A0A077Z775_TRITR Loading...

LYR motif containing protein 5

AlphaFold DB , UniProt , Accession A0A077Z775, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 98 aa.

						>A0A077Z775_TRITR|A0A077Z775
MSKELRYQVVQLYKQLMYMARDYPSGEDYFKQKLRLAFRNKKGITDETQIREALKHGNFVKKELETLYYLKKYRAMKKRYYNNIRILNQTFTMRLAFA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	78.3	Confident	93.6	Very high	116 Å²	116	90.3 Å²	90.3	57%	0.571	42%	0.418	S	S	*	.				0	117	0	-178.8	-179.3	56.9	0	0	109.4	L5 R6 E47 I50	M1-L5 HydrophobicContact CG-CB 3.95Å; M1-L5 HydrophobicContact SD-CB 4.46Å; M1-R6 HydrophobicContact CE-CB 3.48Å; M1-R6 VanDerWaalsContact CE-CB 3.48Å; M1-R6 HydrophobicContact CE-CG 3.63Å; M1-R6 HydrophobicContact SD-CB 4.02Å; M1-E47 WeakPolarHBondContact CA-OE1 3.37Å; M1-I50 HydrophobicContact CB-CD1 4.35Å; M1-I50 HydrophobicContact CG-CD1 4.06Å; M1-I50 HydrophobicContact SD-CD1 4.16Å
2	S	88.3	Confident	93.9	Very high	43 Å²	43	83.3 Å²	83.3	30%	0.301	39%	0.386	S	S	.	.			trans	-51.4	142.8	169.8	172.9	0	0	0	0	113.2	E4 L5 R6 E47	S2-E4 PolarHBondContact O-N 3.44Å; S2-E4 PolarHBondContact OG-N 2.73Å; S2-L5 PolarHBondContact O-N 3.36Å; S2-L5 VanDerWaalsContact O-N 3.16Å; S2-R6 PolarHBondContact O-N 3.1Å; S2-R6 VanDerWaalsContact O-N 3.16Å; S2-E47 PolarHBondContact N-OE1 2.99Å
3	K	93	Very high	94.2	Very high	187 Å²	187	82.7 Å²	82.7	81%	0.813	38%	0.379	S	S	*	.	H	α-helix	trans	-54.7	-33.5	174.3	-174.5	178.5	179.7	-178.7	0	111.7	Y7	K3-Y7 PolarHBondContact O-N 2.92Å; K3-Y7 VanDerWaalsContact O-N 3.11Å
4	E	94.8	Very high	94.5	Very high	110 Å²	110	85.5 Å²	85.5	51%	0.514	39%	0.39	S	S	.	.	H	α-helix	trans	-66	-49.4	177.9	-166.3	-164.1	159.2	0	0	111.8	S2 R6 Y7 Q8	S2-E4 PolarHBondContact O-N 3.44Å; S2-E4 PolarHBondContact OG-N 2.73Å; E4-R6 VanDerWaalsContact C-N 3.3Å; E4-R6 PolarHBondContact O-N 3.18Å; E4-Y7 WeakPolarHBondContact O-CB 3.44Å; E4-Y7 PolarHBondContact O-N 2.98Å; E4-Y7 VanDerWaalsContact O-N 3.11Å; E4-Q8 WeakPolarHBondContact O-CG 3.29Å; E4-Q8 PolarHBondContact O-N 3.11Å; E4-Q8 PolarHBondContact OE1-NE2 3.38Å
5	L	95.4	Very high	94.7	Very high	0 Å²	0	84.7 Å²	84.7	0%	0	39%	0.387	C	S	.	.	H	α-helix	trans	-61.1	-41.2	178.3	-70.9	174	0	0	0	111.2	M1 S2 Y7 Q8 V9 E47 I50 R51 L54	M1-L5 HydrophobicContact CG-CB 3.95Å; M1-L5 HydrophobicContact SD-CB 4.46Å; S2-L5 PolarHBondContact O-N 3.36Å; S2-L5 VanDerWaalsContact O-N 3.16Å; L5-Y7 VanDerWaalsContact C-N 3.31Å; L5-Y7 PolarHBondContact O-N 3.12Å; L5-Q8 PolarHBondContact O-N 3.37Å; L5-V9 VanDerWaalsContact O-CG2 3.3Å; L5-V9 WeakPolarHBondContact O-CG2 3.31Å; L5-V9 PolarHBondContact O-N 2.98Å; L5-E47 HydrophobicContact CD1-CB 3.87Å; L5-E47 HydrophobicContact CD1-CG 3.92Å; L5-I50 HydrophobicContact CB-CG2 4.26Å; L5-I50 HydrophobicContact CD1-CG2 4.38Å; L5-I50 HydrophobicContact CD2-CG2 4.37Å; L5-R51 HydrophobicContact CD2-CG 3.75Å; L5-L54 HydrophobicContact CD2-CD1 3.91Å
6	R	94.3	Very high	94.9	Very high	161 Å²	161	79.8 Å²	79.8	61%	0.608	37%	0.365	S	S	*	.	H	α-helix	trans	-57.5	-45.9	174.4	-171.4	174.5	170.9	96.7	-2.1	111.7	M1 S2 E4 V9 V10	M1-R6 HydrophobicContact CE-CB 3.48Å; M1-R6 VanDerWaalsContact CE-CB 3.48Å; M1-R6 HydrophobicContact CE-CG 3.63Å; M1-R6 HydrophobicContact SD-CB 4.02Å; S2-R6 PolarHBondContact O-N 3.1Å; S2-R6 VanDerWaalsContact O-N 3.16Å; E4-R6 VanDerWaalsContact C-N 3.3Å; E4-R6 PolarHBondContact O-N 3.18Å; R6-V9 PolarHBondContact O-N 2.87Å; R6-V10 VanDerWaalsContact O-CG2 3.32Å; R6-V10 WeakPolarHBondContact O-CG2 3.46Å; R6-V10 PolarHBondContact O-N 3.28Å; R6-V10 VanDerWaalsContact O-N 3.07Å
7	Y	97	Very high	95	Very high	148 Å²	148	77.2 Å²	77.2	58%	0.58	35%	0.354	S	S	*	.	H	α-helix	trans	-61.3	-47.7	178.1	175.7	-94.4	0	0	0	111	K3 E4 L5 V9 V10 Q11	K3-Y7 PolarHBondContact O-N 2.92Å; K3-Y7 VanDerWaalsContact O-N 3.11Å; E4-Y7 WeakPolarHBondContact O-CB 3.44Å; E4-Y7 PolarHBondContact O-N 2.98Å; E4-Y7 VanDerWaalsContact O-N 3.11Å; L5-Y7 VanDerWaalsContact C-N 3.31Å; L5-Y7 PolarHBondContact O-N 3.12Å; Y7-V9 PolarHBondContact O-N 3.01Å; Y7-V10 PolarHBondContact O-N 3.21Å; Y7-Q11 HydrophobicContact CD1-CG 3.98Å; Y7-Q11 HydrophobicContact CD2-CG 4.32Å; Y7-Q11 HydrophobicContact CE1-CG 3.55Å; Y7-Q11 HydrophobicContact CE2-CG 3.95Å; Y7-Q11 HydrophobicContact CG-CG 4.34Å; Y7-Q11 WeakPolarHBondContact O-CB 3.47Å; Y7-Q11 WeakPolarHBondContact O-CG 3.43Å; Y7-Q11 PolarHBondContact O-N 3.44Å; Y7-Q11 PolarHBondContact OH-NE2 3.34Å
8	Q	97	Very high	95	Very high	65 Å²	65	81.2 Å²	81.2	30%	0.304	37%	0.366	S	S	.	.	H	α-helix	trans	-58.9	-44.1	178.7	-67.3	-178.1	32.4	0	0	112.1	E4 L5 V10 Q11 L12 L54	E4-Q8 WeakPolarHBondContact O-CG 3.29Å; E4-Q8 PolarHBondContact O-N 3.11Å; E4-Q8 PolarHBondContact OE1-NE2 3.38Å; L5-Q8 PolarHBondContact O-N 3.37Å; Q8-V10 PolarHBondContact O-N 2.94Å; Q8-Q11 PolarHBondContact O-N 3.46Å; Q8-L12 WeakPolarHBondContact O-CB 3.41Å; Q8-L12 PolarHBondContact O-N 3.24Å; Q8-L54 HydrophobicContact CB-CD1 3.93Å; Q8-L54 HydrophobicContact CB-CD2 4.15Å
9	V	96.6	Very high	95.1	Very high	44 Å²	44	78.1 Å²	78.1	27%	0.267	35%	0.353	S	S	.	.	H	α-helix	trans	-61.4	-45.9	177.5	171.3	0	0	0	0	111.4	L5 R6 Y7 L12 Y13 F38 I50 L54	L5-V9 VanDerWaalsContact O-CG2 3.3Å; L5-V9 WeakPolarHBondContact O-CG2 3.31Å; L5-V9 PolarHBondContact O-N 2.98Å; R6-V9 PolarHBondContact O-N 2.87Å; Y7-V9 PolarHBondContact O-N 3.01Å; V9-L12 PolarHBondContact O-N 3.19Å; V9-Y13 PolarHBondContact O-N 3.27Å; V9-F38 HydrophobicContact CG1-CD1 4.48Å; V9-F38 HydrophobicContact CG1-CE1 4.09Å; V9-I50 HydrophobicContact CG2-CG2 4.13Å; V9-L54 HydrophobicContact CB-CD2 4.37Å; V9-L54 HydrophobicContact CG2-CD1 4.08Å; V9-L54 HydrophobicContact CG2-CD2 3.72Å; V9-L54 HydrophobicContact CG2-CG 3.95Å
10	V	96.7	Very high	95.1	Very high	59 Å²	59	74.2 Å²	74.2	36%	0.358	34%	0.335	S	S	.	.	H	α-helix	trans	-66	-41.6	179.1	171.1	0	0	0	0	111.2	R6 Y7 Q8 Y13 K14	R6-V10 VanDerWaalsContact O-CG2 3.32Å; R6-V10 WeakPolarHBondContact O-CG2 3.46Å; R6-V10 PolarHBondContact O-N 3.28Å; R6-V10 VanDerWaalsContact O-N 3.07Å; Y7-V10 PolarHBondContact O-N 3.21Å; Q8-V10 PolarHBondContact O-N 2.94Å; V10-Y13 PolarHBondContact O-N 3.19Å; V10-K14 HydrophobicContact CG1-CD 4.33Å; V10-K14 WeakPolarHBondContact O-CG 3.47Å; V10-K14 PolarHBondContact O-N 3.09Å
11	Q	97.8	Very high	95	Very high	60 Å²	60	78 Å²	78	28%	0.28	35%	0.347	S	S	.	.	H	α-helix	trans	-62.5	-46.8	176.6	-73.1	-58.2	-29.6	0	0	111.6	Y7 Q8 Y13 K14 Q15	Y7-Q11 HydrophobicContact CD1-CG 3.98Å; Y7-Q11 HydrophobicContact CD2-CG 4.32Å; Y7-Q11 HydrophobicContact CE1-CG 3.55Å; Y7-Q11 HydrophobicContact CE2-CG 3.95Å; Y7-Q11 HydrophobicContact CG-CG 4.34Å; Y7-Q11 WeakPolarHBondContact O-CB 3.47Å; Y7-Q11 WeakPolarHBondContact O-CG 3.43Å; Y7-Q11 PolarHBondContact O-N 3.44Å; Y7-Q11 PolarHBondContact OH-NE2 3.34Å; Q8-Q11 PolarHBondContact O-N 3.46Å; Q11-Y13 VanDerWaalsContact C-N 3.32Å; Q11-Y13 PolarHBondContact O-N 2.9Å; Q11-K14 PolarHBondContact O-N 3.4Å; Q11-Q15 VanDerWaalsContact O-CG 3.32Å; Q11-Q15 WeakPolarHBondContact O-CG 3.21Å; Q11-Q15 PolarHBondContact O-N 2.83Å
12	L	98.1	Very high	95.6	Very high	7 Å²	7	77.4 Å²	77.4	4%	0.037	35%	0.346	C	S	.	.	H	α-helix	trans	-58.6	-44.6	176.7	177.8	64	0	0	0	111.5	Q8 V9 K14 Q15 L16 F38 L54 K61	Q8-L12 WeakPolarHBondContact O-CB 3.41Å; Q8-L12 PolarHBondContact O-N 3.24Å; V9-L12 PolarHBondContact O-N 3.19Å; L12-K14 PolarHBondContact O-N 3.25Å; L12-Q15 PolarHBondContact O-N 3.11Å; L12-L16 HydrophobicContact CD1-CD1 3.94Å; L12-L16 HydrophobicContact CD1-CG 4.19Å; L12-L16 HydrophobicContact CG-CD1 3.97Å; L12-L16 WeakPolarHBondContact O-CG 3.49Å; L12-L16 PolarHBondContact O-N 3.19Å; L12-F38 HydrophobicContact CD2-CZ 4.41Å; L12-F38 HydrophobicContact CG-CZ 4.39Å; L12-L54 HydrophobicContact CB-CD2 4.46Å; L12-L54 HydrophobicContact CD2-CD2 3.91Å; L12-K61 HydrophobicContact CD1-CB 4.47Å; L12-K61 HydrophobicContact CD1-CD 4.38Å
