A0A077Z7G5_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077Z7G5, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 143 aa.

						>A0A077Z7G5_TRITR|A0A077Z7G5
MKLWGKLFHFGGNANSSVRQETHCQHVVPLGDGGTAYFGLYGSIRRRRSSRLPYTASSKSASASPCCQRAPSTIELLQDQQKRLATIAATPRMARALQKQTPMAKDLIFFRNIFLSKLSLVAAHQTLHGSIKETFKFRVTVII
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	35.5	Very low	46.5	Very low	241 Å²	241	164.2 Å²	164.2	100%	1.187	83%	0.828	S	S	*	*				0	92	0	-68.7	165.8	84.5	0	0	109.8
2	K	49.2	Very low	45.3	Very low	207 Å²	207	156.9 Å²	156.9	90%	0.9	83%	0.825	S	S	*	*			trans	-154.1	51.4	177.7	-77.3	-169.8	175.7	175.7	0	112.8
3	L	52.2	Low	44.7	Very low	149 Å²	149	155.1 Å²	155.1	78%	0.78	82%	0.816	S	S	*	*			trans	-122.6	-4.4	-179.3	-88.7	154.8	0	0	0	115.5
4	W	47.4	Very low	44.1	Very low	215 Å²	215	150.7 Å²	150.7	81%	0.814	81%	0.813	S	S	*	*	G	3₁₀ helix	trans	-83.7	-16.9	-179.4	-64.3	95.2	0	0	0	114.2	K6	W4-K6 VanDerWaalsContact C-N 3.3Å; W4-K6 PolarHBondContact O-N 2.85Å
5	G	50.3	Low	43.6	Very low	73 Å²	73	149.3 Å²	149.3	75%	0.753	81%	0.805	S	S	*	*	G	3₁₀ helix	trans	-73.7	-14	-176.9	0	0	0	0	0	115.4
6	K	54.7	Low	43	Very low	188 Å²	188	147.4 Å²	147.4	82%	0.817	81%	0.807	S	S	*	*	G	3₁₀ helix	trans	-94.5	-1.7	-177.4	-77.1	-173.7	172.9	-178.8	0	114.7	W4	W4-K6 VanDerWaalsContact C-N 3.3Å; W4-K6 PolarHBondContact O-N 2.85Å
7	L	50	Low	42.8	Very low	138 Å²	138	145.5 Å²	145.5	72%	0.723	81%	0.807	S	S	*	*	S	Bend	trans	-94.6	-11.4	-175	-137	83.9	0	0	0	114.5
8	F	43.5	Very low	42.3	Very low	144 Å²	144	144.5 Å²	144.5	63%	0.632	81%	0.805	S	S	*	*			trans	-113.8	64.2	-174.8	-64.6	-80.3	0	0	0	111.8	F10	F8-F10 HydrophobicContact CD1-CD2 4.27Å; F8-F10 PolarHBondContact O-N 3.24Å
9	H	47.5	Very low	41.8	Very low	186 Å²	186	149.3 Å²	149.3	86%	0.861	81%	0.809	S	S	*	*			trans	-90.5	76	151.2	-76.2	-64.3	0	0	0	107.6
10	F	41.5	Very low	41.4	Very low	185 Å²	185	150.6 Å²	150.6	81%	0.811	81%	0.81	S	S	*	*			trans	-88.2	125.6	171.3	-121.4	-88.6	0	0	0	108.8	F8	F8-F10 HydrophobicContact CD1-CD2 4.27Å; F8-F10 PolarHBondContact O-N 3.24Å
11	G	40	Very low	40.9	Very low	80 Å²	80	153 Å²	153	83%	0.825	82%	0.816	S	S	*	*			trans	91.3	120.4	147.8	0	0	0	0	0	116.3
12	G	32.4	Very low	41.1	Very low	77 Å²	77	146.8 Å²	146.8	79%	0.794	79%	0.791	S	S	*	*			trans	145.4	62.6	154.6	0	0	0	0	0	115.1
13	N	37.3	Very low	40.5	Very low	133 Å²	133	145.3 Å²	145.3	71%	0.711	79%	0.787	S	S	*	*				-161.7	97.4	130	-148.8	-15.5	0	0	0	110.9	N15	N13-N15 PolarHBondContact O-N 3.19Å; N13-N15 PolarHBondContact OD1-ND2 2.9Å
14	A	36.3	Very low	39.5	Very low	94 Å²	94	143.2 Å²	143.2	78%	0.777	78%	0.784	S	S	*	*			trans	-76.3	96.1	164.7	0	0	0	0	0	108
15	N	36.5	Very low	39	Very low	130 Å²	130	141.6 Å²	141.6	70%	0.695	79%	0.786	S	S	*	*			trans	-124.7	79.9	161.5	-76.9	-30.4	0	0	0	108.3	N13 S17	N13-N15 PolarHBondContact O-N 3.19Å; N13-N15 PolarHBondContact OD1-ND2 2.9Å; N15-S17 PolarHBondContact O-N 3.47Å
16	S	34.1	Very low	38.3	Very low	118 Å²	118	146.2 Å²	146.2	83%	0.825	79%	0.787	S	S	*	*			trans	-57.8	108.5	158.4	48	0	0	0	0	109.5
17	S	38.7	Very low	37.4	Very low	116 Å²	116	144.1 Å²	144.1	81%	0.811	79%	0.79	S	S	*	*			trans	-123.8	99.2	153.1	68.8	0	0	0	0	109.5	N15	N15-S17 PolarHBondContact O-N 3.47Å
18	V	34.2	Very low	36.8	Very low	127 Å²	127	141.4 Å²	141.4	77%	0.77	78%	0.779	S	S	*	*			trans	-18.7	129.4	158.8	176.8	0	0	0	0	116
19	R	32.6	Very low	36.7	Very low	235 Å²	235	140.5 Å²	140.5	89%	0.887	79%	0.788	S	S	*	*			trans	54	106	154.7	-80.5	177.5	140.7	-172.6	-4.6	118.5
20	Q	34.1	Very low	36.3	Very low	176 Å²	176	139 Å²	139	82%	0.822	79%	0.785	S	S	*	*				-155.2	91.7	127.3	-112.4	172.7	29.7	0	0	109.4	T22	Q20-T22 PolarHBondContact O-N 3.39Å
21	E	32.1	Very low	36	Very low	202 Å²	202	133.4 Å²	133.4	94%	0.944	78%	0.779	S	S	*	*			trans	-73.1	79.8	159.1	-78.3	176.5	142.9	0	0	107.9
22	T	37.9	Very low	35.9	Very low	109 Å²	109	137.5 Å²	137.5	67%	0.669	78%	0.782	S	S	*	*			trans	-123	95.4	161.6	50.8	0	0	0	0	107.8	Q20 C24	Q20-T22 PolarHBondContact O-N 3.39Å; T22-C24 PolarHBondContact O-N 3.29Å
23	H	37.9	Very low	36	Very low	176 Å²	176	137.9 Å²	137.9	82%	0.815	79%	0.786	S	S	*	*			trans	16.2	102.5	147.1	-161.8	54.2	0	0	0	115.1	Q25	H23-Q25 PolarHBondContact O-N 3.49Å
24	C	31.5	Very low	35.8	Very low	105 Å²	105	134.9 Å²	134.9	71%	0.709	79%	0.787	S	S	*	*	S	Bend	trans	-28.5	113.7	166.5	-53.9	0	0	0	0	113.7	T22	T22-C24 PolarHBondContact O-N 3.29Å
25	Q	36.4	Very low	36	Very low	182 Å²	182	136.9 Å²	136.9	85%	0.85	79%	0.789	S	S	*	*			trans	164.8	103.1	131.3	-90.7	157	83.7	0	0	107.6	H23	H23-Q25 PolarHBondContact O-N 3.49Å
26	H	35.2	Very low	36.3	Very low	169 Å²	169	134.9 Å²	134.9	78%	0.782	79%	0.791	S	S	*	*				175.7	74.1	128	-160.8	-101.5	0	0	0	107.6	V28	H26-V28 PolarHBondContact O-N 3.3Å
27	V	35	Very low	36.7	Very low	144 Å²	144	140 Å²	140	87%	0.873	79%	0.794	S	S	*	*			trans	-75.6	110.5	159.4	176.1	0	0	0	0	105.3
28	V	38	Very low	37.1	Very low	81 Å²	81	144.4 Å²	144.4	49%	0.491	80%	0.799	S	S	.	*			trans	179.7	111.2	138.7	164.4	0	0	0	0	105.9	H26 L30	H26-V28 PolarHBondContact O-N 3.3Å; V28-L30 HydrophobicContact CB-CD1 4.47Å; V28-L30 HydrophobicContact CG1-CD1 3.39Å; V28-L30 HydrophobicContact CG2-CD1 4.21Å
