobicContact CB-CZ2 4Å; V82-W94 HydrophobicContact CG1-CH2 3.67Å; V82-W94 HydrophobicContact CG1-CZ2 3.86Å
83	G	65.4	Low	66.8	Low	0 Å²	0	88.6 Å²	88.6	0%	0	46%	0.464	C	S	.	.	H	α-helix	trans	-62.5	-35.3	174.8	0	0	0	0	0	113.8	L79 A80 E81 G87 F88 G89	L79-G83 PolarHBondContact O-N 2.95Å; A80-G83 PolarHBondContact O-N 2.85Å; E81-G83 VanDerWaalsContact C-N 3.27Å; E81-G83 PolarHBondContact O-N 2.87Å; G83-G87 PolarHBondContact O-N 3.34Å; G83-G87 VanDerWaalsContact O-N 3.14Å; G83-F88 PolarHBondContact O-N 3.42Å; G83-G89 CarbonylContact C-O 3.51Å
84	K	64.9	Low	65.8	Low	160 Å²	160	87.9 Å²	87.9	70%	0.696	46%	0.456	S	S	*	.	H	α-helix	trans	-69.2	-42.6	174.4	-171.8	-173.8	175	-167.6	0	111.2	A80 E81 V82 L86 G87	A80-K84 PolarHBondContact O-N 3.43Å; A80-K84 VanDerWaalsContact O-N 3.08Å; E81-K84 WeakPolarHBondContact O-CB 3.28Å; E81-K84 PolarHBondContact O-N 3.3Å; V82-K84 VanDerWaalsContact C-N 3.29Å; V82-K84 PolarHBondContact O-N 3.29Å; K84-L86 VanDerWaalsContact C-N 3.33Å; K84-G87 PolarHBondContact O-N 3.42Å
85	E	66.9	Low	64.8	Low	158 Å²	158	86 Å²	86	74%	0.738	44%	0.444	S	S	*	.	H	α-helix	trans	-64.2	-37.3	176.3	-68.7	-170.7	160.2	0	0	112.4	E81 V82 G87	E81-E85 PolarHBondContact O-N 3.08Å; V82-E85 PolarHBondContact O-N 3.37Å; E85-G87 VanDerWaalsContact C-N 3.33Å
86	L	67	Low	63.6	Low	101 Å²	101	88.6 Å²	88.6	53%	0.529	47%	0.471	S	S	.	.	T	Hydrogen-bonded Turn	trans	-82.7	-4.7	178.2	-66.9	174.5	0	0	0	114.2	V82 K84 F88 W94	V82-L86 HydrophobicContact CG1-CD1 3.79Å; V82-L86 HydrophobicContact CG1-CG 4.28Å; V82-L86 WeakPolarHBondContact O-CB 3.32Å; V82-L86 WeakPolarHBondContact O-CG 3.1Å; V82-L86 PolarHBondContact O-N 2.86Å; K84-L86 VanDerWaalsContact C-N 3.33Å; L86-F88 HydrophobicContact CB-CD2 3.55Å; L86-F88 HydrophobicContact CB-CE2 3.88Å; L86-F88 HydrophobicContact CD1-CD2 4.4Å; L86-F88 HydrophobicContact CD1-CE2 4.46Å; L86-F88 PolarHBondContact O-N 2.94Å; L86-W94 HydrophobicContact CD1-CH2 3.74Å; L86-W94 HydrophobicContact CD1-CZ3 3.79Å
87	G	62.5	Low	62.6	Low	66 Å²	66	91.6 Å²	91.6	68%	0.68	48%	0.48	S	S	*	.	T	Hydrogen-bonded Turn	trans	78.2	11.1	178.6	0	0	0	0	0	115.6	G83 K84 E85 G89	G83-G87 PolarHBondContact O-N 3.34Å; G83-G87 VanDerWaalsContact O-N 3.14Å; K84-G87 PolarHBondContact O-N 3.42Å; E85-G87 VanDerWaalsContact C-N 3.33Å; G87-G89 VanDerWaalsContact C-N 3.35Å