13	Y	97.8	Very high	95.9	Very high	75 Å²	75	78.6 Å²	78.6	29%	0.294	34%	0.344	S	S	.	.	H	α-helix	trans	-59.2	-45.5	176.4	179.4	-101.9	0	0	0	112.1	V9 V10 Q11 L16 M17 L34 F38	V9-Y13 PolarHBondContact O-N 3.27Å; V10-Y13 PolarHBondContact O-N 3.19Å; Q11-Y13 VanDerWaalsContact C-N 3.32Å; Q11-Y13 PolarHBondContact O-N 2.9Å; Y13-L16 PolarHBondContact O-N 3.15Å; Y13-M17 HydrophobicContact CE1-CE 3.82Å; Y13-M17 HydrophobicContact CE2-CE 3.8Å; Y13-M17 VanDerWaalsContact O-CB 3.25Å; Y13-M17 WeakPolarHBondContact O-CB 3.44Å; Y13-M17 PolarHBondContact O-N 3.32Å; Y13-M17 WeakPolarHBondContact OH-CE 3.42Å; Y13-L34 HydrophobicContact CD2-CD2 4.35Å; Y13-L34 HydrophobicContact CD2-CG 4.45Å; Y13-L34 HydrophobicContact CE2-CD2 4.27Å; Y13-L34 HydrophobicContact CE2-CG 4.37Å; Y13-F38 AromaticContact CD2-CD1 3.98Å; Y13-F38 HydrophobicContact CD2-CD1 3.98Å; Y13-F38 AromaticContact CD2-CD2 3.91Å; Y13-F38 HydrophobicContact CD2-CD2 3.91Å; Y13-F38 HydrophobicContact CD2-CE1 4.06Å; Y13-F38 HydrophobicContact CD2-CE2 4.01Å; Y13-F38 AromaticContact CD2-CG 3.9Å; Y13-F38 HydrophobicContact CD2-CG 3.9Å; Y13-F38 HydrophobicContact CD2-CZ 4.07Å; Y13-F38 HydrophobicContact CE2-CD2 4.5Å; Y13-F38 HydrophobicContact CE2-CG 4.45Å; Y13-F38 HydrophobicContact CG-CE1 4.39Å
14	K	97.9	Very high	95.8	Very high	122 Å²	122	74.7 Å²	74.7	53%	0.53	34%	0.338	S	S	.	.	H	α-helix	trans	-64	-41.9	178.1	-73.3	179.6	178.2	-174.7	0	112.2	V10 Q11 L12 M17 Y18	V10-K14 HydrophobicContact CG1-CD 4.33Å; V10-K14 WeakPolarHBondContact O-CG 3.47Å; V10-K14 PolarHBondContact O-N 3.09Å; Q11-K14 PolarHBondContact O-N 3.4Å; L12-K14 PolarHBondContact O-N 3.25Å; K14-M17 PolarHBondContact O-N 3.02Å; K14-Y18 PolarHBondContact O-N 2.96Å
15	Q	97.6	Very high	95.8	Very high	74 Å²	74	73.1 Å²	73.1	35%	0.346	34%	0.339	S	S	.	.	H	α-helix	trans	-63.3	-47.7	177.9	-72.6	175.5	-17	0	0	111.5	Q11 L12 M17 Y18 M19 K61	Q11-Q15 VanDerWaalsContact O-CG 3.32Å; Q11-Q15 WeakPolarHBondContact O-CG 3.21Å; Q11-Q15 PolarHBondContact O-N 2.83Å; L12-Q15 PolarHBondContact O-N 3.11Å; Q15-M17 VanDerWaalsContact C-N 3.32Å; Q15-M17 PolarHBondContact O-N 3.37Å; Q15-Y18 WeakPolarHBondContact O-CB 3.37Å; Q15-Y18 PolarHBondContact O-N 3.16Å; Q15-M19 WeakPolarHBondContact O-CG 3.45Å; Q15-M19 PolarHBondContact O-N 3.27Å; Q15-K61 HydrophobicContact CB-CD 4.48Å; Q15-K61 VanDerWaalsContact CD-NZ 3.26Å
16	L	97.4	Very high	95.8	Very high	6 Å²	6	74.6 Å²	74.6	3%	0.031	36%	0.355	C	S	.	.	H	α-helix	trans	-64.4	-38	176.3	-70.2	170.3	0	0	0	111.7	L12 Y13 Y18 M19 A20 F30 L34 F38 K61 L64	L12-L16 HydrophobicContact CD1-CD1 3.94Å; L12-L16 HydrophobicContact CD1-CG 4.19Å; L12-L16 HydrophobicContact CG-CD1 3.97Å; L12-L16 WeakPolarHBondContact O-CG 3.49Å; L12-L16 PolarHBondContact O-N 3.19Å; Y13-L16 PolarHBondContact O-N 3.15Å; L16-Y18 VanDerWaalsContact C-N 3.31Å; L16-Y18 PolarHBondContact O-N 3.49Å; L16-M19 HydrophobicContact CD2-SD 4.43Å; L16-M19 PolarHBondContact O-N 3.49Å; L16-A20 PolarHBondContact O-N 3.01Å; L16-F30 HydrophobicContact CB-CE1 4.48Å; L16-F30 HydrophobicContact CD2-CZ 4.49Å; L16-F30 VanDerWaalsContact O-CE1 3.32Å; L16-F30 WeakPolarHBondContact O-CE1 3.39Å; L16-L34 HydrophobicContact CB-CD1 3.71Å; L16-L34 HydrophobicContact CB-CD2 3.79Å; L16-L34 HydrophobicContact CB-CG 4.43Å; L16-L34 HydrophobicContact CD1-CD1 3.63Å; L16-L34 HydrophobicContact CG-CD1 4.26Å; L16-F38 HydrophobicContact CD1-CE2 4.14Å; L16-F38 HydrophobicContact CD1-CZ 4.38Å; L16-K61 HydrophobicContact CD2-CB 4.05Å; L16-K61 HydrophobicContact CD2-CG 4.42Å; L16-L64 HydrophobicContact CD2-CD1 3.97Å
17	M	96.8	Very high	95.8	Very high	36 Å²	36	70.3 Å²	70.3	18%	0.177	34%	0.342	C	S	.	.	H	α-helix	trans	-62.4	-38.1	175.3	-169.6	65	63.5	0	0	112.1	Y13 K14 Q15 A20 K31 L34	Y13-M17 HydrophobicContact CE1-CE 3.82Å; Y13-M17 HydrophobicContact CE2-CE 3.8Å; Y13-M17 VanDerWaalsContact O-CB 3.25Å; Y13-M17 WeakPolarHBondContact O-CB 3.44Å; Y13-M17 PolarHBondContact O-N 3.32Å; Y13-M17 WeakPolarHBondContact OH-CE 3.42Å; K14-M17 PolarHBondContact O-N 3.02Å; Q15-M17 VanDerWaalsContact C-N 3.32Å; Q15-M17 PolarHBondContact O-N 3.37Å; M17-A20 VanDerWaalsContact O-CB 3.29Å; M17-A20 WeakPolarHBondContact O-CB 3.07Å; M17-A20 PolarHBondContact O-N 3Å; M17-K31 HydrophobicContact SD-CB 4.42Å; M17-K31 HydrophobicContact SD-CD 3.69Å; M17-K31 VanDerWaalsContact SD-CE 3.57Å; M17-K31 HydrophobicContact SD-CG 3.56Å; M17-K31 VanDerWaalsContact SD-CG 3.56Å; M17-L34 HydrophobicContact CB-CD2 4.43Å; M17-L34 HydrophobicContact CE-CD2 3.93Å
18	Y	96.3	Very high	95.8	Very high	148 Å²	148	68.6 Å²	68.6	58%	0.58	34%	0.343	S	S	*	.	H	α-helix	trans	-67.1	-42.5	175.2	178.3	-95.6	0	0	0	111.7	K14 Q15 L16 A20 R21	K14-Y18 PolarHBondContact O-N 2.96Å; Q15-Y18 WeakPolarHBondContact O-CB 3.37Å; Q15-Y18 PolarHBondContact O-N 3.16Å; L16-Y18 VanDerWaalsContact C-N 3.31Å; L16-Y18 PolarHBondContact O-N 3.49Å; Y18-A20 PolarHBondContact O-N 2.9Å; Y18-R21 VanDerWaalsContact CE2-NH1 3.35Å; Y18-R21 WeakPolarHBondContact O-CG 3.41Å; Y18-R21 PolarHBondContact O-N 3.32Å
19	M	95.7	Very high	95.8	Very high	23 Å²	23	70.8 Å²	70.8	11%	0.113	35%	0.349	C	S	.	.	H	α-helix	trans	-64.1	-18.8	177.5	-71.3	175.7	174.4	0	0	113.8	Q15 L16 R21 K61 L64 E65 Y68	Q15-M19 WeakPolarHBondContact O-CG 3.45Å; Q15-M19 PolarHBondContact O-N 3.27Å; L16-M19 HydrophobicContact CD2-SD 4.43Å; L16-M19 PolarHBondContact O-N 3.49Å; M19-R21 PolarHBondContact O-N 3.42Å; M19-K61 HydrophobicContact CE-CD 4.23Å; M19-K61 HydrophobicContact CE-CG 3.61Å; M19-K61 HydrophobicContact SD-CG 3.8Å; M19-L64 HydrophobicContact SD-CB 4.47Å; M19-E65 HydrophobicContact CE-CG 3.41Å; M19-E65 VanDerWaalsContact CE-CG 3.41Å; M19-E65 WeakPolarHBondContact CE-OE1 3.22Å; M19-E65 HydrophobicContact SD-CG 4.49Å; M19-Y68 HydrophobicContact CB-CE2 4.22Å; M19-Y68 PolarHBondContact O-OH 3.2Å
20	A	94.7	Very high	95.8	Very high	0 Å²	0	69.7 Å²	69.7	0%	0	34%	0.341	C	S	.	.	G	3₁₀ helix	trans	-61.2	-26.9	179.9	0	0	0	0	0	113.6	L16 M17 Y18 D22 Y23 E27 F30 K31	L16-A20 PolarHBondContact O-N 3.01Å; M17-A20 VanDerWaalsContact O-CB 3.29Å; M17-A20 WeakPolarHBondContact O-CB 3.07Å; M17-A20 PolarHBondContact O-N 3Å; Y18-A20 PolarHBondContact O-N 2.9Å; A20-D22 VanDerWaalsContact C-N 3.27Å; A20-D22 PolarHBondContact O-N 2.95Å; A20-Y23 WeakPolarHBondContact O-CB 3.43Å; A20-Y23 PolarHBondContact O-N 3.26Å; A20-E27 HydrophobicContact CB-CG 4.1Å; A20-E27 WeakPolarHBondContact O-CA 3.47Å; A20-F30 HydrophobicContact CB-CB 4.21Å; A20-F30 HydrophobicContact CB-CD1 3.41Å; A20-F30 VanDerWaalsContact CB-CD1 3.41Å; A20-F30 HydrophobicContact CB-CE1 4.1Å; A20-F30 HydrophobicContact CB-CG 4.1Å; A20-K31 HydrophobicContact CB-CG 3.91Å
21	R	93.4	Very high	95.8	Very high	154 Å²	154	68.7 Å²	68.7	58%	0.581	33%	0.332	S	S	*	.	G	3₁₀ helix	trans	-59	-35.8	-173.7	-65.3	173.9	-179.6	-174.7	-0.7	113.5	Y18 M19	Y18-R21 VanDerWaalsContact CE2-NH1 3.35Å; Y18-R21 WeakPolarHBondContact O-CG 3.41Å; Y18-R21 PolarHBondContact O-N 3.32Å; M19-R21 PolarHBondContact O-N 3.42Å
22	D	91	Very high	95.8	Very high	104 Å²	104	72 Å²	72	56%	0.556	35%	0.347	S	S	*	.	G	3₁₀ helix	trans	-101	10.1	-175.8	-65.4	-53.3	0	0	0	113.4	A20 Y68	A20-D22 VanDerWaalsContact C-N 3.27Å; A20-D22 PolarHBondContact O-N 2.95Å; D22-Y68 HydrophobicContact CB-CE1 4Å; D22-Y68 HydrophobicContact CB-CE2 4.47Å; D22-Y68 WeakPolarHBondContact O-CE1 3.49Å