29	P	41.5	Very low	37.5	Very low	126 Å²	126	141 Å²	141	82%	0.818	79%	0.789	S	S	*	*				-115.7	118.4	119	-3.5	21.8	0	0	0	109.1	G31	P29-G31 VanDerWaalsContact C-N 3.28Å; P29-G31 PolarHBondContact O-N 3.24Å
30	L	39.6	Very low	38	Very low	155 Å²	155	137.6 Å²	137.6	81%	0.812	79%	0.788	S	S	*	*			trans	-58	93.3	163.7	-98.8	60.6	0	0	0	107	V28	V28-L30 HydrophobicContact CB-CD1 4.47Å; V28-L30 HydrophobicContact CG1-CD1 3.39Å; V28-L30 HydrophobicContact CG2-CD1 4.21Å
31	G	34.4	Very low	38.7	Very low	66 Å²	66	140.4 Å²	140.4	68%	0.68	79%	0.792	S	S	*	*			trans	-79.8	122	167.7	0	0	0	0	0	108.7	P29 G33	P29-G31 VanDerWaalsContact C-N 3.28Å; P29-G31 PolarHBondContact O-N 3.24Å; G31-G33 PolarHBondContact O-N 2.91Å
32	D	37.6	Very low	39	Very low	167 Å²	167	134.4 Å²	134.4	89%	0.893	79%	0.785	S	S	*	*	S	Bend	trans	-48	132.2	177.6	-63	-55.6	0	0	0	112.4
33	G	35	Very low	39.5	Very low	85 Å²	85	133.1 Å²	133.1	88%	0.876	78%	0.781	S	S	*	*			trans	81.2	82.6	165	0	0	0	0	0	115.5	G31	G31-G33 PolarHBondContact O-N 2.91Å
34	G	32.7	Very low	40	Very low	70 Å²	70	132.8 Å²	132.8	72%	0.722	78%	0.783	S	S	*	*			trans	-178.6	85.8	167.9	0	0	0	0	0	111.6	A36	G34-A36 PolarHBondContact O-N 2.85Å
35	T	40.7	Very low	41.1	Very low	135 Å²	135	137.9 Å²	137.9	83%	0.828	79%	0.787	S	S	*	*			trans	-30	107.5	173.6	46.6	0	0	0	0	112.7	Y37	T35-Y37 VanDerWaalsContact C-N 3.3Å; T35-Y37 PolarHBondContact O-N 3.45Å
36	A	44.3	Very low	41.7	Very low	89 Å²	89	140.1 Å²	140.1	74%	0.736	79%	0.788	S	S	*	*			trans	-67.3	87.6	176.1	0	0	0	0	0	109.7	G34 F38	G34-A36 PolarHBondContact O-N 2.85Å; A36-F38 PolarHBondContact O-N 3.14Å
37	Y	42.1	Very low	42.5	Very low	226 Å²	226	143.8 Å²	143.8	89%	0.886	80%	0.795	S	S	*	*			trans	-74.8	65.2	165	-135.1	-91.8	0	0	0	108.4	T35	T35-Y37 VanDerWaalsContact C-N 3.3Å; T35-Y37 PolarHBondContact O-N 3.45Å
38	F	46.2	Very low	43.2	Very low	207 Å²	207	147.9 Å²	147.9	91%	0.908	80%	0.795	S	S	*	*			trans	-114.8	80.6	177.4	-106.3	-80.4	0	0	0	109.2	A36	A36-F38 PolarHBondContact O-N 3.14Å
39	G	42.1	Very low	43.6	Very low	55 Å²	55	149 Å²	149	57%	0.567	81%	0.806	S	S	*	*			trans	-179.2	93.7	172.4	0	0	0	0	0	109.1
40	L	43.8	Very low	44	Very low	165 Å²	165	148.3 Å²	148.3	86%	0.864	80%	0.804	S	S	*	*	S	Bend	trans	151.6	63.4	152.6	-79.5	164.6	0	0	0	108.9
41	Y	48.6	Very low	44.3	Very low	234 Å²	234	151.6 Å²	151.6	92%	0.918	81%	0.806	S	S	*	*			trans	-160.4	110.8	136.8	-94.8	-68.2	0	0	0	107.2	S43	Y41-S43 PolarHBondContact O-N 3.29Å
42	G	38.2	Very low	44.8	Very low	76 Å²	76	156 Å²	156	78%	0.784	81%	0.813	S	S	*	*			trans	-62	99.6	-177.2	0	0	0	0	0	110.4	I44	G42-I44 PolarHBondContact O-N 3.47Å; G42-I44 VanDerWaalsContact O-N 3.14Å
43	S	49.2	Very low	45.2	Very low	83 Å²	83	153.1 Å²	153.1	58%	0.58	80%	0.803	S	S	*	*			trans	-61.5	114.9	153.8	63.7	0	0	0	0	106	Y41 R45	Y41-S43 PolarHBondContact O-N 3.29Å; S43-R45 PolarHBondContact O-N 2.99Å
44	I	48.9	Very low	45.6	Very low	169 Å²	169	159.5 Å²	159.5	87%	0.867	80%	0.803	S	S	*	*			trans	-64.9	73.1	164.9	-56.8	169.7	0	0	0	105.9	G42 R46	G42-I44 PolarHBondContact O-N 3.47Å; G42-I44 VanDerWaalsContact O-N 3.14Å; I44-R46 PolarHBondContact O-N 3.02Å
45	R	52.7	Low	46	Very low	212 Å²	212	162.8 Å²	162.8	80%	0.8	81%	0.809	S	S	*	*			trans	-64.5	108.2	167.1	-84.3	176	173.5	-123.6	-0.7	104	S43 R47	S43-R45 PolarHBondContact O-N 2.99Å; R45-R47 PolarHBondContact O-N 2.87Å
46	R	50.8	Low	46.4	Very low	229 Å²	229	161.1 Å²	161.1	86%	0.864	81%	0.808	S	S	*	*			trans	-40	109.5	164.3	-81.6	-177.3	170.1	-170.5	-2.2	106.6	I44 R48	I44-R46 PolarHBondContact O-N 3.02Å; R46-R48 PolarHBondContact O-N 3.38Å
47	R	50.2	Low	46.5	Very low	246 Å²	246	161.9 Å²	161.9	93%	0.928	81%	0.808	S	S	*	*			trans	-62.5	90.4	166.7	-74.7	-176	176.1	-177.7	-1.5	105.3	R45 S49	R45-R47 PolarHBondContact O-N 2.87Å; R47-S49 PolarHBondContact O-N 3.2Å
48	R	50.8	Low	46.8	Very low	230 Å²	230	156 Å²	156	87%	0.868	80%	0.801	S	S	*	*			trans	-62.2	100.7	158.3	-74	-177.1	176.3	157	-1.4	103.6	R46 S50	R46-R48 PolarHBondContact O-N 3.38Å; R48-S50 VanDerWaalsContact C-N 3.3Å; R48-S50 PolarHBondContact O-N 3.32Å
49	S	46.6	Very low	46.7	Very low	103 Å²	103	155.1 Å²	155.1	72%	0.72	80%	0.797	S	S	*	*			trans	-64.8	100.1	172.5	-177.2	0	0	0	0	106.3	R47 R51	R47-S49 PolarHBondContact O-N 3.2Å; S49-R51 PolarHBondContact O-N 3.34Å
50	S	49.5	Very low	46.9	Very low	113 Å²	113	157.9 Å²	157.9	79%	0.79	81%	0.807	S	S	*	*			trans	-73.7	65.3	161	55.9	0	0	0	0	107.6	R48 L52	R48-S50 VanDerWaalsContact C-N 3.3Å; R48-S50 PolarHBondContact O-N 3.32Å; S50-L52 PolarHBondContact O-N 3.4Å
51	R	45	Very low	47.2	Very low	223 Å²	223	154 Å²	154	84%	0.842	80%	0.798	S	S	*	*			trans	-76.9	104.8	160.8	-148.4	178.5	-160.5	-171	4.3	104.6	S49	S49-R51 PolarHBondContact O-N 3.34Å
52	L	46.5	Very low	47.1	Very low	159 Å²	159	148.4 Å²	148.4	83%	0.832	79%	0.794	S	S	*	*			trans	-36.5	128.1	177.5	-79.8	129	0	0	0	111.2	S50	S50-L52 PolarHBondContact O-N 3.4Å
53	P	45.3	Very low	47.6	Very low	106 Å²	106	148.6 Å²	148.6	69%	0.688	79%	0.788	S	S	*	*			trans	-76	160.4	168.7	35.3	-31.6	0	0	0	108.6
54	Y	42.4	Very low	47.1	Very low	220 Å²	220	148.7 Å²	148.7	86%	0.863	79%	0.789	S	S	*	*			trans	70.2	101.1	-178.1	-78.5	-108.1	0	0	0	112.8
55	T	42	Very low	47.3	Very low	138 Å²	138	145.9 Å²	145.9	85%	0.847	78%	0.781	S	S	*	*				-152	93.5	60	52.6	0	0	0	0	110.4