88	F	58	Low	61.4	Low	134 Å²	134	94.5 Å²	94.5	59%	0.588	49%	0.491	S	S	*	.	S	Bend	trans	-84.4	-4.3	-179.8	-70.7	-69.4	0	0	0	114.3	G83 L86 W94	G83-F88 PolarHBondContact O-N 3.42Å; L86-F88 HydrophobicContact CB-CD2 3.55Å; L86-F88 HydrophobicContact CB-CE2 3.88Å; L86-F88 HydrophobicContact CD1-CD2 4.4Å; L86-F88 HydrophobicContact CD1-CE2 4.46Å; L86-F88 PolarHBondContact O-N 2.94Å; F88-W94 HydrophobicContact CB-CB 3.75Å; F88-W94 HydrophobicContact CB-CD2 4.37Å; F88-W94 HydrophobicContact CB-CG 3.86Å; F88-W94 HydrophobicContact CD2-CE3 4.24Å; F88-W94 HydrophobicContact CG-CB 4.26Å
89	G	53	Low	60.1	Low	34 Å²	34	96.9 Å²	96.9	35%	0.351	49%	0.492	S	S	.	.			trans	97.9	177.6	179.3	0	0	0	0	0	113.9	G83 G87 T91	G83-G89 CarbonylContact C-O 3.51Å; G87-G89 VanDerWaalsContact C-N 3.35Å; G89-T91 VanDerWaalsContact C-N 3.31Å; G89-T91 PolarHBondContact O-N 3.46Å
90	R	54.7	Low	59	Low	220 Å²	220	102.7 Å²	102.7	83%	0.83	52%	0.518	S	S	*	.	S	Bend	trans	-78.4	-5.1	-171.2	-85.3	-173.2	-76.1	-170.4	-4.8	115.2
91	T	56.7	Low	58.2	Low	80 Å²	80	107 Å²	107	49%	0.491	54%	0.544	S	S	.	.			trans	-101.1	128.5	-168.9	46.3	0	0	0	0	111	G89 E93	G89-T91 VanDerWaalsContact C-N 3.31Å; G89-T91 PolarHBondContact O-N 3.46Å; T91-E93 PolarHBondContact O-N 3.48Å
92	V	58.3	Low	57.3	Low	31 Å²	31	107 Å²	107	19%	0.188	55%	0.546	C	S	.	.	G	3₁₀ helix	trans	-60.6	-8.4	-178.2	-169	0	0	0	0	113.9	K76 L79 A80 W94 A95	K76-V92 HydrophobicContact CB-CG2 4.2Å; K76-V92 HydrophobicContact CG-CG2 4.46Å; K76-V92 WeakPolarHBondContact O-CG2 3.42Å; L79-V92 HydrophobicContact CB-CG1 3.69Å; L79-V92 HydrophobicContact CB-CG2 4.43Å; L79-V92 HydrophobicContact CD1-CG1 3.59Å; L79-V92 HydrophobicContact CG-CG1 4.28Å; A80-V92 HydrophobicContact CB-CG2 4.45Å; V92-W94 PolarHBondContact O-N 2.75Å; V92-A95 PolarHBondContact O-N 3.02Å
93	E	56.6	Low	56.1	Low	166 Å²	166	109.8 Å²	109.8	78%	0.776	56%	0.559	S	S	*	*	G	3₁₀ helix	trans	-57	-29	179.1	-62.4	-173.7	161.5	0	0	113.7	T91 A95 G96	T91-E93 PolarHBondContact O-N 3.48Å; E93-A95 PolarHBondContact O-N 3.17Å; E93-G96 PolarHBondContact O-N 3.16Å