23	Y	94.3	Very high	95.7	Very high	67 Å²	67	77.2 Å²	77.2	26%	0.263	37%	0.369	S	S	.	.			trans	-69	133.1	-172.3	-166.1	-102.5	0	0	0	111.6	A20 S25 G26 Y29 F30 L64 Y68	A20-Y23 WeakPolarHBondContact O-CB 3.43Å; A20-Y23 PolarHBondContact O-N 3.26Å; Y23-S25 VanDerWaalsContact C-N 3.3Å; Y23-S25 PolarHBondContact O-N 3.4Å; Y23-G26 PolarHBondContact O-N 3.16Å; Y23-Y29 HydrophobicContact CD1-CD1 4.22Å; Y23-Y29 AromaticContact CE1-CD1 3.73Å; Y23-Y29 HydrophobicContact CE1-CD1 3.73Å; Y23-Y29 HydrophobicContact CE1-CE1 4Å; Y23-F30 HydrophobicContact CD1-CB 3.83Å; Y23-F30 HydrophobicContact CD1-CD2 4.11Å; Y23-F30 HydrophobicContact CD1-CG 4.44Å; Y23-F30 HydrophobicContact CD2-CB 4.37Å; Y23-F30 AromaticContact CD2-CD2 3.34Å; Y23-F30 HydrophobicContact CD2-CD2 3.34Å; Y23-F30 AromaticContact CD2-CE2 3.91Å; Y23-F30 HydrophobicContact CD2-CE2 3.91Å; Y23-F30 HydrophobicContact CD2-CG 4.13Å; Y23-F30 HydrophobicContact CE1-CB 4.45Å; Y23-F30 HydrophobicContact CE1-CD2 4.25Å; Y23-F30 AromaticContact CE2-CD2 3.5Å; Y23-F30 HydrophobicContact CE2-CD2 3.5Å; Y23-F30 VanDerWaalsContact CE2-CD2 3.5Å; Y23-F30 AromaticContact CE2-CE2 3.93Å; Y23-F30 HydrophobicContact CE2-CE2 3.93Å; Y23-F30 HydrophobicContact CG-CB 3.78Å; Y23-F30 AromaticContact CG-CD2 3.66Å; Y23-F30 HydrophobicContact CG-CD2 3.66Å; Y23-F30 HydrophobicContact CG-CG 4.04Å; Y23-F30 AromaticContact CZ-CD2 3.96Å; Y23-L64 HydrophobicContact CD2-CD2 4.31Å; Y23-L64 HydrophobicContact CE2-CD2 4Å; Y23-Y68 WeakPolarHBondContact CA-OH 3.44Å; Y23-Y68 PolarHBondContact N-OH 3.27Å
24	P	91.9	Very high	95.7	Very high	106 Å²	106	74.4 Å²	74.4	69%	0.688	36%	0.359	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59	-33.8	-171.5	-26.6	34.8	0	0	0	115.5	G26	P24-G26 VanDerWaalsContact C-N 3.28Å
25	S	94	Very high	95.7	Very high	76 Å²	76	74.6 Å²	74.6	53%	0.531	36%	0.357	S	S	.	.	T	Hydrogen-bonded Turn	trans	-88	6.9	179.8	-49.4	0	0	0	0	113.6	Y23	Y23-S25 VanDerWaalsContact C-N 3.3Å; Y23-S25 PolarHBondContact O-N 3.4Å
26	G	94.6	Very high	95.7	Very high	32 Å²	32	75 Å²	75	33%	0.33	36%	0.361	S	S	.	.			trans	97.6	152.7	-176.9	0	0	0	0	0	113.9	Y23 P24 Y29 F30	Y23-G26 PolarHBondContact O-N 3.16Å; P24-G26 VanDerWaalsContact C-N 3.28Å; G26-Y29 PolarHBondContact O-N 2.92Å; G26-F30 PolarHBondContact O-N 3.41Å
27	E	96.1	Very high	95.7	Very high	70 Å²	70	77.1 Å²	77.1	33%	0.327	38%	0.379	S	S	.	.	H	α-helix	trans	-62.1	-46.7	-175.8	-178.5	174.1	-168.5	0	0	112	A20 Y29 F30 K31	A20-E27 HydrophobicContact CB-CG 4.1Å; A20-E27 WeakPolarHBondContact O-CA 3.47Å; E27-Y29 VanDerWaalsContact C-N 3.33Å; E27-Y29 PolarHBondContact O-N 3.05Å; E27-F30 PolarHBondContact O-N 2.9Å; E27-K31 HydrophobicContact CG-CD 3.95Å; E27-K31 VanDerWaalsContact CG-CE 3.42Å; E27-K31 HydrophobicContact CG-CG 4.25Å; E27-K31 WeakPolarHBondContact O-CB 3.3Å; E27-K31 VanDerWaalsContact O-CG 3.3Å; E27-K31 WeakPolarHBondContact O-CG 3.46Å; E27-K31 PolarHBondContact O-N 2.9Å; E27-K31 WeakPolarHBondContact OE1-CE 3.35Å; E27-K31 IonicContact OE1-NZ 3.99Å; E27-K31 PolarHBondContact OE1-NZ 3.04Å; E27-K31 IonicContact OE2-NZ 3.86Å
28	D	96.6	Very high	95.7	Very high	112 Å²	112	78.2 Å²	78.2	60%	0.599	38%	0.383	S	S	*	.	H	α-helix	trans	-64.7	-36.9	-177.8	-72.3	-31.6	0	0	0	112.9	F30 K31 Q32	D28-F30 PolarHBondContact O-N 3.2Å; D28-K31 PolarHBondContact O-N 2.93Å; D28-Q32 WeakPolarHBondContact O-CB 3.44Å; D28-Q32 WeakPolarHBondContact O-CG 3.2Å; D28-Q32 PolarHBondContact O-N 3.03Å; D28-Q32 PolarHBondContact O-NE2 3.47Å
29	Y	96.9	Very high	95.7	Very high	111 Å²	111	79.7 Å²	79.7	44%	0.435	39%	0.387	S	S	.	.	H	α-helix	trans	-58.4	-50.5	175.7	177.1	-90	0	0	0	110.7	Y23 G26 E27 Q32 K33	Y23-Y29 HydrophobicContact CD1-CD1 4.22Å; Y23-Y29 AromaticContact CE1-CD1 3.73Å; Y23-Y29 HydrophobicContact CE1-CD1 3.73Å; Y23-Y29 HydrophobicContact CE1-CE1 4Å; G26-Y29 PolarHBondContact O-N 2.92Å; E27-Y29 VanDerWaalsContact C-N 3.33Å; E27-Y29 PolarHBondContact O-N 3.05Å; Y29-Q32 PolarHBondContact O-N 3.47Å; Y29-K33 HydrophobicContact CE1-CG 4.27Å; Y29-K33 WeakPolarHBondContact O-CG 3.46Å; Y29-K33 PolarHBondContact O-N 3.27Å
30	F	96.6	Very high	95.8	Very high	21 Å²	21	84.3 Å²	84.3	9%	0.092	41%	0.412	C	S	.	.	H	α-helix	trans	-64	-46.8	178.9	-173.9	-87.2	0	0	0	111.5	L16 A20 Y23 G26 E27 D28 Q32 K33 L34 L64	L16-F30 HydrophobicContact CB-CE1 4.48Å; L16-F30 HydrophobicContact CD2-CZ 4.49Å; L16-F30 VanDerWaalsContact O-CE1 3.32Å; L16-F30 WeakPolarHBondContact O-CE1 3.39Å; A20-F30 HydrophobicContact CB-CB 4.21Å; A20-F30 HydrophobicContact CB-CD1 3.41Å; A20-F30 VanDerWaalsContact CB-CD1 3.41Å; A20-F30 HydrophobicContact CB-CE1 4.1Å; A20-F30 HydrophobicContact CB-CG 4.1Å; Y23-F30 HydrophobicContact CD1-CB 3.83Å; Y23-F30 HydrophobicContact CD1-CD2 4.11Å; Y23-F30 HydrophobicContact CD1-CG 4.44Å; Y23-F30 HydrophobicContact CD2-CB 4.37Å; Y23-F30 AromaticContact CD2-CD2 3.34Å; Y23-F30 HydrophobicContact CD2-CD2 3.34Å; Y23-F30 AromaticContact CD2-CE2 3.91Å; Y23-F30 HydrophobicContact CD2-CE2 3.91Å; Y23-F30 HydrophobicContact CD2-CG 4.13Å; Y23-F30 HydrophobicContact CE1-CB 4.45Å; Y23-F30 HydrophobicContact CE1-CD2 4.25Å; Y23-F30 AromaticContact CE2-CD2 3.5Å; Y23-F30 HydrophobicContact CE2-CD2 3.5Å; Y23-F30 VanDerWaalsContact CE2-CD2 3.5Å; Y23-F30 AromaticContact CE2-CE2 3.93Å; Y23-F30 HydrophobicContact CE2-CE2 3.93Å; Y23-F30 HydrophobicContact CG-CB 3.78Å; Y23-F30 AromaticContact CG-CD2 3.66Å; Y23-F30 HydrophobicContact CG-CD2 3.66Å; Y23-F30 HydrophobicContact CG-CG 4.04Å; Y23-F30 AromaticContact CZ-CD2 3.96Å; G26-F30 PolarHBondContact O-N 3.41Å; E27-F30 PolarHBondContact O-N 2.9Å; D28-F30 PolarHBondContact O-N 3.2Å; F30-Q32 VanDerWaalsContact C-N 3.31Å; F30-Q32 PolarHBondContact O-N 3.3Å; F30-K33 PolarHBondContact O-N 3.41Å; F30-L34 HydrophobicContact CD1-CB 4.43Å; F30-L34 HydrophobicContact CE1-CB 4.3Å; F30-L34 HydrophobicContact CE1-CD2 4.14Å; F30-L34 WeakPolarHBondContact O-CB 3.48Å; F30-L34 PolarHBondContact O-N 2.92Å; F30-L64 HydrophobicContact CE2-CD1 3.66Å; F30-L64 HydrophobicContact CE2-CD2 4.19Å; F30-L64 HydrophobicContact CZ-CD1 3.57Å
31	K	97.1	Very high	95.8	Very high	39 Å²	39	89.4 Å²	89.4	17%	0.17	44%	0.435	C	S	.	.	H	α-helix	trans	-59	-40.7	179.6	-73.6	-174.5	177.5	164.6	0	112.4	M17 A20 E27 D28 L34 R35	M17-K31 HydrophobicContact SD-CB 4.42Å; M17-K31 HydrophobicContact SD-CD 3.69Å; M17-K31 VanDerWaalsContact SD-CE 3.57Å; M17-K31 HydrophobicContact SD-CG 3.56Å; M17-K31 VanDerWaalsContact SD-CG 3.56Å; A20-K31 HydrophobicContact CB-CG 3.91Å; E27-K31 HydrophobicContact CG-CD 3.95Å; E27-K31 VanDerWaalsContact CG-CE 3.42Å; E27-K31 HydrophobicContact CG-CG 4.25Å; E27-K31 WeakPolarHBondContact O-CB 3.3Å; E27-K31 VanDerWaalsContact O-CG 3.3Å; E27-K31 WeakPolarHBondContact O-CG 3.46Å; E27-K31 PolarHBondContact O-N 2.9Å; E27-K31 WeakPolarHBondContact OE1-CE 3.35Å; E27-K31 IonicContact OE1-NZ 3.99Å; E27-K31 PolarHBondContact OE1-NZ 3.04Å; E27-K31 IonicContact OE2-NZ 3.86Å; D28-K31 PolarHBondContact O-N 2.93Å; K31-L34 PolarHBondContact O-N 3.4Å; K31-R35 WeakPolarHBondContact O-CB 3.49Å; K31-R35 WeakPolarHBondContact O-CG 3.38Å; K31-R35 PolarHBondContact O-N 2.88Å