56	A	49.3	Very low	47	Very low	100 Å²	100	140.4 Å²	140.4	83%	0.826	78%	0.775	S	S	*	*			trans	-101.1	98	161.8	0	0	0	0	0	106.5	S58	A56-S58 PolarHBondContact O-N 2.91Å; A56-S58 VanDerWaalsContact O-N 3.15Å
57	S	45.7	Very low	47	Very low	105 Å²	105	135.4 Å²	135.4	73%	0.734	77%	0.773	S	S	*	*			trans	-31.7	118.8	165.9	165	0	0	0	0	109.7	K59	S57-K59 PolarHBondContact O-N 3.47Å
58	S	48	Very low	47.4	Very low	104 Å²	104	132.2 Å²	132.2	73%	0.727	77%	0.769	S	S	*	*			trans	-62.7	83	167.3	51.1	0	0	0	0	107.1	A56 S60	A56-S58 PolarHBondContact O-N 2.91Å; A56-S58 VanDerWaalsContact O-N 3.15Å; S58-S60 PolarHBondContact O-N 2.94Å
59	K	46	Very low	48	Very low	188 Å²	188	131.1 Å²	131.1	82%	0.817	77%	0.765	S	S	*	*			trans	-60.8	98.2	157.1	-109.1	177	175.8	176.4	0	104.3	S57 A61	S57-K59 PolarHBondContact O-N 3.47Å; K59-A61 PolarHBondContact O-N 3.22Å
60	S	45.5	Very low	48.8	Very low	113 Å²	113	130.2 Å²	130.2	79%	0.79	76%	0.763	S	S	*	*			trans	-59.8	71.7	161.8	-55	0	0	0	0	107.6	S58 S62	S58-S60 PolarHBondContact O-N 2.94Å; S60-S62 PolarHBondContact O-N 2.96Å
61	A	49.9	Very low	49.5	Very low	82 Å²	82	128.9 Å²	128.9	68%	0.678	75%	0.752	S	S	*	*			trans	-76.7	87.7	162.7	0	0	0	0	0	104.5	K59 A63	K59-A61 PolarHBondContact O-N 3.22Å; A61-A63 PolarHBondContact O-N 3.37Å
62	S	45.8	Very low	50.7	Low	118 Å²	118	120.7 Å²	120.7	83%	0.825	73%	0.729	S	S	*	*			trans	-65.8	56.6	159.9	63.7	0	0	0	0	109.1	S60 S64	S60-S62 PolarHBondContact O-N 2.96Å; S62-S64 PolarHBondContact O-N 3.35Å
63	A	48.8	Very low	51.9	Low	79 Å²	79	118.6 Å²	118.6	65%	0.653	72%	0.723	S	S	*	*			trans	-82.1	84.3	157.1	0	0	0	0	0	104.2	A61 P65	A61-A63 PolarHBondContact O-N 3.37Å; A63-P65 VanDerWaalsContact O-CD 3.22Å; A63-P65 WeakPolarHBondContact O-CD 3.11Å
64	S	40.1	Very low	53.5	Low	86 Å²	86	118.5 Å²	118.5	60%	0.601	72%	0.716	S	S	*	*			trans	-44.4	116.6	165.7	177.6	0	0	0	0	108	S62 C66	S62-S64 PolarHBondContact O-N 3.35Å; S64-C66 PolarHBondContact O-N 3.13Å; S64-C66 PolarHBondContact OG-SG 2.91Å; S64-C66 VanDerWaalsContact OG-SG 3.36Å
65	P	51.4	Low	55	Low	110 Å²	110	111.9 Å²	111.9	71%	0.714	69%	0.692	S	S	*	*			trans	-77	55.2	173.3	32.8	-32.3	0	0	0	108.6	A63 C67	A63-P65 VanDerWaalsContact O-CD 3.22Å; A63-P65 WeakPolarHBondContact O-CD 3.11Å; P65-C67 PolarHBondContact O-N 3.42Å
66	C	46.7	Very low	56.6	Low	97 Å²	97	109.6 Å²	109.6	66%	0.655	68%	0.675	S	S	*	*	T	Hydrogen-bonded Turn	trans	-70.9	120.2	164.6	-87.1	0	0	0	0	106.7	S64	S64-C66 PolarHBondContact O-N 3.13Å; S64-C66 PolarHBondContact OG-SG 2.91Å; S64-C66 VanDerWaalsContact OG-SG 3.36Å
67	C	51.6	Low	58	Low	124 Å²	124	109.9 Å²	109.9	84%	0.838	66%	0.662	S	S	*	*	T	Hydrogen-bonded Turn	trans	85.6	40.4	167.2	-45.5	0	0	0	0	117.3	P65 R69	P65-C67 PolarHBondContact O-N 3.42Å; C67-R69 PolarHBondContact O-N 3.48Å
68	Q	58.2	Low	59.6	Low	178 Å²	178	110.6 Å²	110.6	83%	0.832	65%	0.654	S	S	*	*			trans	-71	91.6	149	-72.6	-170.1	10	0	0	108	A70	Q68-A70 PolarHBondContact O-N 3.49Å; Q68-A70 VanDerWaalsContact O-N 3.08Å
69	R	64.1	Low	61	Low	207 Å²	207	109.8 Å²	109.8	78%	0.781	64%	0.641	S	S	*	*			trans	-51.3	115.2	169.3	-180	178.4	175.9	125.3	-3.8	107.5	C67 P71	C67-R69 PolarHBondContact O-N 3.48Å; R69-P71 WeakPolarHBondContact O-CD 3.33Å
70	A	63.7	Low	62.6	Low	84 Å²	84	105.4 Å²	105.4	69%	0.694	62%	0.623	S	S	*	*	P	Polyproline II helix	trans	-58.8	122.9	172	0	0	0	0	0	107.7	Q68 S72	Q68-A70 PolarHBondContact O-N 3.49Å; Q68-A70 VanDerWaalsContact O-N 3.08Å; A70-S72 PolarHBondContact O-N 3.03Å
71	P	62.9	Low	64.1	Low	85 Å²	85	106.8 Å²	106.8	55%	0.552	62%	0.617	S	S	*	*	P	Polyproline II helix	trans	-62.4	133.9	-179.6	24.1	-31.7	0	0	0	108.8	R69 E75	R69-P71 WeakPolarHBondContact O-CD 3.33Å; P71-E75 WeakPolarHBondContact CA-OE2 3.36Å; P71-E75 HydrophobicContact CB-CB 4.43Å; P71-E75 WeakPolarHBondContact CB-OE2 3.35Å
72	S	70.2	Confident	65.4	Low	51 Å²	51	110 Å²	110	36%	0.357	62%	0.616	S	S	.	*	P	Polyproline II helix	trans	-67	153.1	179	65.3	0	0	0	0	110	A70 I74 E75 L76	A70-S72 PolarHBondContact O-N 3.03Å; S72-I74 PolarHBondContact O-N 2.87Å; S72-E75 PolarHBondContact N-OE2 2.93Å; S72-E75 WeakPolarHBondContact O-CB 3.49Å; S72-E75 PolarHBondContact O-N 3.26Å; S72-E75 WeakPolarHBondContact OG-CG 3.44Å; S72-E75 PolarHBondContact OG-OE1 3.3Å; S72-L76 PolarHBondContact O-N 3.06Å
73	T	73.3	Confident	66.6	Low	115 Å²	115	112.1 Å²	112.1	71%	0.706	61%	0.606	S	S	*	*	H	α-helix	trans	-53.1	-31.5	-179.5	48.5	0	0	0	0	112.6	L76 L77	T73-L76 PolarHBondContact O-N 2.94Å; T73-L77 WeakPolarHBondContact O-CG 3.29Å; T73-L77 PolarHBondContact O-N 3.28Å; T73-L77 VanDerWaalsContact O-N 3.11Å
74	I	78.7	Confident	67.6	Low	105 Å²	105	114 Å²	114	54%	0.538	60%	0.604	S	S	.	*	H	α-helix	trans	-68.1	-43.7	177.5	-58.2	172.4	0	0	0	111.3	S72 L76 L77 Q78	S72-I74 PolarHBondContact O-N 2.87Å; I74-L76 VanDerWaalsContact C-N 3.29Å; I74-L76 PolarHBondContact O-N 3.2Å; I74-L77 PolarHBondContact O-N 3.45Å; I74-Q78 WeakPolarHBondContact O-CG 3.39Å; I74-Q78 PolarHBondContact O-N 3.45Å
75	E	72.7	Confident	69	Low	80 Å²	80	112.7 Å²	112.7	37%	0.374	60%	0.599	S	S	.	*	H	α-helix	trans	-62.6	-39.5	177.8	-71	166.5	-161.5	0	0	111	P71 S72 Q78 D79	P71-E75 WeakPolarHBondContact CA-OE2 3.36Å; P71-E75 HydrophobicContact CB-CB 4.43Å; P71-E75 WeakPolarHBondContact CB-OE2 3.35Å; S72-E75 PolarHBondContact N-OE2 2.93Å; S72-E75 WeakPolarHBondContact O-CB 3.49Å; S72-E75 PolarHBondContact O-N 3.26Å; S72-E75 WeakPolarHBondContact OG-CG 3.44Å; S72-E75 PolarHBondContact OG-OE1 3.3Å; E75-Q78 PolarHBondContact O-N 2.96Å; E75-D79 PolarHBondContact O-N 3.38Å