94	W	54.5	Low	55.4	Low	79 Å²	79	113.5 Å²	113.5	30%	0.299	58%	0.579	S	S	.	*	G	3₁₀ helix	trans	-63.8	-27.5	-179.5	72.5	-99.7	0	0	0	113.1	L79 V82 L86 F88 V92 G96	L79-W94 WeakPolarHBondContact O-CZ2 3.31Å; L79-W94 PolarHBondContact O-NE1 3.22Å; L79-W94 VanDerWaalsContact O-NE1 3.11Å; V82-W94 HydrophobicContact CB-CH2 4.31Å; V82-W94 HydrophobicContact CB-CZ2 4Å; V82-W94 HydrophobicContact CG1-CH2 3.67Å; V82-W94 HydrophobicContact CG1-CZ2 3.86Å; L86-W94 HydrophobicContact CD1-CH2 3.74Å; L86-W94 HydrophobicContact CD1-CZ3 3.79Å; F88-W94 HydrophobicContact CB-CB 3.75Å; F88-W94 HydrophobicContact CB-CD2 4.37Å; F88-W94 HydrophobicContact CB-CG 3.86Å; F88-W94 HydrophobicContact CD2-CE3 4.24Å; F88-W94 HydrophobicContact CG-CB 4.26Å; V92-W94 PolarHBondContact O-N 2.75Å; W94-G96 PolarHBondContact O-N 3.2Å
95	A	57.9	Low	54.7	Low	25 Å²	25	114.7 Å²	114.7	21%	0.207	58%	0.584	C	S	.	*	G	3₁₀ helix	trans	-80.1	-0.5	-177.3	0	0	0	0	0	113.1	L79 V92 E93 Y97	L79-A95 HydrophobicContact CD2-CB 4.24Å; V92-A95 PolarHBondContact O-N 3.02Å; E93-A95 PolarHBondContact O-N 3.17Å; A95-Y97 HydrophobicContact CB-CD2 3.99Å; A95-Y97 VanDerWaalsContact O-CD2 3.23Å; A95-Y97 WeakPolarHBondContact O-CD2 3.25Å; A95-Y97 PolarHBondContact O-N 2.87Å
96	G	54.5	Low	53.9	Low	67 Å²	67	116.3 Å²	116.3	69%	0.691	59%	0.589	S	S	*	*			trans	69.2	-7.4	-179.1	0	0	0	0	0	114.9	E93 W94 K98	E93-G96 PolarHBondContact O-N 3.16Å; W94-G96 PolarHBondContact O-N 3.2Å; G96-K98 PolarHBondContact O-N 3.33Å; G96-K98 VanDerWaalsContact O-N 3.1Å
97	Y	52.3	Low	53.1	Low	162 Å²	162	115.8 Å²	115.8	64%	0.635	59%	0.594	S	S	*	*			trans	-77.6	93.3	173.2	-68.7	-77.1	0	0	0	109.9	A95 Y99	A95-Y97 HydrophobicContact CB-CD2 3.99Å; A95-Y97 VanDerWaalsContact O-CD2 3.23Å; A95-Y97 WeakPolarHBondContact O-CD2 3.25Å; A95-Y97 PolarHBondContact O-N 2.87Å; Y97-Y99 VanDerWaalsContact C-N 3.27Å; Y97-Y99 PolarHBondContact O-N 3.41Å
98	K	49.6	Very low	52.2	Low	191 Å²	191	122.3 Å²	122.3	83%	0.83	61%	0.612	S	S	*	*			trans	-64.7	95.1	156.6	-74.7	-177.4	-179.4	178.8	0	107	G96 E100	G96-K98 PolarHBondContact O-N 3.33Å; G96-K98 VanDerWaalsContact O-N 3.1Å; K98-E100 PolarHBondContact O-N 3.45Å
99	Y	48.2	Very low	51.9	Low	108 Å²	108	121.7 Å²	121.7	42%	0.424	61%	0.613	S	S	.	*			trans	-65.4	85.5	165.3	-88.6	-89.2	0	0	0	107.6	L79 Y97	L79-Y99 HydrophobicContact CD1-CE2 3.79Å; Y97-Y99 VanDerWaalsContact C-N 3.27Å; Y97-Y99 PolarHBondContact O-N 3.41Å
100	E	47	Very low	51.8	Low	159 Å²	159	126.3 Å²	126.3	74%	0.743	63%	0.627	S	S	*	*			trans	-60	128.8	165.6	-67.3	-171.1	167.9	0	0	107.2	K98 I102	K98-E100 PolarHBondContact O-N 3.45Å; E100-I102 PolarHBondContact O-N 2.96Å; E100-I102 VanDerWaalsContact O-N 3.17Å