32	Q	97.5	Very high	95.8	Very high	129 Å²	129	90.8 Å²	90.8	60%	0.603	45%	0.445	S	S	*	.	H	α-helix	trans	-62.7	-48.1	176.9	-75.5	177.8	63.4	0	0	111.5	D28 Y29 F30 L34 R35 L36	D28-Q32 WeakPolarHBondContact O-CB 3.44Å; D28-Q32 WeakPolarHBondContact O-CG 3.2Å; D28-Q32 PolarHBondContact O-N 3.03Å; D28-Q32 PolarHBondContact O-NE2 3.47Å; Y29-Q32 PolarHBondContact O-N 3.47Å; F30-Q32 VanDerWaalsContact C-N 3.31Å; F30-Q32 PolarHBondContact O-N 3.3Å; Q32-L34 PolarHBondContact O-N 3.45Å; Q32-R35 PolarHBondContact O-N 3.05Å; Q32-L36 WeakPolarHBondContact O-CB 3.33Å; Q32-L36 PolarHBondContact O-N 3.14Å
33	K	96.7	Very high	95.9	Very high	117 Å²	117	89.1 Å²	89.1	51%	0.509	45%	0.452	S	S	.	.	H	α-helix	trans	-61.6	-42.9	176.5	-66.9	-66.4	-173.1	179.8	0	112	Y29 F30 L36 A37	Y29-K33 HydrophobicContact CE1-CG 4.27Å; Y29-K33 WeakPolarHBondContact O-CG 3.46Å; Y29-K33 PolarHBondContact O-N 3.27Å; F30-K33 PolarHBondContact O-N 3.41Å; K33-L36 PolarHBondContact O-N 3.46Å; K33-A37 WeakPolarHBondContact O-CB 3.48Å; K33-A37 PolarHBondContact O-N 3.25Å
34	L	97.1	Very high	95.9	Very high	15 Å²	15	88.2 Å²	88.2	8%	0.079	45%	0.451	C	S	.	.	H	α-helix	trans	-61.3	-50.4	177.2	-175.9	69.1	0	0	0	111.3	Y13 L16 M17 F30 K31 Q32 L36 A37 F38	Y13-L34 HydrophobicContact CD2-CD2 4.35Å; Y13-L34 HydrophobicContact CD2-CG 4.45Å; Y13-L34 HydrophobicContact CE2-CD2 4.27Å; Y13-L34 HydrophobicContact CE2-CG 4.37Å; L16-L34 HydrophobicContact CB-CD1 3.71Å; L16-L34 HydrophobicContact CB-CD2 3.79Å; L16-L34 HydrophobicContact CB-CG 4.43Å; L16-L34 HydrophobicContact CD1-CD1 3.63Å; L16-L34 HydrophobicContact CG-CD1 4.26Å; M17-L34 HydrophobicContact CB-CD2 4.43Å; M17-L34 HydrophobicContact CE-CD2 3.93Å; F30-L34 HydrophobicContact CD1-CB 4.43Å; F30-L34 HydrophobicContact CE1-CB 4.3Å; F30-L34 HydrophobicContact CE1-CD2 4.14Å; F30-L34 WeakPolarHBondContact O-CB 3.48Å; F30-L34 PolarHBondContact O-N 2.92Å; K31-L34 PolarHBondContact O-N 3.4Å; Q32-L34 PolarHBondContact O-N 3.45Å; L34-L36 VanDerWaalsContact C-N 3.3Å; L34-L36 PolarHBondContact O-N 3.37Å; L34-A37 PolarHBondContact O-N 3.5Å; L34-F38 HydrophobicContact CD1-CD2 3.86Å; L34-F38 HydrophobicContact CD1-CE2 3.51Å; L34-F38 HydrophobicContact CG-CD2 4.18Å; L34-F38 HydrophobicContact CG-CE2 4.2Å; L34-F38 WeakPolarHBondContact O-CD2 3.32Å; L34-F38 PolarHBondContact O-N 3.11Å
35	R	97.6	Very high	95.9	Very high	127 Å²	127	88.9 Å²	88.9	48%	0.479	45%	0.454	S	S	.	.	H	α-helix	trans	-59.4	-41.7	178.2	-74.3	170.5	-177.7	176.9	1.9	111.5	K31 Q32 R39	K31-R35 WeakPolarHBondContact O-CB 3.49Å; K31-R35 WeakPolarHBondContact O-CG 3.38Å; K31-R35 PolarHBondContact O-N 2.88Å; Q32-R35 PolarHBondContact O-N 3.05Å; R35-R39 WeakPolarHBondContact O-CB 3.4Å; R35-R39 PolarHBondContact O-N 2.99Å
36	L	97.8	Very high	96	Very high	83 Å²	83	88.2 Å²	88.2	44%	0.435	44%	0.444	S	S	.	.	H	α-helix	trans	-62.6	-46.9	176.1	-177.6	62.7	0	0	0	111.5	Q32 K33 L34 F38 R39 N40	Q32-L36 WeakPolarHBondContact O-CB 3.33Å; Q32-L36 PolarHBondContact O-N 3.14Å; K33-L36 PolarHBondContact O-N 3.46Å; L34-L36 VanDerWaalsContact C-N 3.3Å; L34-L36 PolarHBondContact O-N 3.37Å; L36-F38 PolarHBondContact O-N 3.07Å; L36-R39 PolarHBondContact O-N 3Å; L36-N40 WeakPolarHBondContact O-CB 3.41Å; L36-N40 PolarHBondContact O-N 3.46Å; L36-N40 PolarHBondContact O-OD1 3.39Å
37	A	97.1	Very high	96	Very high	50 Å²	50	89.9 Å²	89.9	41%	0.413	44%	0.444	S	S	.	.	H	α-helix	trans	-59.4	-44.4	179.3	0	0	0	0	0	112.6	K33 L34	K33-A37 WeakPolarHBondContact O-CB 3.48Å; K33-A37 PolarHBondContact O-N 3.25Å; L34-A37 PolarHBondContact O-N 3.5Å
38	F	96.9	Very high	96	Very high	59 Å²	59	90.5 Å²	90.5	26%	0.259	45%	0.452	S	S	.	.	H	α-helix	trans	-69.6	-38.2	175.9	-83.7	-101.7	0	0	0	112.1	V9 L12 Y13 L16 L34 L36 K41 K42	V9-F38 HydrophobicContact CG1-CD1 4.48Å; V9-F38 HydrophobicContact CG1-CE1 4.09Å; L12-F38 HydrophobicContact CD2-CZ 4.41Å; L12-F38 HydrophobicContact CG-CZ 4.39Å; Y13-F38 AromaticContact CD2-CD1 3.98Å; Y13-F38 HydrophobicContact CD2-CD1 3.98Å; Y13-F38 AromaticContact CD2-CD2 3.91Å; Y13-F38 HydrophobicContact CD2-CD2 3.91Å; Y13-F38 HydrophobicContact CD2-CE1 4.06Å; Y13-F38 HydrophobicContact CD2-CE2 4.01Å; Y13-F38 AromaticContact CD2-CG 3.9Å; Y13-F38 HydrophobicContact CD2-CG 3.9Å; Y13-F38 HydrophobicContact CD2-CZ 4.07Å; Y13-F38 HydrophobicContact CE2-CD2 4.5Å; Y13-F38 HydrophobicContact CE2-CG 4.45Å; Y13-F38 HydrophobicContact CG-CE1 4.39Å; L16-F38 HydrophobicContact CD1-CE2 4.14Å; L16-F38 HydrophobicContact CD1-CZ 4.38Å; L34-F38 HydrophobicContact CD1-CD2 3.86Å; L34-F38 HydrophobicContact CD1-CE2 3.51Å; L34-F38 HydrophobicContact CG-CD2 4.18Å; L34-F38 HydrophobicContact CG-CE2 4.2Å; L34-F38 WeakPolarHBondContact O-CD2 3.32Å; L34-F38 PolarHBondContact O-N 3.11Å; L36-F38 PolarHBondContact O-N 3.07Å; F38-K41 PolarHBondContact O-N 3.01Å; F38-K42 PolarHBondContact O-N 3.22Å
39	R	96.8	Very high	95.9	Very high	178 Å²	178	89.6 Å²	89.6	67%	0.672	44%	0.444	S	S	*	.	H	α-helix	trans	-61.6	-43.8	176.6	-176.8	-177	-63.8	-179.9	-1.4	111.8	R35 L36 K41 K42	R35-R39 WeakPolarHBondContact O-CB 3.4Å; R35-R39 PolarHBondContact O-N 2.99Å; L36-R39 PolarHBondContact O-N 3Å; R39-K41 PolarHBondContact O-N 3.38Å; R39-K42 WeakPolarHBondContact O-CB 3.34Å; R39-K42 PolarHBondContact O-N 3.48Å; R39-K42 VanDerWaalsContact O-N 3.09Å
40	N	96.4	Very high	95.9	Very high	120 Å²	120	85 Å²	85	64%	0.642	43%	0.427	S	S	*	.	H	α-helix	trans	-61.9	-25.2	179.4	-68.5	-3.7	0	0	0	112.6	L36	L36-N40 WeakPolarHBondContact O-CB 3.41Å; L36-N40 PolarHBondContact O-N 3.46Å; L36-N40 PolarHBondContact O-OD1 3.39Å
41	K	94.9	Very high	95.9	Very high	107 Å²	107	89.5 Å²	89.5	47%	0.465	44%	0.444	S	S	.	.	T	Hydrogen-bonded Turn	trans	-98	5.4	178.8	-66.2	-173.5	-179.5	-69.7	0	114	F38 R39 G43 I44 A53	F38-K41 PolarHBondContact O-N 3.01Å; R39-K41 PolarHBondContact O-N 3.38Å; K41-G43 PolarHBondContact O-N 2.85Å; K41-I44 HydrophobicContact CB-CD1 3.78Å; K41-I44 HydrophobicContact CB-CG1 4.44Å; K41-I44 HydrophobicContact CD-CD1 4.27Å; K41-I44 HydrophobicContact CG-CD1 3.91Å; K41-I44 WeakPolarHBondContact O-CG1 3.34Å; K41-I44 PolarHBondContact O-N 3.46Å; K41-A53 HydrophobicContact CD-CB 3.9Å
42	K	94	Very high	95.9	Very high	184 Å²	184	94 Å²	94	80%	0.8	47%	0.465	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59	-30.8	-175.9	-178	-175.9	173.3	-169.8	0	113.6	F38 R39	F38-K42 PolarHBondContact O-N 3.22Å; R39-K42 WeakPolarHBondContact O-CB 3.34Å; R39-K42 PolarHBondContact O-N 3.48Å; R39-K42 VanDerWaalsContact O-N 3.09Å
43	G	93.7	Very high	95.9	Very high	69 Å²	69	89 Å²	89	71%	0.711	45%	0.446	S	S	*	.	T	Hydrogen-bonded Turn	trans	-85	-2.8	-176.1	0	0	0	0	0	115.6	K41 T45	K41-G43 PolarHBondContact O-N 2.85Å; G43-T45 PolarHBondContact O-N 3.37Å
44	I	93.7	Very high	95.9	Very high	47 Å²	47	83.9 Å²	83.9	24%	0.241	42%	0.424	C	S	.	.			trans	-72.2	118.2	-178.6	-57.5	177.2	0	0	0	109.2	K41 Q49 I50	K41-I44 HydrophobicContact CB-CD1 3.78Å; K41-I44 HydrophobicContact CB-CG1 4.44Å; K41-I44 HydrophobicContact CD-CD1 4.27Å; K41-I44 HydrophobicContact CG-CD1 3.91Å; K41-I44 WeakPolarHBondContact O-CG1 3.34Å; K41-I44 PolarHBondContact O-N 3.46Å; I44-Q49 HydrophobicContact CG2-CB 3.47Å; I44-Q49 VanDerWaalsContact CG2-CB 3.47Å; I44-I50 HydrophobicContact CB-CG1 4.5Å; I44-I50 HydrophobicContact CG2-CG1 3.82Å
45	T	92.9	Very high	96	Very high	121 Å²	121	91.1 Å²	91.1	74%	0.742	46%	0.455	S	S	*	.			trans	-104.3	-29	179.1	50.7	0	0	0	0	113.1	G43	G43-T45 PolarHBondContact O-N 3.37Å