76	L	77.2	Confident	69.6	Low	90 Å²	90	112.1 Å²	112.1	47%	0.471	59%	0.594	S	S	.	*	H	α-helix	trans	-64.6	-41.8	176.8	-169.2	146	0	0	0	111.7	S72 T73 I74 D79 Q80	S72-L76 PolarHBondContact O-N 3.06Å; T73-L76 PolarHBondContact O-N 2.94Å; I74-L76 VanDerWaalsContact C-N 3.29Å; I74-L76 PolarHBondContact O-N 3.2Å; L76-D79 PolarHBondContact O-N 2.95Å; L76-Q80 HydrophobicContact CD2-CG 4.24Å; L76-Q80 WeakPolarHBondContact O-CB 3.49Å; L76-Q80 VanDerWaalsContact O-CG 3.31Å; L76-Q80 WeakPolarHBondContact O-CG 3.37Å; L76-Q80 PolarHBondContact O-N 3.41Å
77	L	77.9	Confident	70.3	Confident	106 Å²	106	112.2 Å²	112.2	56%	0.555	59%	0.586	S	S	*	*	H	α-helix	trans	-65.3	-40.4	175.8	-70.4	173.9	0	0	0	112	T73 I74 Q80 Q81	T73-L77 WeakPolarHBondContact O-CG 3.29Å; T73-L77 PolarHBondContact O-N 3.28Å; T73-L77 VanDerWaalsContact O-N 3.11Å; I74-L77 PolarHBondContact O-N 3.45Å; L77-Q80 PolarHBondContact O-N 3.37Å; L77-Q81 WeakPolarHBondContact O-CB 3.48Å; L77-Q81 PolarHBondContact O-N 2.95Å
78	Q	80.1	Confident	70.6	Confident	121 Å²	121	109.4 Å²	109.4	57%	0.565	57%	0.573	S	S	*	*	H	α-helix	trans	-64.9	-42.8	176.8	-73.7	179.9	-5.7	0	0	112	I74 E75 Q81 K82	I74-Q78 WeakPolarHBondContact O-CG 3.39Å; I74-Q78 PolarHBondContact O-N 3.45Å; E75-Q78 PolarHBondContact O-N 2.96Å; Q78-Q81 PolarHBondContact O-N 3.44Å; Q78-K82 WeakPolarHBondContact O-CB 3.46Å; Q78-K82 PolarHBondContact O-N 3.13Å
79	D	76.7	Confident	70.5	Confident	87 Å²	87	104.8 Å²	104.8	47%	0.465	57%	0.565	S	S	.	*	H	α-helix	trans	-65.6	-41.5	176.9	-169.6	62.7	0	0	0	111.4	E75 L76 Q81 K82 R83	E75-D79 PolarHBondContact O-N 3.38Å; L76-D79 PolarHBondContact O-N 2.95Å; D79-Q81 PolarHBondContact O-N 3.02Å; D79-K82 PolarHBondContact O-N 3.32Å; D79-R83 WeakPolarHBondContact O-CB 3.46Å; D79-R83 VanDerWaalsContact O-CG 3.29Å; D79-R83 WeakPolarHBondContact O-CG 3.47Å; D79-R83 PolarHBondContact O-N 2.95Å
80	Q	78.7	Confident	70	Confident	95 Å²	95	98 Å²	98	44%	0.444	55%	0.546	S	S	.	.	H	α-helix	trans	-61.8	-43.1	173.7	-75.4	-174.4	-25.1	0	0	112.2	L76 L77 K82 R83 L84	L76-Q80 HydrophobicContact CD2-CG 4.24Å; L76-Q80 WeakPolarHBondContact O-CB 3.49Å; L76-Q80 VanDerWaalsContact O-CG 3.31Å; L76-Q80 WeakPolarHBondContact O-CG 3.37Å; L76-Q80 PolarHBondContact O-N 3.41Å; L77-Q80 PolarHBondContact O-N 3.37Å; Q80-K82 VanDerWaalsContact C-N 3.34Å; Q80-K82 PolarHBondContact O-N 2.9Å; Q80-R83 PolarHBondContact O-N 3.41Å; Q80-L84 WeakPolarHBondContact O-CB 3.39Å; Q80-L84 VanDerWaalsContact O-CG 3.29Å; Q80-L84 WeakPolarHBondContact O-CG 3.46Å; Q80-L84 PolarHBondContact O-N 3.38Å
81	Q	77.2	Confident	69.6	Low	142 Å²	142	98.5 Å²	98.5	66%	0.664	54%	0.542	S	S	*	.	H	α-helix	trans	-62.3	-42.1	176	-175	176.8	-1.8	0	0	111.5	L77 Q78 D79 L84 A85	L77-Q81 WeakPolarHBondContact O-CB 3.48Å; L77-Q81 PolarHBondContact O-N 2.95Å; Q78-Q81 PolarHBondContact O-N 3.44Å; D79-Q81 PolarHBondContact O-N 3.02Å; Q81-L84 PolarHBondContact O-N 3.27Å; Q81-A85 WeakPolarHBondContact O-CB 3.46Å; Q81-A85 PolarHBondContact O-N 3.43Å
82	K	76.6	Confident	69.1	Low	151 Å²	151	105 Å²	105	66%	0.657	56%	0.556	S	S	*	*	H	α-helix	trans	-62.2	-45.6	176.5	-171	176.9	-177.9	179.6	0	111.3	Q78 D79 Q80 L84 A85 T86	Q78-K82 WeakPolarHBondContact O-CB 3.46Å; Q78-K82 PolarHBondContact O-N 3.13Å; D79-K82 PolarHBondContact O-N 3.32Å; Q80-K82 VanDerWaalsContact C-N 3.34Å; Q80-K82 PolarHBondContact O-N 2.9Å; K82-L84 PolarHBondContact O-N 3.15Å; K82-A85 PolarHBondContact O-N 3.12Å; K82-T86 PolarHBondContact O-N 3.25Å; K82-T86 PolarHBondContact O-OG1 3.01Å; K82-T86 VanDerWaalsContact O-OG1 3.06Å
83	R	72.8	Confident	68.4	Low	162 Å²	162	107.1 Å²	107.1	61%	0.611	56%	0.561	S	S	*	*	H	α-helix	trans	-62.3	-42.2	176.5	-70.7	176.9	69	-169	1.1	112	D79 Q80 T86 I87	D79-R83 WeakPolarHBondContact O-CB 3.46Å; D79-R83 VanDerWaalsContact O-CG 3.29Å; D79-R83 WeakPolarHBondContact O-CG 3.47Å; D79-R83 PolarHBondContact O-N 2.95Å; Q80-R83 PolarHBondContact O-N 3.41Å; R83-T86 PolarHBondContact O-N 3.47Å; R83-I87 WeakPolarHBondContact O-CG1 3.48Å; R83-I87 PolarHBondContact O-N 3.39Å; R83-I87 VanDerWaalsContact O-N 3.07Å
84	L	69	Low	67.4	Low	117 Å²	117	104.1 Å²	104.1	61%	0.613	55%	0.548	S	S	*	.	H	α-helix	trans	-67	-38.4	176.8	-71.9	173.2	0	0	0	112.3	Q80 Q81 K82 T86 I87 A88	Q80-L84 WeakPolarHBondContact O-CB 3.39Å; Q80-L84 VanDerWaalsContact O-CG 3.29Å; Q80-L84 WeakPolarHBondContact O-CG 3.46Å; Q80-L84 PolarHBondContact O-N 3.38Å; Q81-L84 PolarHBondContact O-N 3.27Å; K82-L84 PolarHBondContact O-N 3.15Å; L84-T86 VanDerWaalsContact C-N 3.32Å; L84-T86 PolarHBondContact O-N 3.29Å; L84-I87 PolarHBondContact O-N 3.1Å; L84-A88 PolarHBondContact O-N 3.5Å
85	A	69.7	Low	66.3	Low	60 Å²	60	108.4 Å²	108.4	50%	0.496	56%	0.558	S	S	.	*	H	α-helix	trans	-62.1	-40	174.6	0	0	0	0	0	111.7	Q81 K82 A88 A89	Q81-A85 WeakPolarHBondContact O-CB 3.46Å; Q81-A85 PolarHBondContact O-N 3.43Å; K82-A85 PolarHBondContact O-N 3.12Å; A85-A88 PolarHBondContact O-N 3.48Å; A85-A89 PolarHBondContact O-N 2.94Å; A85-A89 VanDerWaalsContact O-N 3.13Å