101	P	51.1	Low	51.7	Low	116 Å²	116	121.1 Å²	121.1	75%	0.753	62%	0.615	S	S	*	*			trans	-56.9	127.2	174.6	24.4	-31.3	0	0	0	107.5	D103	P101-D103 PolarHBondContact O-N 3.03Å
102	I	51.6	Low	51.4	Low	128 Å²	128	123.5 Å²	123.5	66%	0.656	62%	0.623	S	S	*	*			trans	-54.1	107.3	178.5	-59.7	165.7	0	0	0	107.4	E100 L104	E100-I102 PolarHBondContact O-N 2.96Å; E100-I102 VanDerWaalsContact O-N 3.17Å; I102-L104 VanDerWaalsContact C-N 3.32Å; I102-L104 PolarHBondContact O-N 2.99Å
103	D	48.2	Very low	51	Low	120 Å²	120	129.3 Å²	129.3	64%	0.642	65%	0.65	S	S	*	*			trans	-77.4	87.9	-175.2	-149.6	-6.6	0	0	0	108.5	P101 K105 K106	P101-D103 PolarHBondContact O-N 3.03Å; D103-K105 PolarHBondContact O-N 3.08Å; D103-K106 PolarHBondContact O-N 2.9Å
104	L	49.1	Very low	50.6	Low	79 Å²	79	126.9 Å²	126.9	41%	0.414	64%	0.641	S	S	.	*	G	3₁₀ helix	trans	-56.2	-18.6	-170.6	-83.8	145	0	0	0	114.6	L65 I102 K106 S107	L65-L104 HydrophobicContact CD2-CD1 4.35Å; L65-L104 HydrophobicContact CD2-CD2 3.29Å; L65-L104 HydrophobicContact CD2-CG 4.42Å; I102-L104 VanDerWaalsContact C-N 3.32Å; I102-L104 PolarHBondContact O-N 2.99Å; L104-K106 VanDerWaalsContact C-N 3.25Å; L104-K106 PolarHBondContact O-N 3.4Å; L104-S107 PolarHBondContact O-N 2.97Å; L104-S107 PolarHBondContact O-OG 3.13Å; L104-S107 VanDerWaalsContact O-OG 3.08Å
105	K	51	Low	50.3	Low	184 Å²	184	130.3 Å²	130.3	80%	0.8	67%	0.666	S	S	*	*	G	3₁₀ helix	trans	-67.3	-21.1	173.6	-83.6	-172	177	-175.8	0	113.9	D103	D103-K105 PolarHBondContact O-N 3.08Å
106	K	51	Low	49.7	Very low	193 Å²	193	138.4 Å²	138.4	84%	0.839	70%	0.701	S	S	*	*	G	3₁₀ helix	trans	-85.6	-13.6	177.5	-93.3	-177.3	177	176	0	114.2	D103 L104	D103-K106 PolarHBondContact O-N 2.9Å; L104-K106 VanDerWaalsContact C-N 3.25Å; L104-K106 PolarHBondContact O-N 3.4Å
107	S	50.3	Low	49.3	Very low	90 Å²	90	144.3 Å²	144.3	63%	0.629	70%	0.702	S	S	*	*			trans	-101.1	-4.9	-177.9	56.6	0	0	0	0	114.7	L104	L104-S107 PolarHBondContact O-N 2.97Å; L104-S107 PolarHBondContact O-OG 3.13Å; L104-S107 VanDerWaalsContact O-OG 3.08Å
108	L	42.5	Very low	49.1	Very low	202 Å²	202	142.7 Å²	142.7	100%	1.058	71%	0.708	S	S	*	*			trans	-91.1	0	168.3	-82.8	157.8	0	0	0	109.2

Retrieved 108 of 108 residues in 109.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).