46	D	94.8	Very high	95.9	Very high	61 Å²	61	90.6 Å²	90.6	33%	0.326	46%	0.458	S	S	.	.			trans	-68.8	127.4	-179.8	175.2	18.2	0	0	0	111.9	T48 Q49 I50	D46-T48 VanDerWaalsContact C-N 3.28Å; D46-T48 VanDerWaalsContact CG-OG1 3.25Å; D46-T48 PolarHBondContact O-N 3.4Å; D46-T48 PolarHBondContact OD1-N 2.9Å; D46-T48 VanDerWaalsContact OD1-N 3.12Å; D46-T48 PolarHBondContact OD1-OG1 3.48Å; D46-T48 PolarHBondContact OD2-OG1 2.88Å; D46-Q49 HydrophobicContact CB-CB 4.36Å; D46-Q49 HydrophobicContact CB-CG 4.32Å; D46-Q49 PolarHBondContact O-N 2.97Å; D46-Q49 WeakPolarHBondContact OD2-CG 3.22Å; D46-Q49 PolarHBondContact OD2-NE2 3.21Å; D46-I50 VanDerWaalsContact O-CG1 3.29Å; D46-I50 WeakPolarHBondContact O-CG1 3.44Å; D46-I50 PolarHBondContact O-N 3.23Å; D46-I50 VanDerWaalsContact O-N 3.1Å
47	E	95.1	Very high	95.9	Very high	68 Å²	68	87.2 Å²	87.2	32%	0.318	44%	0.442	S	S	.	.	H	α-helix	trans	-66.4	-30.3	-176.9	-61.5	-153.6	160.1	0	0	112.8	M1 S2 L5 I50 R51	M1-E47 WeakPolarHBondContact CA-OE1 3.37Å; S2-E47 PolarHBondContact N-OE1 2.99Å; L5-E47 HydrophobicContact CD1-CB 3.87Å; L5-E47 HydrophobicContact CD1-CG 3.92Å; E47-I50 PolarHBondContact O-N 3.42Å; E47-R51 VanDerWaalsContact O-CG 3.31Å; E47-R51 WeakPolarHBondContact O-CG 3.42Å; E47-R51 PolarHBondContact O-N 3.5Å
48	T	95.4	Very high	96	Very high	83 Å²	83	87.9 Å²	87.9	51%	0.509	44%	0.439	S	S	.	.	H	α-helix	trans	-65.9	-49	179	70	0	0	0	0	110.4	D46 I50 R51 E52	D46-T48 VanDerWaalsContact C-N 3.28Å; D46-T48 VanDerWaalsContact CG-OG1 3.25Å; D46-T48 PolarHBondContact O-N 3.4Å; D46-T48 PolarHBondContact OD1-N 2.9Å; D46-T48 VanDerWaalsContact OD1-N 3.12Å; D46-T48 PolarHBondContact OD1-OG1 3.48Å; D46-T48 PolarHBondContact OD2-OG1 2.88Å; T48-I50 VanDerWaalsContact C-N 3.32Å; T48-I50 PolarHBondContact O-N 3.47Å; T48-R51 WeakPolarHBondContact O-CB 3.41Å; T48-R51 PolarHBondContact O-N 2.77Å; T48-R51 VanDerWaalsContact O-N 3.11Å; T48-E52 PolarHBondContact O-N 3.32Å
49	Q	95.9	Very high	96	Very high	92 Å²	92	90.8 Å²	90.8	43%	0.43	45%	0.452	S	S	.	.	H	α-helix	trans	-61.8	-35.8	175	-69.5	175.4	55.4	0	0	112.9	I44 D46 E52 A53	I44-Q49 HydrophobicContact CG2-CB 3.47Å; I44-Q49 VanDerWaalsContact CG2-CB 3.47Å; D46-Q49 HydrophobicContact CB-CB 4.36Å; D46-Q49 HydrophobicContact CB-CG 4.32Å; D46-Q49 PolarHBondContact O-N 2.97Å; D46-Q49 WeakPolarHBondContact OD2-CG 3.22Å; D46-Q49 PolarHBondContact OD2-NE2 3.21Å; Q49-E52 PolarHBondContact O-N 3.27Å; Q49-A53 WeakPolarHBondContact O-CB 3.1Å; Q49-A53 PolarHBondContact O-N 3.25Å
50	I	96.2	Very high	96	Very high	14 Å²	14	84.6 Å²	84.6	7%	0.072	43%	0.434	C	S	.	.	H	α-helix	trans	-64.3	-43.1	174.4	-66.4	167.8	0	0	0	110.5	M1 L5 V9 I44 D46 E47 T48 A53 L54	M1-I50 HydrophobicContact CB-CD1 4.35Å; M1-I50 HydrophobicContact CG-CD1 4.06Å; M1-I50 HydrophobicContact SD-CD1 4.16Å; L5-I50 HydrophobicContact CB-CG2 4.26Å; L5-I50 HydrophobicContact CD1-CG2 4.38Å; L5-I50 HydrophobicContact CD2-CG2 4.37Å; V9-I50 HydrophobicContact CG2-CG2 4.13Å; I44-I50 HydrophobicContact CB-CG1 4.5Å; I44-I50 HydrophobicContact CG2-CG1 3.82Å; D46-I50 VanDerWaalsContact O-CG1 3.29Å; D46-I50 WeakPolarHBondContact O-CG1 3.44Å; D46-I50 PolarHBondContact O-N 3.23Å; D46-I50 VanDerWaalsContact O-N 3.1Å; E47-I50 PolarHBondContact O-N 3.42Å; T48-I50 VanDerWaalsContact C-N 3.32Å; T48-I50 PolarHBondContact O-N 3.47Å; I50-A53 PolarHBondContact O-N 2.91Å; I50-L54 HydrophobicContact CG2-CD1 4.14Å; I50-L54 WeakPolarHBondContact O-CB 3.38Å; I50-L54 WeakPolarHBondContact O-CG 3.4Å; I50-L54 PolarHBondContact O-N 3.19Å
51	R	96.7	Very high	96	Very high	117 Å²	117	80.5 Å²	80.5	44%	0.442	41%	0.41	S	S	.	.	H	α-helix	trans	-64.6	-39.9	177.5	-71.4	173.5	-170.5	-79.4	-0.3	111.8	L5 E47 T48 L54 K55	L5-R51 HydrophobicContact CD2-CG 3.75Å; E47-R51 VanDerWaalsContact O-CG 3.31Å; E47-R51 WeakPolarHBondContact O-CG 3.42Å; E47-R51 PolarHBondContact O-N 3.5Å; T48-R51 WeakPolarHBondContact O-CB 3.41Å; T48-R51 PolarHBondContact O-N 2.77Å; T48-R51 VanDerWaalsContact O-N 3.11Å; R51-L54 PolarHBondContact O-N 2.99Å; R51-K55 WeakPolarHBondContact O-CB 3.41Å; R51-K55 PolarHBondContact O-N 3.48Å
52	E	97	Very high	96.2	Very high	134 Å²	134	82 Å²	82	63%	0.626	42%	0.417	S	S	*	.	H	α-helix	trans	-63.7	-44.6	174	-70.8	-177.4	166.7	0	0	112	T48 Q49 L54 K55 H56	T48-E52 PolarHBondContact O-N 3.32Å; Q49-E52 PolarHBondContact O-N 3.27Å; E52-L54 VanDerWaalsContact C-N 3.33Å; E52-L54 PolarHBondContact O-N 2.91Å; E52-K55 WeakPolarHBondContact O-CB 3.32Å; E52-K55 PolarHBondContact O-N 3.2Å; E52-H56 PolarHBondContact O-N 3.4Å
53	A	96.9	Very high	96.3	Very high	24 Å²	24	77.6 Å²	77.6	20%	0.198	40%	0.399	C	S	.	.	H	α-helix	trans	-62	-40.1	175.8	0	0	0	0	0	112.2	K41 Q49 I50 H56 G57	K41-A53 HydrophobicContact CD-CB 3.9Å; Q49-A53 WeakPolarHBondContact O-CB 3.1Å; Q49-A53 PolarHBondContact O-N 3.25Å; I50-A53 PolarHBondContact O-N 2.91Å; A53-H56 PolarHBondContact O-N 3.23Å; A53-G57 PolarHBondContact O-N 2.96Å
54	L	97.3	Very high	96.4	Very high	9 Å²	9	75 Å²	75	5%	0.047	37%	0.369	C	S	.	.	H	α-helix	trans	-63.6	-43.8	173	-81	170.4	0	0	0	112	L5 Q8 V9 L12 I50 R51 E52 H56 G57 N58	L5-L54 HydrophobicContact CD2-CD1 3.91Å; Q8-L54 HydrophobicContact CB-CD1 3.93Å; Q8-L54 HydrophobicContact CB-CD2 4.15Å; V9-L54 HydrophobicContact CB-CD2 4.37Å; V9-L54 HydrophobicContact CG2-CD1 4.08Å; V9-L54 HydrophobicContact CG2-CD2 3.72Å; V9-L54 HydrophobicContact CG2-CG 3.95Å; L12-L54 HydrophobicContact CB-CD2 4.46Å; L12-L54 HydrophobicContact CD2-CD2 3.91Å; I50-L54 HydrophobicContact CG2-CD1 4.14Å; I50-L54 WeakPolarHBondContact O-CB 3.38Å; I50-L54 WeakPolarHBondContact O-CG 3.4Å; I50-L54 PolarHBondContact O-N 3.19Å; R51-L54 PolarHBondContact O-N 2.99Å; E52-L54 VanDerWaalsContact C-N 3.33Å; E52-L54 PolarHBondContact O-N 2.91Å; L54-H56 VanDerWaalsContact C-N 3.34Å; L54-H56 PolarHBondContact O-N 3.46Å; L54-G57 PolarHBondContact O-N 2.96Å; L54-N58 WeakPolarHBondContact O-CB 3.19Å; L54-N58 PolarHBondContact O-N 3.49Å; L54-N58 PolarHBondContact O-ND2 2.96Å
55	K	97.9	Very high	96.5	Very high	167 Å²	167	75.7 Å²	75.7	73%	0.726	37%	0.371	S	S	*	.	H	α-helix	trans	-58.8	-47.2	176.2	-178	179.6	177.8	-177.1	0	110.8	R51 E52 N58 F59	R51-K55 WeakPolarHBondContact O-CB 3.41Å; R51-K55 PolarHBondContact O-N 3.48Å; E52-K55 WeakPolarHBondContact O-CB 3.32Å; E52-K55 PolarHBondContact O-N 3.2Å; K55-N58 PolarHBondContact O-N 3.03Å; K55-F59 PolarHBondContact O-N 3.46Å
56	H	97.3	Very high	96.7	Very high	116 Å²	116	74.1 Å²	74.1	54%	0.537	36%	0.361	S	S	.	.	H	α-helix	trans	-61.8	-46.6	176	178.4	-97.2	0	0	0	112.1	E52 A53 L54 N58 F59 V60	E52-H56 PolarHBondContact O-N 3.4Å; A53-H56 PolarHBondContact O-N 3.23Å; L54-H56 VanDerWaalsContact C-N 3.34Å; L54-H56 PolarHBondContact O-N 3.46Å; H56-N58 VanDerWaalsContact C-N 3.33Å; H56-N58 PolarHBondContact O-N 3.37Å; H56-F59 WeakPolarHBondContact O-CB 3.35Å; H56-F59 PolarHBondContact O-N 3.02Å; H56-F59 VanDerWaalsContact O-N 3.15Å; H56-V60 PolarHBondContact O-N 3.33Å
57	G	97.6	Very high	96.7	Very high	11 Å²	11	76.1 Å²	76.1	11%	0.113	37%	0.371	C	S	.	.	H	α-helix	trans	-65.4	-35	179.2	0	0	0	0	0	113.6	A53 L54 V60 K61	A53-G57 PolarHBondContact O-N 2.96Å; L54-G57 PolarHBondContact O-N 2.96Å; G57-V60 PolarHBondContact O-N 3.18Å; G57-K61 WeakPolarHBondContact O-CB 3.4Å; G57-K61 PolarHBondContact O-N 3.5Å
58	N	98.1	Very high	96.7	Very high	64 Å²	64	75.1 Å²	75.1	34%	0.342	37%	0.365	S	S	.	.	H	α-helix	trans	-67.8	-33.6	172.1	-79.9	-51.1	0	0	0	112.8	L54 K55 H56 K62	L54-N58 WeakPolarHBondContact O-CB 3.19Å; L54-N58 PolarHBondContact O-N 3.49Å; L54-N58 PolarHBondContact O-ND2 2.96Å; K55-N58 PolarHBondContact O-N 3.03Å; H56-N58 VanDerWaalsContact C-N 3.33Å; H56-N58 PolarHBondContact O-N 3.37Å; N58-K62 WeakPolarHBondContact O-CG 3.11Å; N58-K62 PolarHBondContact O-N 3.35Å; N58-K62 VanDerWaalsContact O-N 3.14Å