86	T	64.5	Low	65.4	Low	98 Å²	98	107 Å²	107	60%	0.601	56%	0.56	S	S	*	*	H	α-helix	trans	-64.5	-39.5	173.9	-49.6	0	0	0	0	112.1	K82 R83 L84 A89 T90	K82-T86 PolarHBondContact O-N 3.25Å; K82-T86 PolarHBondContact O-OG1 3.01Å; K82-T86 VanDerWaalsContact O-OG1 3.06Å; R83-T86 PolarHBondContact O-N 3.47Å; L84-T86 VanDerWaalsContact C-N 3.32Å; L84-T86 PolarHBondContact O-N 3.29Å; T86-A89 PolarHBondContact O-N 3.45Å; T86-T90 PolarHBondContact O-N 3.35Å
87	I	59.8	Low	64	Low	98 Å²	98	106.1 Å²	106.1	50%	0.503	56%	0.555	S	S	.	*	H	α-helix	trans	-67.8	-37.2	176.9	-65.4	164.4	0	0	0	111.2	R83 L84 A89 T90	R83-I87 WeakPolarHBondContact O-CG1 3.48Å; R83-I87 PolarHBondContact O-N 3.39Å; R83-I87 VanDerWaalsContact O-N 3.07Å; L84-I87 PolarHBondContact O-N 3.1Å; I87-A89 VanDerWaalsContact C-N 3.26Å; I87-A89 PolarHBondContact O-N 3.27Å; I87-T90 VanDerWaalsContact C-OG1 3.31Å; I87-T90 WeakPolarHBondContact CA-OG1 3.48Å; I87-T90 PolarHBondContact O-N 2.83Å; I87-T90 PolarHBondContact O-OG1 2.94Å
88	A	58.8	Low	62.9	Low	66 Å²	66	108.8 Å²	108.8	55%	0.545	57%	0.565	S	S	.	*	H	α-helix	trans	-63.4	-34.2	174.4	0	0	0	0	0	112.2	L84 A85 T90	L84-A88 PolarHBondContact O-N 3.5Å; A85-A88 PolarHBondContact O-N 3.48Å; A88-T90 VanDerWaalsContact C-N 3.27Å; A88-T90 PolarHBondContact O-N 3.25Å
89	A	55.4	Low	61.7	Low	81 Å²	81	112.1 Å²	112.1	67%	0.669	58%	0.577	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.5	3	176.8	0	0	0	0	0	114.4	A85 T86 I87 P91	A85-A89 PolarHBondContact O-N 2.94Å; A85-A89 VanDerWaalsContact O-N 3.13Å; T86-A89 PolarHBondContact O-N 3.45Å; I87-A89 VanDerWaalsContact C-N 3.26Å; I87-A89 PolarHBondContact O-N 3.27Å; A89-P91 WeakPolarHBondContact O-CD 3.42Å
90	T	54.9	Low	60.3	Low	63 Å²	63	112.6 Å²	112.6	39%	0.387	58%	0.577	S	S	.	*			trans	-70.6	125.7	179.4	-22.8	0	0	0	0	110.4	T86 I87 A88 R92 M93	T86-T90 PolarHBondContact O-N 3.35Å; I87-T90 VanDerWaalsContact C-OG1 3.31Å; I87-T90 WeakPolarHBondContact CA-OG1 3.48Å; I87-T90 PolarHBondContact O-N 2.83Å; I87-T90 PolarHBondContact O-OG1 2.94Å; A88-T90 VanDerWaalsContact C-N 3.27Å; A88-T90 PolarHBondContact O-N 3.25Å; T90-R92 PolarHBondContact O-N 2.87Å; T90-M93 PolarHBondContact O-N 2.85Å
91	P	53.9	Low	58.8	Low	95 Å²	95	113.2 Å²	113.2	62%	0.617	59%	0.587	S	S	*	*	H	α-helix	trans	-61	-16.6	-175.9	20.6	-32.9	0	0	0	114.5	A89 M93 A94 R95	A89-P91 WeakPolarHBondContact O-CD 3.42Å; P91-M93 VanDerWaalsContact C-N 3.32Å; P91-M93 PolarHBondContact O-N 3.05Å; P91-A94 PolarHBondContact O-N 3.36Å; P91-R95 PolarHBondContact O-N 3.32Å; P91-R95 VanDerWaalsContact O-N 3.15Å
92	R	53.9	Low	57.7	Low	222 Å²	222	111.2 Å²	111.2	84%	0.838	59%	0.586	S	S	*	*	H	α-helix	trans	-61.7	-35.8	170.9	-87.6	-170.6	170.8	179.6	-1.7	112.8	T90 A96	T90-R92 PolarHBondContact O-N 2.87Å; R92-A96 PolarHBondContact O-N 2.89Å
93	M	54.2	Low	56.5	Low	95 Å²	95	111.3 Å²	111.3	47%	0.468	59%	0.591	S	S	.	*	H	α-helix	trans	-74.6	-37.5	174.1	-74.9	-135.8	-66.7	0	0	111.9	T90 P91 R95 A96 L97	T90-M93 PolarHBondContact O-N 2.85Å; P91-M93 VanDerWaalsContact C-N 3.32Å; P91-M93 PolarHBondContact O-N 3.05Å; M93-R95 PolarHBondContact O-N 3.48Å; M93-A96 WeakPolarHBondContact O-CB 3.27Å; M93-A96 PolarHBondContact O-N 2.89Å; M93-L97 WeakPolarHBondContact O-CG 3.42Å; M93-L97 PolarHBondContact O-N 3.46Å
94	A	53.4	Low	55.5	Low	52 Å²	52	104.7 Å²	104.7	43%	0.43	57%	0.571	S	S	.	*	H	α-helix	trans	-57	-38.9	175.2	0	0	0	0	0	112.2	P91 L97 Q98	P91-A94 PolarHBondContact O-N 3.36Å; A94-L97 PolarHBondContact O-N 2.62Å; A94-Q98 WeakPolarHBondContact O-CG 3.47Å; A94-Q98 PolarHBondContact O-N 3.39Å
95	R	54.8	Low	54.7	Low	196 Å²	196	105.6 Å²	105.6	74%	0.74	57%	0.57	S	S	*	*	H	α-helix	trans	-70.5	-33.8	173.9	-72.1	-172.8	-179.2	-167.3	0.6	113.7	P91 M93	P91-R95 PolarHBondContact O-N 3.32Å; P91-R95 VanDerWaalsContact O-N 3.15Å; M93-R95 PolarHBondContact O-N 3.48Å
96	A	53.2	Low	54	Low	51 Å²	51	106.9 Å²	106.9	42%	0.421	57%	0.568	S	S	.	*	H	α-helix	trans	-67.1	-39.7	173.7	0	0	0	0	0	111.3	R92 M93 K99 Q100	R92-A96 PolarHBondContact O-N 2.89Å; M93-A96 WeakPolarHBondContact O-CB 3.27Å; M93-A96 PolarHBondContact O-N 2.89Å; A96-K99 PolarHBondContact O-N 3.2Å; A96-Q100 WeakPolarHBondContact O-CG 3.41Å; A96-Q100 PolarHBondContact O-N 3.26Å
97	L	49.5	Very low	53.8	Low	70 Å²	70	108.3 Å²	108.3	37%	0.366	57%	0.572	S	S	.	*	H	α-helix	trans	-68.4	-34.6	177.3	-66.3	-177.2	0	0	0	113	M93 A94 K99 Q100 I108	M93-L97 WeakPolarHBondContact O-CG 3.42Å; M93-L97 PolarHBondContact O-N 3.46Å; A94-L97 PolarHBondContact O-N 2.62Å; L97-K99 PolarHBondContact O-N 3.18Å; L97-Q100 PolarHBondContact O-N 3.13Å; L97-I108 HydrophobicContact CD1-CD1 3.97Å; L97-I108 HydrophobicContact CD2-CD1 3.27Å; L97-I108 HydrophobicContact CG-CD1 4.21Å
98	Q	54.4	Low	53.9	Low	163 Å²	163	106.5 Å²	106.5	76%	0.762	56%	0.563	S	S	*	*	H	α-helix	trans	-66	-24.6	174.9	-77.5	-176.9	1.2	0	0	113.5	A94	A94-Q98 WeakPolarHBondContact O-CG 3.47Å; A94-Q98 PolarHBondContact O-N 3.39Å
99	K	55.2	Low	54.2	Low	191 Å²	191	109.6 Å²	109.6	83%	0.83	56%	0.564	S	S	*	*	H	α-helix	trans	-87.9	-11.7	175.2	-73.3	-168.7	175.8	-170.4	0	113.8	A96 L97 T101	A96-K99 PolarHBondContact O-N 3.2Å; L97-K99 PolarHBondContact O-N 3.18Å; K99-T101 PolarHBondContact O-N 3.38Å