59	F	98.1	Very high	96.6	Very high	121 Å²	121	78.8 Å²	78.8	53%	0.531	37%	0.371	S	S	.	.	H	α-helix	trans	-61.9	-52.3	172.1	174.2	-96.3	0	0	0	110.7	K55 H56 K61 K62 E63	K55-F59 PolarHBondContact O-N 3.46Å; H56-F59 WeakPolarHBondContact O-CB 3.35Å; H56-F59 PolarHBondContact O-N 3.02Å; H56-F59 VanDerWaalsContact O-N 3.15Å; F59-K61 VanDerWaalsContact C-N 3.27Å; F59-K61 PolarHBondContact O-N 2.89Å; F59-K62 WeakPolarHBondContact O-CB 3.32Å; F59-K62 PolarHBondContact O-N 3.45Å; F59-E63 HydrophobicContact CD1-CG 4.37Å; F59-E63 WeakPolarHBondContact CD1-OE2 3.47Å; F59-E63 HydrophobicContact CE1-CG 3.98Å; F59-E63 WeakPolarHBondContact CE1-OE1 3.37Å; F59-E63 WeakPolarHBondContact CE1-OE2 3.49Å; F59-E63 HydrophobicContact CZ-CG 4.06Å; F59-E63 PolarHBondContact O-N 3.4Å
60	V	96.1	Very high	96.6	Very high	47 Å²	47	77.6 Å²	77.6	29%	0.285	37%	0.367	S	S	.	.	H	α-helix	trans	-57.4	-40.8	176.9	174.3	0	0	0	0	111.8	H56 G57 K62 E63 L64	H56-V60 PolarHBondContact O-N 3.33Å; G57-V60 PolarHBondContact O-N 3.18Å; V60-K62 PolarHBondContact O-N 2.91Å; V60-E63 PolarHBondContact O-N 3.39Å; V60-L64 HydrophobicContact CG1-CD1 4.23Å; V60-L64 WeakPolarHBondContact O-CG 3.25Å; V60-L64 PolarHBondContact O-N 3.38Å
61	K	97.2	Very high	96.5	Very high	34 Å²	34	82.7 Å²	82.7	15%	0.148	39%	0.389	C	S	.	.	H	α-helix	trans	-57.3	-48	175.3	-177.2	-169.6	164	-167.2	0	111.8	L12 Q15 L16 M19 G57 F59 E63 L64 E65	L12-K61 HydrophobicContact CD1-CB 4.47Å; L12-K61 HydrophobicContact CD1-CD 4.38Å; Q15-K61 HydrophobicContact CB-CD 4.48Å; Q15-K61 VanDerWaalsContact CD-NZ 3.26Å; L16-K61 HydrophobicContact CD2-CB 4.05Å; L16-K61 HydrophobicContact CD2-CG 4.42Å; M19-K61 HydrophobicContact CE-CD 4.23Å; M19-K61 HydrophobicContact CE-CG 3.61Å; M19-K61 HydrophobicContact SD-CG 3.8Å; G57-K61 WeakPolarHBondContact O-CB 3.4Å; G57-K61 PolarHBondContact O-N 3.5Å; F59-K61 VanDerWaalsContact C-N 3.27Å; F59-K61 PolarHBondContact O-N 2.89Å; K61-E63 VanDerWaalsContact C-N 3.33Å; K61-E63 PolarHBondContact O-N 3.43Å; K61-L64 PolarHBondContact O-N 3.27Å; K61-E65 WeakPolarHBondContact CE-OE1 3.44Å; K61-E65 IonicContact NZ-OE1 2.59Å; K61-E65 WeakPolarHBondContact O-CG 3.48Å; K61-E65 PolarHBondContact O-N 3.38Å
62	K	97.7	Very high	96.4	Very high	140 Å²	140	84.4 Å²	84.4	61%	0.609	40%	0.399	S	S	*	.	H	α-helix	trans	-64.3	-36.7	178.7	-73.7	178.8	176.3	-175.5	0	112.3	N58 F59 V60 E65 T66	N58-K62 WeakPolarHBondContact O-CG 3.11Å; N58-K62 PolarHBondContact O-N 3.35Å; N58-K62 VanDerWaalsContact O-N 3.14Å; F59-K62 WeakPolarHBondContact O-CB 3.32Å; F59-K62 PolarHBondContact O-N 3.45Å; V60-K62 PolarHBondContact O-N 2.91Å; K62-E65 PolarHBondContact O-N 2.91Å; K62-T66 WeakPolarHBondContact O-CB 3.05Å; K62-T66 PolarHBondContact O-N 3.2Å; K62-T66 PolarHBondContact O-OG1 3.27Å
63	E	96.2	Very high	96.3	Very high	90 Å²	90	83.8 Å²	83.8	42%	0.421	39%	0.392	S	S	.	.	H	α-helix	trans	-62.4	-46.7	174	-68.3	-175.1	111.6	0	0	111.1	F59 V60 K61 E65 T66 L67	F59-E63 HydrophobicContact CD1-CG 4.37Å; F59-E63 WeakPolarHBondContact CD1-OE2 3.47Å; F59-E63 HydrophobicContact CE1-CG 3.98Å; F59-E63 WeakPolarHBondContact CE1-OE1 3.37Å; F59-E63 WeakPolarHBondContact CE1-OE2 3.49Å; F59-E63 HydrophobicContact CZ-CG 4.06Å; F59-E63 PolarHBondContact O-N 3.4Å; V60-E63 PolarHBondContact O-N 3.39Å; K61-E63 VanDerWaalsContact C-N 3.33Å; K61-E63 PolarHBondContact O-N 3.43Å; E63-E65 PolarHBondContact O-N 2.85Å; E63-T66 WeakPolarHBondContact O-CB 3.32Å; E63-T66 PolarHBondContact O-N 3.43Å; E63-L67 WeakPolarHBondContact O-CG 3.48Å; E63-L67 PolarHBondContact O-N 3.43Å
64	L	95.9	Very high	96.1	Very high	16 Å²	16	90.5 Å²	90.5	8%	0.084	41%	0.412	C	S	.	.	H	α-helix	trans	-60.6	-45.2	176.9	-70.6	170.7	0	0	0	112.2	L16 M19 Y23 F30 V60 K61 T66 L67 Y68	L16-L64 HydrophobicContact CD2-CD1 3.97Å; M19-L64 HydrophobicContact SD-CB 4.47Å; Y23-L64 HydrophobicContact CD2-CD2 4.31Å; Y23-L64 HydrophobicContact CE2-CD2 4Å; F30-L64 HydrophobicContact CE2-CD1 3.66Å; F30-L64 HydrophobicContact CE2-CD2 4.19Å; F30-L64 HydrophobicContact CZ-CD1 3.57Å; V60-L64 HydrophobicContact CG1-CD1 4.23Å; V60-L64 WeakPolarHBondContact O-CG 3.25Å; V60-L64 PolarHBondContact O-N 3.38Å; K61-L64 PolarHBondContact O-N 3.27Å; L64-T66 VanDerWaalsContact C-N 3.3Å; L64-T66 PolarHBondContact O-N 3.37Å; L64-L67 PolarHBondContact O-N 3.28Å; L64-Y68 WeakPolarHBondContact O-CD2 3.3Å; L64-Y68 PolarHBondContact O-N 3.48Å
65	E	95.7	Very high	95.9	Very high	61 Å²	61	92.4 Å²	92.4	29%	0.285	43%	0.43	S	S	.	.	H	α-helix	trans	-56	-47.1	173.9	-72.6	171.4	167.6	0	0	111	M19 K61 K62 E63 L67 Y68 Y69	M19-E65 HydrophobicContact CE-CG 3.41Å; M19-E65 VanDerWaalsContact CE-CG 3.41Å; M19-E65 WeakPolarHBondContact CE-OE1 3.22Å; M19-E65 HydrophobicContact SD-CG 4.49Å; K61-E65 WeakPolarHBondContact CE-OE1 3.44Å; K61-E65 IonicContact NZ-OE1 2.59Å; K61-E65 WeakPolarHBondContact O-CG 3.48Å; K61-E65 PolarHBondContact O-N 3.38Å; K62-E65 PolarHBondContact O-N 2.91Å; E63-E65 PolarHBondContact O-N 2.85Å; E65-L67 PolarHBondContact O-N 3.28Å; E65-Y68 PolarHBondContact O-N 2.89Å; E65-Y69 HydrophobicContact CB-CE2 4.19Å; E65-Y69 WeakPolarHBondContact O-CD2 3.38Å; E65-Y69 PolarHBondContact O-N 3.24Å
66	T	96.8	Very high	95.7	Very high	88 Å²	88	88.7 Å²	88.7	54%	0.54	42%	0.416	S	S	.	.	H	α-helix	trans	-60.5	-43.6	178.5	-57.5	0	0	0	0	111.8	K62 E63 L64 Y68 Y69 L70	K62-T66 WeakPolarHBondContact O-CB 3.05Å; K62-T66 PolarHBondContact O-N 3.2Å; K62-T66 PolarHBondContact O-OG1 3.27Å; E63-T66 WeakPolarHBondContact O-CB 3.32Å; E63-T66 PolarHBondContact O-N 3.43Å; L64-T66 VanDerWaalsContact C-N 3.3Å; L64-T66 PolarHBondContact O-N 3.37Å; T66-Y68 VanDerWaalsContact C-N 3.35Å; T66-Y68 PolarHBondContact O-N 2.91Å; T66-Y69 PolarHBondContact O-N 2.91Å; T66-L70 WeakPolarHBondContact O-CB 3.43Å; T66-L70 PolarHBondContact O-N 3Å
67	L	95	Very high	95.4	Very high	103 Å²	103	88.3 Å²	88.3	54%	0.539	41%	0.413	S	S	.	.	H	α-helix	trans	-64.2	-39.1	177	-69.2	176.1	0	0	0	112	E63 L64 E65 L70 K71	E63-L67 WeakPolarHBondContact O-CG 3.48Å; E63-L67 PolarHBondContact O-N 3.43Å; L64-L67 PolarHBondContact O-N 3.28Å; E65-L67 PolarHBondContact O-N 3.28Å; L67-L70 PolarHBondContact O-N 3.44Å; L67-K71 WeakPolarHBondContact O-CB 3.42Å; L67-K71 PolarHBondContact O-N 2.99Å
68	Y	94.6	Very high	95	Very high	47 Å²	47	94.3 Å²	94.3	18%	0.184	44%	0.435	C	S	.	.	H	α-helix	trans	-66.5	-41.6	174.6	-68.4	-28.5	0	0	0	112.4	M19 D22 Y23 L64 E65 T66 L70 K71 K72	M19-Y68 HydrophobicContact CB-CE2 4.22Å; M19-Y68 PolarHBondContact O-OH 3.2Å; D22-Y68 HydrophobicContact CB-CE1 4Å; D22-Y68 HydrophobicContact CB-CE2 4.47Å; D22-Y68 WeakPolarHBondContact O-CE1 3.49Å; Y23-Y68 WeakPolarHBondContact CA-OH 3.44Å; Y23-Y68 PolarHBondContact N-OH 3.27Å; L64-Y68 WeakPolarHBondContact O-CD2 3.3Å; L64-Y68 PolarHBondContact O-N 3.48Å; E65-Y68 PolarHBondContact O-N 2.89Å; T66-Y68 VanDerWaalsContact C-N 3.35Å; T66-Y68 PolarHBondContact O-N 2.91Å; Y68-L70 VanDerWaalsContact C-N 3.34Å; Y68-L70 PolarHBondContact O-N 3.18Å; Y68-K71 PolarHBondContact O-N 2.59Å; Y68-K72 PolarHBondContact O-N 2.65Å
69	Y	95	Very high	94.6	Very high	159 Å²	159	100.6 Å²	100.6	62%	0.624	46%	0.455	S	S	*	.	H	α-helix	trans	-61.3	-42.5	172.2	-70.1	-53.2	0	0	0	112.1	E65 T66 K72 Y73	E65-Y69 HydrophobicContact CB-CE2 4.19Å; E65-Y69 WeakPolarHBondContact O-CD2 3.38Å; E65-Y69 PolarHBondContact O-N 3.24Å; T66-Y69 PolarHBondContact O-N 2.91Å; Y69-K72 PolarHBondContact O-N 3.43Å; Y69-Y73 WeakPolarHBondContact O-CB 3.33Å; Y69-Y73 PolarHBondContact O-N 3.2Å
70	L	95.8	Very high	94.1	Very high	68 Å²	68	102.8 Å²	102.8	36%	0.356	46%	0.46	S	S	.	.	H	α-helix	trans	-64.5	-41.8	178	-177.1	60.4	0	0	0	111.9	T66 L67 Y68 Y73 R74	T66-L70 WeakPolarHBondContact O-CB 3.43Å; T66-L70 PolarHBondContact O-N 3Å; L67-L70 PolarHBondContact O-N 3.44Å; Y68-L70 VanDerWaalsContact C-N 3.34Å; Y68-L70 PolarHBondContact O-N 3.18Å; L70-Y73 PolarHBondContact O-N 3.34Å; L70-R74 HydrophobicContact CD1-CG 4.45Å; L70-R74 WeakPolarHBondContact O-CB 3.29Å; L70-R74 WeakPolarHBondContact O-CG 3.44Å; L70-R74 PolarHBondContact O-N 3.45Å
71	K	93.4	Very high	93.5	Very high	121 Å²	121	107 Å²	107	53%	0.526	47%	0.472	S	S	.	.	H	α-helix	trans	-58.3	-47.4	173.5	-179.8	179.5	175.9	-175.3	0	110.7	L67 Y68 R74 A75	L67-K71 WeakPolarHBondContact O-CB 3.42Å; L67-K71 PolarHBondContact O-N 2.99Å; Y68-K71 PolarHBondContact O-N 2.59Å; K71-R74 PolarHBondContact O-N 3.49Å; K71-A75 PolarHBondContact O-N 2.99Å; K71-A75 VanDerWaalsContact O-N 3.08Å
72	K	94	Very high	92.2	Very high	153 Å²	153	108.3 Å²	108.3	67%	0.665	48%	0.481	S	S	*	.	H	α-helix	trans	-60.3	-46.8	176.1	-178	177	178.2	179.4	0	111.7	Y68 Y69 R74 A75 M76	Y68-K72 PolarHBondContact O-N 2.65Å; Y69-K72 PolarHBondContact O-N 3.43Å; K72-R74 PolarHBondContact O-N 2.81Å; K72-A75 PolarHBondContact O-N 3.26Å; K72-M76 WeakPolarHBondContact O-CB 2.97Å; K72-M76 PolarHBondContact O-N 3.45Å
73	Y	95.8	Very high	90.5	Very high	121 Å²	121	106.6 Å²	106.6	48%	0.475	48%	0.478	S	S	.	.	H	α-helix	trans	-60.2	-45.8	177.8	173.3	-98.4	0	0	0	112.2	Y69 L70 A75 M76 K77	Y69-Y73 WeakPolarHBondContact O-CB 3.33Å; Y69-Y73 PolarHBondContact O-N 3.2Å; L70-Y73 PolarHBondContact O-N 3.34Å; Y73-A75 PolarHBondContact O-N 2.97Å; Y73-M76 HydrophobicContact CD2-CE 4.13Å; Y73-M76 PolarHBondContact O-N 3.33Å; Y73-K77 HydrophobicContact CE1-CD 4.02Å; Y73-K77 WeakPolarHBondContact O-CB 3.44Å; Y73-K77 PolarHBondContact O-N 3.45Å
74	R	93.3	Very high	88.9	Confident	164 Å²	164	106.1 Å²	106.1	62%	0.619	48%	0.478	S	S	*	.	H	α-helix	trans	-60.8	-42.9	177.5	-73.9	174.6	177.9	178.2	-1.3	112	L70 K71 K72 K78	L70-R74 HydrophobicContact CD1-CG 4.45Å; L70-R74 WeakPolarHBondContact O-CB 3.29Å; L70-R74 WeakPolarHBondContact O-CG 3.44Å; L70-R74 PolarHBondContact O-N 3.45Å; K71-R74 PolarHBondContact O-N 3.49Å; K72-R74 PolarHBondContact O-N 2.81Å; R74-K78 WeakPolarHBondContact O-CB 3.35Å; R74-K78 PolarHBondContact O-N 3.08Å
75	A	92.2	Very high	87.2	Confident	50 Å²	50	113.8 Å²	113.8	41%	0.413	51%	0.505	S	S	.	.	H	α-helix	trans	-63.1	-43.8	176.2	0	0	0	0	0	111.9	K71 K72 Y73 K78 R79	K71-A75 PolarHBondContact O-N 2.99Å; K71-A75 VanDerWaalsContact O-N 3.08Å; K72-A75 PolarHBondContact O-N 3.26Å; Y73-A75 PolarHBondContact O-N 2.97Å; A75-K78 PolarHBondContact O-N 3.04Å; A75-R79 WeakPolarHBondContact O-CG 3.38Å; A75-R79 PolarHBondContact O-N 3.1Å
76	M	93.1	Very high	85.7	Confident	89 Å²	89	115.5 Å²	115.5	44%	0.438	52%	0.516	S	S	.	.	H	α-helix	trans	-64.2	-48.3	177	-174.4	173.8	62	0	0	111.8	K72 Y73 K78 R79 Y80	K72-M76 WeakPolarHBondContact O-CB 2.97Å; K72-M76 PolarHBondContact O-N 3.45Å; Y73-M76 HydrophobicContact CD2-CE 4.13Å; Y73-M76 PolarHBondContact O-N 3.33Å; M76-K78 VanDerWaalsContact C-N 3.27Å; M76-K78 PolarHBondContact O-N 3.4Å; M76-R79 PolarHBondContact O-N 3.24Å; M76-Y80 HydrophobicContact CG-CD2 3.7Å; M76-Y80 HydrophobicContact CG-CE2 3.62Å; M76-Y80 WeakPolarHBondContact O-CD2 3.32Å; M76-Y80 PolarHBondContact O-N 3.44Å; M76-Y80 VanDerWaalsContact O-N 3.1Å; M76-Y80 HydrophobicContact SD-CE2 4.4Å
77	K	91.8	Very high	84	Confident	108 Å²	108	116.6 Å²	116.6	47%	0.47	52%	0.517	S	S	.	.	H	α-helix	trans	-56.6	-42.1	176.3	-173.8	176	-176.5	171.6	0	111.2	Y73 R79 Y81	Y73-K77 HydrophobicContact CE1-CD 4.02Å; Y73-K77 WeakPolarHBondContact O-CB 3.44Å; Y73-K77 PolarHBondContact O-N 3.45Å; K77-R79 VanDerWaalsContact C-N 3.35Å; K77-R79 PolarHBondContact O-N 3.06Å; K77-Y81 HydrophobicContact CB-CD2 4.48Å; K77-Y81 HydrophobicContact CG-CD2 3.75Å; K77-Y81 HydrophobicContact CG-CE2 4.24Å; K77-Y81 WeakPolarHBondContact O-CB 3.41Å; K77-Y81 VanDerWaalsContact O-CD2 3.32Å; K77-Y81 WeakPolarHBondContact O-CD2 3.33Å; K77-Y81 PolarHBondContact O-N 3.04Å
78	K	89.8	Confident	82.6	Confident	136 Å²	136	116.2 Å²	116.2	59%	0.591	52%	0.516	S	S	*	.	H	α-helix	trans	-59.2	-44.1	175.3	-170.7	177.1	-178.5	-178.9	0	111.5	R74 A75 M76 N82	R74-K78 WeakPolarHBondContact O-CB 3.35Å; R74-K78 PolarHBondContact O-N 3.08Å; A75-K78 PolarHBondContact O-N 3.04Å; M76-K78 VanDerWaalsContact C-N 3.27Å; M76-K78 PolarHBondContact O-N 3.4Å; K78-N82 WeakPolarHBondContact CG-ND2 3.3Å; K78-N82 WeakPolarHBondContact O-CB 3.37Å; K78-N82 PolarHBondContact O-N 2.91Å; K78-N82 PolarHBondContact O-ND2 3.5Å; K78-N82 PolarHBondContact O-OD1 3.24Å
79	R	88.6	Confident	81.3	Confident	197 Å²	197	120.1 Å²	120.1	74%	0.743	54%	0.536	S	S	*	.	H	α-helix	trans	-66.4	-46.3	-178.5	-68.9	175.3	-176	-168.8	-0.3	113.2	A75 M76 K77	A75-R79 WeakPolarHBondContact O-CG 3.38Å; A75-R79 PolarHBondContact O-N 3.1Å; M76-R79 PolarHBondContact O-N 3.24Å; K77-R79 VanDerWaalsContact C-N 3.35Å; K77-R79 PolarHBondContact O-N 3.06Å
80	Y	88.9	Confident	79.9	Confident	167 Å²	167	115.7 Å²	115.7	66%	0.655	53%	0.526	S	S	*	.	H	α-helix	trans	-76.5	-37.3	-176.7	-73.4	-77.8	0	0	0	113.2	M76	M76-Y80 HydrophobicContact CG-CD2 3.7Å; M76-Y80 HydrophobicContact CG-CE2 3.62Å; M76-Y80 WeakPolarHBondContact O-CD2 3.32Å; M76-Y80 PolarHBondContact O-N 3.44Å; M76-Y80 VanDerWaalsContact O-N 3.1Å; M76-Y80 HydrophobicContact SD-CE2 4.4Å
81	Y	82.2	Confident	78.7	Confident	136 Å²	136	118.6 Å²	118.6	53%	0.533	54%	0.536	S	S	.	.	H	α-helix	trans	-98.5	-12.7	-173.3	-64.4	-87.6	0	0	0	114.4	K77 N83 I84 R85	K77-Y81 HydrophobicContact CB-CD2 4.48Å; K77-Y81 HydrophobicContact CG-CD2 3.75Å; K77-Y81 HydrophobicContact CG-CE2 4.24Å; K77-Y81 WeakPolarHBondContact O-CB 3.41Å; K77-Y81 VanDerWaalsContact O-CD2 3.32Å; K77-Y81 WeakPolarHBondContact O-CD2 3.33Å; K77-Y81 PolarHBondContact O-N 3.04Å; Y81-N83 VanDerWaalsContact C-N 3.27Å; Y81-N83 PolarHBondContact O-N 3.32Å; Y81-I84 HydrophobicContact CD1-CD1 3.71Å; Y81-I84 HydrophobicContact CE1-CD1 4.19Å; Y81-I84 PolarHBondContact O-N 2.93Å; Y81-R85 PolarHBondContact O-N 3.03Å
82	N	70.5	Confident	77.6	Confident	60 Å²	60	116.7 Å²	116.7	32%	0.321	53%	0.534	S	S	.	.	H	α-helix	trans	-64.7	-34.6	172.7	-82.5	6.3	0	0	0	111.8	K78 I84 R85 I86	K78-N82 WeakPolarHBondContact CG-ND2 3.3Å; K78-N82 WeakPolarHBondContact O-CB 3.37Å; K78-N82 PolarHBondContact O-N 2.91Å; K78-N82 PolarHBondContact O-ND2 3.5Å; K78-N82 PolarHBondContact O-OD1 3.24Å; N82-I84 VanDerWaalsContact C-N 3.29Å; N82-I84 PolarHBondContact O-N 3.26Å; N82-R85 PolarHBondContact O-N 3.04Å; N82-I86 WeakPolarHBondContact O-CG1 3.37Å; N82-I86 PolarHBondContact O-N 2.89Å
83	N	62.8	Low	76.4	Confident	105 Å²	105	114.5 Å²	114.5	56%	0.561	53%	0.528	S	S	*	.	H	α-helix	trans	-62.5	-39.9	174.9	-68.9	-10	0	0	0	111.1	Y81 R85 I86 L87	Y81-N83 VanDerWaalsContact C-N 3.27Å; Y81-N83 PolarHBondContact O-N 3.32Å; N83-R85 PolarHBondContact O-N 3.18Å; N83-I86 PolarHBondContact O-N 3.45Å; N83-L87 WeakPolarHBondContact O-CB 3.01Å; N83-L87 VanDerWaalsContact O-CG 3.29Å; N83-L87 WeakPolarHBondContact O-CG 3.44Å; N83-L87 PolarHBondContact O-N 3.44Å
84	I	61.2	Low	75.2	Confident	80 Å²	80	118.1 Å²	118.1	41%	0.41	54%	0.54	S	S	.	.	H	α-helix	trans	-66.3	-39.1	177.1	-62.5	167	0	0	0	110.8	Y81 N82 L87 N88	Y81-I84 HydrophobicContact CD1-CD1 3.71Å; Y81-I84 HydrophobicContact CE1-CD1 4.19Å; Y81-I84 PolarHBondContact O-N 2.93Å; N82-I84 VanDerWaalsContact C-N 3.29Å; N82-I84 PolarHBondContact O-N 3.26Å; I84-L87 PolarHBondContact O-N 3.47Å; I84-N88 WeakPolarHBondContact O-CB 3.29Å; I84-N88 PolarHBondContact O-N 2.96Å