100	Q	46.8	Very low	54.6	Low	97 Å²	97	112.3 Å²	112.3	45%	0.453	56%	0.561	S	S	.	*	S	Bend	trans	-83.7	115.1	177.2	-70.8	-179.3	-16.7	0	0	108.8	A96 L97 A104	A96-Q100 WeakPolarHBondContact O-CG 3.41Å; A96-Q100 PolarHBondContact O-N 3.26Å; L97-Q100 PolarHBondContact O-N 3.13Å; Q100-A104 HydrophobicContact CB-CB 3.54Å; Q100-A104 HydrophobicContact CG-CB 4.49Å
101	T	46.5	Very low	55.2	Low	108 Å²	108	117.8 Å²	117.8	66%	0.663	58%	0.575	S	S	*	*			trans	-33.1	147.3	170.8	22.8	0	0	0	0	113.1	K99 M103 A104	K99-T101 PolarHBondContact O-N 3.38Å; T101-M103 PolarHBondContact O-N 3.4Å; T101-A104 PolarHBondContact O-N 3.44Å
102	P	55.3	Low	55.9	Low	99 Å²	99	118 Å²	118	64%	0.643	57%	0.571	S	S	*	*	T	Hydrogen-bonded Turn	trans	-49.2	-29.4	-165.8	15.3	-29.9	0	0	0	115.5	A104 K105	P102-A104 PolarHBondContact O-N 3.34Å; P102-K105 PolarHBondContact O-N 2.95Å
103	M	49.9	Very low	56.7	Low	153 Å²	153	110.5 Å²	110.5	75%	0.754	55%	0.546	S	S	*	.	H	α-helix	trans	-60	-24.3	175.2	-56.4	-58.5	-131	0	0	114.9	T101 L107	T101-M103 PolarHBondContact O-N 3.4Å; M103-L107 PolarHBondContact O-N 3.28Å
104	A	53.3	Low	57.4	Low	23 Å²	23	112.5 Å²	112.5	19%	0.19	55%	0.553	C	S	.	*	H	α-helix	trans	-78.3	-25.5	-179.1	0	0	0	0	0	113.1	Q100 T101 P102 D106 L107 I108	Q100-A104 HydrophobicContact CB-CB 3.54Å; Q100-A104 HydrophobicContact CG-CB 4.49Å; T101-A104 PolarHBondContact O-N 3.44Å; P102-A104 PolarHBondContact O-N 3.34Å; A104-D106 VanDerWaalsContact C-N 3.32Å; A104-L107 PolarHBondContact O-N 3.36Å; A104-I108 WeakPolarHBondContact O-CG1 3.38Å; A104-I108 PolarHBondContact O-N 3.06Å
105	K	52.1	Low	57.9	Low	136 Å²	136	114.1 Å²	114.1	59%	0.591	55%	0.553	S	S	*	*	H	α-helix	trans	-66.7	-39.9	175.6	-66	179.5	-177.5	174.5	0	110.5	P102 I108 F109	P102-K105 PolarHBondContact O-N 2.95Å; K105-I108 PolarHBondContact O-N 3.41Å; K105-F109 PolarHBondContact O-N 3.4Å
106	D	54.4	Low	58.1	Low	87 Å²	87	108.1 Å²	108.1	47%	0.465	54%	0.542	S	S	.	.	H	α-helix	trans	-62.3	-45.5	176.9	-63.2	-27.6	0	0	0	110.8	A104 I108 F109 F110	A104-D106 VanDerWaalsContact C-N 3.32Å; D106-I108 VanDerWaalsContact C-N 3.28Å; D106-I108 PolarHBondContact O-N 3.44Å; D106-F109 WeakPolarHBondContact O-CB 3.47Å; D106-F109 PolarHBondContact O-N 3.46Å; D106-F109 VanDerWaalsContact O-N 3.14Å; D106-F110 HydrophobicContact CB-CD2 4.41Å; D106-F110 HydrophobicContact CB-CE2 4.4Å; D106-F110 WeakPolarHBondContact O-CD2 3.44Å; D106-F110 PolarHBondContact O-N 3.33Å
107	L	60.6	Low	58.4	Low	129 Å²	129	112.4 Å²	112.4	68%	0.675	55%	0.551	S	S	*	*	H	α-helix	trans	-61.3	-36.2	179.1	-166.9	68.9	0	0	0	112.7	M103 A104 R111	M103-L107 PolarHBondContact O-N 3.28Å; A104-L107 PolarHBondContact O-N 3.36Å; L107-R111 WeakPolarHBondContact O-CB 3.29Å; L107-R111 PolarHBondContact O-N 3.28Å
108	I	62.3	Low	58.8	Low	60 Å²	60	113.8 Å²	113.8	31%	0.308	56%	0.558	S	S	.	*	H	α-helix	trans	-71.3	-40.4	176.5	-65.6	164.7	0	0	0	110.9	L97 A104 K105 D106 R111 N112	L97-I108 HydrophobicContact CD1-CD1 3.97Å; L97-I108 HydrophobicContact CD2-CD1 3.27Å; L97-I108 HydrophobicContact CG-CD1 4.21Å; A104-I108 WeakPolarHBondContact O-CG1 3.38Å; A104-I108 PolarHBondContact O-N 3.06Å; K105-I108 PolarHBondContact O-N 3.41Å; D106-I108 VanDerWaalsContact C-N 3.28Å; D106-I108 PolarHBondContact O-N 3.44Å; I108-R111 PolarHBondContact O-N 2.88Å; I108-N112 PolarHBondContact O-N 3.48Å
109	F	64.8	Low	58.9	Low	131 Å²	131	109.9 Å²	109.9	58%	0.575	55%	0.549	S	S	*	.	H	α-helix	trans	-61.7	-46	174.9	-173.5	-105.4	0	0	0	111.2	K105 D106 R111 N112 I113	K105-F109 PolarHBondContact O-N 3.4Å; D106-F109 WeakPolarHBondContact O-CB 3.47Å; D106-F109 PolarHBondContact O-N 3.46Å; D106-F109 VanDerWaalsContact O-N 3.14Å; F109-R111 PolarHBondContact O-N 3.3Å; F109-N112 PolarHBondContact O-N 3.05Å; F109-I113 HydrophobicContact CD1-CD1 3.63Å; F109-I113 HydrophobicContact CE1-CD1 3.22Å; F109-I113 HydrophobicContact CE1-CG1 4.41Å; F109-I113 HydrophobicContact CE2-CD1 4.3Å; F109-I113 HydrophobicContact CG-CD1 4.33Å; F109-I113 HydrophobicContact CZ-CD1 3.6Å; F109-I113 WeakPolarHBondContact O-CG1 3.44Å; F109-I113 PolarHBondContact O-N 2.9Å
110	F	64	Low	59	Low	138 Å²	138	106.7 Å²	106.7	61%	0.605	54%	0.54	S	S	*	.	H	α-helix	trans	-61.8	-41.7	174	-80.1	-67.7	0	0	0	112.3	D106 N112 I113 F114	D106-F110 HydrophobicContact CB-CD2 4.41Å; D106-F110 HydrophobicContact CB-CE2 4.4Å; D106-F110 WeakPolarHBondContact O-CD2 3.44Å; D106-F110 PolarHBondContact O-N 3.33Å; F110-N112 PolarHBondContact O-N 3.34Å; F110-I113 PolarHBondContact O-N 3.48Å; F110-F114 WeakPolarHBondContact O-CB 3.38Å; F110-F114 PolarHBondContact O-N 3.33Å
111	R	67.3	Low	59.5	Low	178 Å²	178	105.9 Å²	105.9	67%	0.672	54%	0.542	S	S	*	.	H	α-helix	trans	-62.2	-42.1	176.7	-172.4	179	176.3	-177.1	-0.7	111.7	L107 I108 F109 F114 L115	L107-R111 WeakPolarHBondContact O-CB 3.29Å; L107-R111 PolarHBondContact O-N 3.28Å; I108-R111 PolarHBondContact O-N 2.88Å; F109-R111 PolarHBondContact O-N 3.3Å; R111-F114 PolarHBondContact O-N 2.92Å; R111-L115 HydrophobicContact CG-CD1 4.04Å; R111-L115 HydrophobicContact CG-CG 4.47Å; R111-L115 WeakPolarHBondContact O-CB 3.33Å; R111-L115 VanDerWaalsContact O-CG 3.29Å; R111-L115 WeakPolarHBondContact O-CG 3.33Å; R111-L115 PolarHBondContact O-N 3.43Å