85	R	61.1	Low	74	Confident	176 Å²	176	115.2 Å²	115.2	66%	0.664	54%	0.537	S	S	*	.	H	α-helix	trans	-64.9	-41.6	175.5	-74.1	-174.9	176.6	-161.7	-4.5	112.5	Y81 N82 N83 N88 Q89	Y81-R85 PolarHBondContact O-N 3.03Å; N82-R85 PolarHBondContact O-N 3.04Å; N83-R85 PolarHBondContact O-N 3.18Å; R85-N88 PolarHBondContact O-N 3.31Å; R85-Q89 WeakPolarHBondContact O-CB 3.49Å; R85-Q89 WeakPolarHBondContact O-CG 3.07Å; R85-Q89 PolarHBondContact O-N 3.42Å
86	I	63.2	Low	73.2	Confident	97 Å²	97	116.5 Å²	116.5	50%	0.497	55%	0.547	S	S	.	.	H	α-helix	trans	-65.1	-44	177	-65.5	163	0	0	0	110	N82 N83 Q89 T90	N82-I86 WeakPolarHBondContact O-CG1 3.37Å; N82-I86 PolarHBondContact O-N 2.89Å; N83-I86 PolarHBondContact O-N 3.45Å; I86-Q89 PolarHBondContact O-N 3.43Å; I86-T90 HydrophobicContact CG2-CG2 4.39Å; I86-T90 VanDerWaalsContact O-CG2 3.32Å; I86-T90 WeakPolarHBondContact O-CG2 3.33Å; I86-T90 PolarHBondContact O-N 2.98Å; I86-T90 PolarHBondContact O-OG1 3.43Å; I86-T90 VanDerWaalsContact O-OG1 3.12Å
87	L	61.8	Low	72.3	Confident	111 Å²	111	120.2 Å²	120.2	58%	0.581	56%	0.561	S	S	*	*	H	α-helix	trans	-63.7	-40.4	176.8	-71.2	173.1	0	0	0	112.8	N83 I84 T90 F91	N83-L87 WeakPolarHBondContact O-CB 3.01Å; N83-L87 VanDerWaalsContact O-CG 3.29Å; N83-L87 WeakPolarHBondContact O-CG 3.44Å; N83-L87 PolarHBondContact O-N 3.44Å; I84-L87 PolarHBondContact O-N 3.47Å; L87-T90 WeakPolarHBondContact CA-OG1 3.21Å; L87-T90 PolarHBondContact O-N 3.29Å; L87-T90 PolarHBondContact O-OG1 3.11Å; L87-F91 VanDerWaalsContact O-CB 3.29Å; L87-F91 WeakPolarHBondContact O-CB 3.43Å; L87-F91 PolarHBondContact O-N 2.95Å
88	N	64.8	Low	71.2	Confident	95 Å²	95	121.6 Å²	121.6	51%	0.508	59%	0.593	S	S	.	*	H	α-helix	trans	-68.8	-40.4	176.7	-70.8	-6.8	0	0	0	111.1	I84 R85 F91 T92	I84-N88 WeakPolarHBondContact O-CB 3.29Å; I84-N88 PolarHBondContact O-N 2.96Å; R85-N88 PolarHBondContact O-N 3.31Å; N88-F91 PolarHBondContact O-N 3.17Å; N88-T92 WeakPolarHBondContact O-CB 3.12Å; N88-T92 VanDerWaalsContact O-CG2 3.3Å; N88-T92 WeakPolarHBondContact O-CG2 3.41Å; N88-T92 PolarHBondContact O-N 2.92Å; N88-T92 PolarHBondContact O-OG1 2.86Å
89	Q	69	Low	70.3	Confident	130 Å²	130	120.9 Å²	120.9	61%	0.607	59%	0.593	S	S	*	*	H	α-helix	trans	-63.9	-42.2	174.9	-78.4	-178.6	-22.1	0	0	112	R85 I86 T92 M93	R85-Q89 WeakPolarHBondContact O-CB 3.49Å; R85-Q89 WeakPolarHBondContact O-CG 3.07Å; R85-Q89 PolarHBondContact O-N 3.42Å; I86-Q89 PolarHBondContact O-N 3.43Å; Q89-T92 WeakPolarHBondContact CA-OG1 3.32Å; Q89-T92 PolarHBondContact O-N 3.49Å; Q89-T92 PolarHBondContact O-OG1 3.39Å; Q89-M93 WeakPolarHBondContact O-CB 3.29Å; Q89-M93 WeakPolarHBondContact O-CG 3.47Å; Q89-M93 PolarHBondContact O-N 2.91Å
90	T	65.2	Low	69.3	Low	66 Å²	66	116.8 Å²	116.8	41%	0.405	59%	0.585	S	S	.	*	H	α-helix	trans	-68.1	-37.1	177	55.6	0	0	0	0	111.7	I86 L87 R94	I86-T90 HydrophobicContact CG2-CG2 4.39Å; I86-T90 VanDerWaalsContact O-CG2 3.32Å; I86-T90 WeakPolarHBondContact O-CG2 3.33Å; I86-T90 PolarHBondContact O-N 2.98Å; I86-T90 PolarHBondContact O-OG1 3.43Å; I86-T90 VanDerWaalsContact O-OG1 3.12Å; L87-T90 WeakPolarHBondContact CA-OG1 3.21Å; L87-T90 PolarHBondContact O-N 3.29Å; L87-T90 PolarHBondContact O-OG1 3.11Å; T90-R94 WeakPolarHBondContact O-CB 3.34Å; T90-R94 VanDerWaalsContact O-CG 3.29Å; T90-R94 WeakPolarHBondContact O-CG 3.29Å; T90-R94 PolarHBondContact O-N 2.87Å
91	F	70.2	Confident	68.3	Low	128 Å²	128	114.1 Å²	114.1	56%	0.561	58%	0.581	S	S	*	*	H	α-helix	trans	-66.9	-44.2	174.5	-171.7	-104.5	0	0	0	112.2	L87 N88 M93 R94 L95	L87-F91 VanDerWaalsContact O-CB 3.29Å; L87-F91 WeakPolarHBondContact O-CB 3.43Å; L87-F91 PolarHBondContact O-N 2.95Å; N88-F91 PolarHBondContact O-N 3.17Å; F91-M93 VanDerWaalsContact C-N 3.35Å; F91-M93 PolarHBondContact O-N 3.48Å; F91-R94 PolarHBondContact O-N 3.34Å; F91-L95 HydrophobicContact CD1-CD1 3.73Å; F91-L95 HydrophobicContact CE1-CD1 3.26Å; F91-L95 HydrophobicContact CE1-CG 4.21Å; F91-L95 HydrophobicContact CZ-CD1 3.73Å; F91-L95 HydrophobicContact CZ-CG 4.31Å; F91-L95 PolarHBondContact O-N 2.96Å
92	T	71.2	Confident	67.4	Low	82 Å²	82	112.8 Å²	112.8	50%	0.503	58%	0.584	S	S	.	*	H	α-helix	trans	-65.1	-38.1	176.2	53.4	0	0	0	0	112.2	N88 Q89 L95 A96	N88-T92 WeakPolarHBondContact O-CB 3.12Å; N88-T92 VanDerWaalsContact O-CG2 3.3Å; N88-T92 WeakPolarHBondContact O-CG2 3.41Å; N88-T92 PolarHBondContact O-N 2.92Å; N88-T92 PolarHBondContact O-OG1 2.86Å; Q89-T92 WeakPolarHBondContact CA-OG1 3.32Å; Q89-T92 PolarHBondContact O-N 3.49Å; Q89-T92 PolarHBondContact O-OG1 3.39Å; T92-L95 PolarHBondContact O-N 2.94Å; T92-A96 WeakPolarHBondContact O-CB 3.36Å; T92-A96 PolarHBondContact O-N 3.35Å
93	M	67.9	Low	67.3	Low	107 Å²	107	116.1 Å²	116.1	53%	0.527	60%	0.6	S	S	.	*	H	α-helix	trans	-65.5	-45.5	174.8	-69.8	-72.5	-85.5	0	0	110.2	Q89 F91 L95 A96 F97	Q89-M93 WeakPolarHBondContact O-CB 3.29Å; Q89-M93 WeakPolarHBondContact O-CG 3.47Å; Q89-M93 PolarHBondContact O-N 2.91Å; F91-M93 VanDerWaalsContact C-N 3.35Å; F91-M93 PolarHBondContact O-N 3.48Å; M93-L95 VanDerWaalsContact C-N 3.28Å; M93-L95 PolarHBondContact O-N 3.12Å; M93-A96 PolarHBondContact O-N 2.98Å; M93-A96 VanDerWaalsContact O-N 3.11Å; M93-F97 HydrophobicContact CB-CE2 4.45Å; M93-F97 HydrophobicContact CE-CE2 3.69Å; M93-F97 HydrophobicContact CE-CZ 4.32Å; M93-F97 WeakPolarHBondContact O-CD2 3.33Å; M93-F97 PolarHBondContact O-N 3.48Å; M93-F97 VanDerWaalsContact O-N 3.17Å; M93-F97 HydrophobicContact SD-CE2 4.04Å
94	R	70.5	Confident	67.6	Low	196 Å²	196	116.8 Å²	116.8	74%	0.74	60%	0.603	S	S	*	*	H	α-helix	trans	-59.8	-36.1	176.7	-76.5	178.9	-178.8	-167.7	0.3	113.3	T90 F91 A98	T90-R94 WeakPolarHBondContact O-CB 3.34Å; T90-R94 VanDerWaalsContact O-CG 3.29Å; T90-R94 WeakPolarHBondContact O-CG 3.29Å; T90-R94 PolarHBondContact O-N 2.87Å; F91-R94 PolarHBondContact O-N 3.34Å; R94-A98 PolarHBondContact O-N 3.49Å
95	L	67.8	Low	68	Low	104 Å²	104	119.4 Å²	119.4	55%	0.545	62%	0.616	S	S	.	*	H	α-helix	trans	-75.4	-28.9	174.8	-78.2	171.9	0	0	0	113.6	F91 T92 M93 F97	F91-L95 HydrophobicContact CD1-CD1 3.73Å; F91-L95 HydrophobicContact CE1-CD1 3.26Å; F91-L95 HydrophobicContact CE1-CG 4.21Å; F91-L95 HydrophobicContact CZ-CD1 3.73Å; F91-L95 HydrophobicContact CZ-CG 4.31Å; F91-L95 PolarHBondContact O-N 2.96Å; T92-L95 PolarHBondContact O-N 2.94Å; M93-L95 VanDerWaalsContact C-N 3.28Å; M93-L95 PolarHBondContact O-N 3.12Å; L95-F97 VanDerWaalsContact C-N 3.33Å
96	A	76.3	Confident	68.5	Low	76 Å²	76	115.1 Å²	115.1	63%	0.628	61%	0.613	S	S	*	*	H	α-helix	trans	-78.6	-16.8	178.4	0	0	0	0	0	113.5	T92 M93	T92-A96 WeakPolarHBondContact O-CB 3.36Å; T92-A96 PolarHBondContact O-N 3.35Å; M93-A96 PolarHBondContact O-N 2.98Å; M93-A96 VanDerWaalsContact O-N 3.11Å
97	F	73.8	Confident	69	Low	168 Å²	168	116.6 Å²	116.6	74%	0.737	62%	0.622	S	S	*	*	T	Hydrogen-bonded Turn	trans	-108.6	7.1	178.2	-67.5	-69.9	0	0	0	113.9	M93 L95	M93-F97 HydrophobicContact CB-CE2 4.45Å; M93-F97 HydrophobicContact CE-CE2 3.69Å; M93-F97 HydrophobicContact CE-CZ 4.32Å; M93-F97 WeakPolarHBondContact O-CD2 3.33Å; M93-F97 PolarHBondContact O-N 3.48Å; M93-F97 VanDerWaalsContact O-N 3.17Å; M93-F97 HydrophobicContact SD-CE2 4.04Å; L95-F97 VanDerWaalsContact C-N 3.33Å
98	A	69.4	Low	69.6	Low	136 Å²	136	117.1 Å²	117.1	100%	1.124	63%	0.626	S	S	*	*			trans	-106.9	0	172.8	0	0	0	0	0	109.7	R94	R94-A98 PolarHBondContact O-N 3.49Å

Retrieved 98 of 98 residues in 113.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).