112	N	67.7	Low	59.8	Low	100 Å²	100	103.3 Å²	103.3	54%	0.535	53%	0.531	S	S	.	.	H	α-helix	trans	-67.6	-39.9	178.7	-76.2	-12.3	0	0	0	112.3	I108 F109 F110 S116	I108-N112 PolarHBondContact O-N 3.48Å; F109-N112 PolarHBondContact O-N 3.05Å; F110-N112 PolarHBondContact O-N 3.34Å; N112-S116 PolarHBondContact O-N 3.49Å; N112-S116 PolarHBondContact O-OG 3.36Å
113	I	72.1	Confident	59.8	Low	64 Å²	64	101 Å²	101	33%	0.328	52%	0.521	S	S	.	.	H	α-helix	trans	-65.2	-40.2	174	-69.4	170.2	0	0	0	111.2	F109 F110 S116 K117	F109-I113 HydrophobicContact CD1-CD1 3.63Å; F109-I113 HydrophobicContact CE1-CD1 3.22Å; F109-I113 HydrophobicContact CE1-CG1 4.41Å; F109-I113 HydrophobicContact CE2-CD1 4.3Å; F109-I113 HydrophobicContact CG-CD1 4.33Å; F109-I113 HydrophobicContact CZ-CD1 3.6Å; F109-I113 WeakPolarHBondContact O-CG1 3.44Å; F109-I113 PolarHBondContact O-N 2.9Å; F110-I113 PolarHBondContact O-N 3.48Å; I113-S116 PolarHBondContact O-N 3.35Å; I113-S116 PolarHBondContact O-OG 2.91Å; I113-K117 PolarHBondContact O-N 3.06Å; I113-K117 VanDerWaalsContact O-N 3.13Å
114	F	67.5	Low	59.8	Low	136 Å²	136	99.8 Å²	99.8	60%	0.596	51%	0.513	S	S	*	.	H	α-helix	trans	-66.1	-44.5	178.9	-172.8	-95.9	0	0	0	111.5	F110 R111 S116 K117 L118	F110-F114 WeakPolarHBondContact O-CB 3.38Å; F110-F114 PolarHBondContact O-N 3.33Å; R111-F114 PolarHBondContact O-N 2.92Å; F114-S116 PolarHBondContact O-N 3.07Å; F114-K117 PolarHBondContact O-N 3.07Å; F114-L118 HydrophobicContact CE1-CD1 4.28Å; F114-L118 HydrophobicContact CZ-CD1 4.4Å; F114-L118 WeakPolarHBondContact O-CB 3.31Å; F114-L118 PolarHBondContact O-N 3.25Å
115	L	64.6	Low	59.8	Low	86 Å²	86	105.4 Å²	105.4	45%	0.45	54%	0.535	S	S	.	.	H	α-helix	trans	-66.1	-35.3	178.2	-70.6	173	0	0	0	112.5	R111 L118 S119	R111-L115 HydrophobicContact CG-CD1 4.04Å; R111-L115 HydrophobicContact CG-CG 4.47Å; R111-L115 WeakPolarHBondContact O-CB 3.33Å; R111-L115 VanDerWaalsContact O-CG 3.29Å; R111-L115 WeakPolarHBondContact O-CG 3.33Å; R111-L115 PolarHBondContact O-N 3.43Å; L115-L118 PolarHBondContact O-N 3.49Å; L115-S119 WeakPolarHBondContact O-CB 3.39Å; L115-S119 PolarHBondContact O-N 2.96Å
116	S	59.7	Low	59.8	Low	71 Å²	71	103.9 Å²	103.9	50%	0.497	54%	0.537	S	S	.	.	H	α-helix	trans	-67.1	-41.3	175.5	68.7	0	0	0	0	111.9	N112 I113 F114 S119 L120	N112-S116 PolarHBondContact O-N 3.49Å; N112-S116 PolarHBondContact O-OG 3.36Å; I113-S116 PolarHBondContact O-N 3.35Å; I113-S116 PolarHBondContact O-OG 2.91Å; F114-S116 PolarHBondContact O-N 3.07Å; S116-S119 PolarHBondContact O-N 2.95Å; S116-L120 PolarHBondContact O-N 3.04Å
117	K	57.9	Low	59.5	Low	141 Å²	141	104.9 Å²	104.9	61%	0.613	54%	0.542	S	S	*	.	H	α-helix	trans	-64.4	-41.5	172.9	-72.7	-167.9	178.4	-165	0	112.2	I113 F114 S119 L120 V121	I113-K117 PolarHBondContact O-N 3.06Å; I113-K117 VanDerWaalsContact O-N 3.13Å; F114-K117 PolarHBondContact O-N 3.07Å; K117-S119 VanDerWaalsContact C-N 3.33Å; K117-S119 PolarHBondContact O-N 3.28Å; K117-L120 PolarHBondContact O-N 3.4Å; K117-V121 WeakPolarHBondContact O-CG2 3.49Å; K117-V121 PolarHBondContact O-N 3.11Å
118	L	59.6	Low	58.6	Low	98 Å²	98	103.7 Å²	103.7	51%	0.513	53%	0.533	S	S	.	.	H	α-helix	trans	-63.4	-40.6	177.9	-155.4	80.4	0	0	0	111.4	F114 L115 V121 A122	F114-L118 HydrophobicContact CE1-CD1 4.28Å; F114-L118 HydrophobicContact CZ-CD1 4.4Å; F114-L118 WeakPolarHBondContact O-CB 3.31Å; F114-L118 PolarHBondContact O-N 3.25Å; L115-L118 PolarHBondContact O-N 3.49Å; L118-V121 PolarHBondContact O-N 3.21Å; L118-A122 WeakPolarHBondContact O-CB 3.44Å; L118-A122 PolarHBondContact O-N 3.43Å
119	S	56.3	Low	57.8	Low	81 Å²	81	102.8 Å²	102.8	57%	0.566	54%	0.539	S	S	*	.	H	α-helix	trans	-64.3	-38.7	174.4	-173.5	0	0	0	0	112.3	L115 S116 K117 A122 A123	L115-S119 WeakPolarHBondContact O-CB 3.39Å; L115-S119 PolarHBondContact O-N 2.96Å; S116-S119 PolarHBondContact O-N 2.95Å; K117-S119 VanDerWaalsContact C-N 3.33Å; K117-S119 PolarHBondContact O-N 3.28Å; S119-A122 PolarHBondContact O-N 3.47Å; S119-A123 WeakPolarHBondContact O-CB 3.29Å; S119-A123 PolarHBondContact O-N 3.34Å
120	L	56.1	Low	56.8	Low	125 Å²	125	99.9 Å²	99.9	65%	0.654	54%	0.535	S	S	*	.	H	α-helix	trans	-67.2	-41.5	177.6	-169.3	68.4	0	0	0	111.3	S116 K117 A123 H124	S116-L120 PolarHBondContact O-N 3.04Å; K117-L120 PolarHBondContact O-N 3.4Å; L120-A123 PolarHBondContact O-N 3.44Å; L120-H124 WeakPolarHBondContact O-CB 3.47Å; L120-H124 PolarHBondContact O-N 3.26Å
121	V	56.9	Low	55.9	Low	80 Å²	80	97.5 Å²	97.5	49%	0.485	53%	0.527	S	S	.	.	H	α-helix	trans	-65.2	-40.9	175.2	173.6	0	0	0	0	111.1	K117 L118 H124 Q125	K117-V121 WeakPolarHBondContact O-CG2 3.49Å; K117-V121 PolarHBondContact O-N 3.11Å; L118-V121 PolarHBondContact O-N 3.21Å; V121-H124 PolarHBondContact O-N 2.99Å; V121-Q125 PolarHBondContact O-N 3.03Å
122	A	54.3	Low	54.8	Low	53 Å²	53	96.2 Å²	96.2	44%	0.438	53%	0.527	S	S	.	.	H	α-helix	trans	-61.2	-46.9	175.1	0	0	0	0	0	111.1	L118 S119 H124 Q125 T126	L118-A122 WeakPolarHBondContact O-CB 3.44Å; L118-A122 PolarHBondContact O-N 3.43Å; S119-A122 PolarHBondContact O-N 3.47Å; A122-H124 VanDerWaalsContact C-N 3.29Å; A122-H124 PolarHBondContact O-N 3.25Å; A122-Q125 PolarHBondContact O-N 3.14Å; A122-T126 PolarHBondContact O-N 2.94Å; A122-T126 PolarHBondContact O-OG1 2.93Å
123	A	54.4	Low	53.8	Low	51 Å²	51	98.8 Å²	98.8	42%	0.421	54%	0.535	S	S	.	.	H	α-helix	trans	-61.5	-37.4	176.5	0	0	0	0	0	112.5	S119 L120 T126 L127	S119-A123 WeakPolarHBondContact O-CB 3.29Å; S119-A123 PolarHBondContact O-N 3.34Å; L120-A123 PolarHBondContact O-N 3.44Å; A123-T126 PolarHBondContact O-N 3.36Å; A123-L127 PolarHBondContact O-N 3.39Å; A123-L127 VanDerWaalsContact O-N 3.13Å
124	H	49.8	Very low	52.6	Low	128 Å²	128	99.7 Å²	99.7	59%	0.593	54%	0.544	S	S	*	.	H	α-helix	trans	-70.5	-34.1	177.7	-149.6	-87.3	0	0	0	112.3	L120 V121 A122 L127 H128	L120-H124 WeakPolarHBondContact O-CB 3.47Å; L120-H124 PolarHBondContact O-N 3.26Å; V121-H124 PolarHBondContact O-N 2.99Å; A122-H124 VanDerWaalsContact C-N 3.29Å; A122-H124 PolarHBondContact O-N 3.25Å; H124-L127 PolarHBondContact O-N 2.68Å; H124-H128 WeakPolarHBondContact O-CB 3.47Å; H124-H128 PolarHBondContact O-N 3.08Å
125	Q	53.8	Low	51.3	Low	141 Å²	141	100.2 Å²	100.2	66%	0.659	55%	0.546	S	S	*	.	H	α-helix	trans	-68.7	-35.8	172.5	-76.4	-176.5	23.6	0	0	112.3	V121 A122 L127 H128 G129	V121-Q125 PolarHBondContact O-N 3.03Å; A122-Q125 PolarHBondContact O-N 3.14Å; Q125-L127 VanDerWaalsContact C-N 3.33Å; Q125-L127 PolarHBondContact O-N 2.9Å; Q125-H128 PolarHBondContact O-N 3.23Å; Q125-G129 PolarHBondContact O-N 2.75Å
126	T	52.2	Low	50.3	Low	104 Å²	104	104.2 Å²	104.2	64%	0.638	56%	0.56	S	S	*	*	H	α-helix	trans	-66.1	-37	175.1	-23.7	0	0	0	0	111.8	A122 A123 S130	A122-T126 PolarHBondContact O-N 2.94Å; A122-T126 PolarHBondContact O-OG1 2.93Å; A123-T126 PolarHBondContact O-N 3.36Å; T126-S130 WeakPolarHBondContact O-CB 3.45Å; T126-S130 PolarHBondContact O-N 2.97Å; T126-S130 VanDerWaalsContact O-N 3.12Å
127	L	46.9	Very low	49.4	Very low	108 Å²	108	109 Å²	109	57%	0.565	57%	0.572	S	S	*	*	H	α-helix	trans	-67.6	-40.5	172	-93.4	153.1	0	0	0	112	A123 H124 Q125 G129 S130 I131	A123-L127 PolarHBondContact O-N 3.39Å; A123-L127 VanDerWaalsContact O-N 3.13Å; H124-L127 PolarHBondContact O-N 2.68Å; Q125-L127 VanDerWaalsContact C-N 3.33Å; Q125-L127 PolarHBondContact O-N 2.9Å; L127-G129 PolarHBondContact O-N 2.86Å; L127-S130 PolarHBondContact O-N 3.03Å; L127-I131 VanDerWaalsContact O-CG1 3.27Å; L127-I131 WeakPolarHBondContact O-CG1 3.22Å; L127-I131 PolarHBondContact O-N 2.85Å
128	H	42.2	Very low	48.6	Very low	103 Å²	103	111.9 Å²	111.9	48%	0.477	58%	0.579	S	S	.	*	H	α-helix	trans	-73.9	-26.4	179.5	-135.3	-75.7	0	0	0	113.7	H124 Q125 K132	H124-H128 WeakPolarHBondContact O-CB 3.47Å; H124-H128 PolarHBondContact O-N 3.08Å; Q125-H128 PolarHBondContact O-N 3.23Å; H128-K132 PolarHBondContact O-N 2.96Å
129	G	45.5	Very low	48	Very low	42 Å²	42	111.4 Å²	111.4	43%	0.433	58%	0.58	S	S	.	*	H	α-helix	trans	-67.8	-41.5	168.2	0	0	0	0	0	111.9	Q125 L127 K132 E133	Q125-G129 PolarHBondContact O-N 2.75Å; L127-G129 PolarHBondContact O-N 2.86Å; G129-K132 PolarHBondContact O-N 2.92Å; G129-E133 PolarHBondContact O-N 3.49Å
130	S	43.3	Very low	47.4	Very low	70 Å²	70	113 Å²	113	49%	0.49	59%	0.587	S	S	.	*	H	α-helix	trans	-72.2	-31.2	178.8	-164.3	0	0	0	0	113.3	T126 L127 K132 E133 T134	T126-S130 WeakPolarHBondContact O-CB 3.45Å; T126-S130 PolarHBondContact O-N 2.97Å; T126-S130 VanDerWaalsContact O-N 3.12Å; L127-S130 PolarHBondContact O-N 3.03Å; S130-K132 VanDerWaalsContact C-N 3.31Å; S130-K132 PolarHBondContact O-N 2.96Å; S130-E133 PolarHBondContact O-N 3.36Å; S130-T134 PolarHBondContact O-N 3.42Å; S130-T134 PolarHBondContact O-OG1 3.2Å
131	I	46.6	Very low	46.9	Very low	88 Å²	88	112.6 Å²	112.6	45%	0.451	59%	0.589	S	S	.	*	H	α-helix	trans	-68.2	-31.2	174.7	-68	163.7	0	0	0	111.4	L127 T134 F135	L127-I131 VanDerWaalsContact O-CG1 3.27Å; L127-I131 WeakPolarHBondContact O-CG1 3.22Å; L127-I131 PolarHBondContact O-N 2.85Å; I131-T134 WeakPolarHBondContact CA-OG1 3.49Å; I131-T134 PolarHBondContact O-OG1 3.36Å; I131-F135 WeakPolarHBondContact O-CB 3.34Å; I131-F135 PolarHBondContact O-N 3.04Å; I131-F135 VanDerWaalsContact O-N 3.1Å
132	K	43.9	Very low	46.2	Very low	151 Å²	151	115.7 Å²	115.7	66%	0.657	60%	0.601	S	S	*	*	H	α-helix	trans	-73	-33.4	176.6	-76.6	-174.6	176.9	-177.4	0	113.2	H128 G129 S130 K136	H128-K132 PolarHBondContact O-N 2.96Å; G129-K132 PolarHBondContact O-N 2.92Å; S130-K132 VanDerWaalsContact C-N 3.31Å; S130-K132 PolarHBondContact O-N 2.96Å; K132-K136 PolarHBondContact O-N 2.77Å
133	E	45.8	Very low	45.6	Very low	153 Å²	153	123.6 Å²	123.6	72%	0.715	63%	0.634	S	S	*	*	H	α-helix	trans	-77	-37.4	175.5	-69.6	-146.6	146.5	0	0	112.8	G129 S130 F135 K136 F137	G129-E133 PolarHBondContact O-N 3.49Å; S130-E133 PolarHBondContact O-N 3.36Å; E133-F135 VanDerWaalsContact C-N 3.32Å; E133-F135 PolarHBondContact O-N 3.2Å; E133-K136 PolarHBondContact O-N 3.36Å; E133-F137 PolarHBondContact O-N 2.83Å
134	T	46.6	Very low	45.2	Very low	83 Å²	83	127.2 Å²	127.2	51%	0.509	64%	0.644	S	S	.	*	H	α-helix	trans	-69.1	-29.3	175.9	49.2	0	0	0	0	112.9	S130 I131 R138	S130-T134 PolarHBondContact O-N 3.42Å; S130-T134 PolarHBondContact O-OG1 3.2Å; I131-T134 WeakPolarHBondContact CA-OG1 3.49Å; I131-T134 PolarHBondContact O-OG1 3.36Å; T134-R138 PolarHBondContact O-N 3.07Å
135	F	40.6	Very low	45	Very low	147 Å²	147	127.2 Å²	127.2	65%	0.645	65%	0.647	S	S	*	*	H	α-helix	trans	-75.9	-34.3	174.3	-147.8	-93.4	0	0	0	113	I131 E133 F137 R138 V139	I131-F135 WeakPolarHBondContact O-CB 3.34Å; I131-F135 PolarHBondContact O-N 3.04Å; I131-F135 VanDerWaalsContact O-N 3.1Å; E133-F135 VanDerWaalsContact C-N 3.32Å; E133-F135 PolarHBondContact O-N 3.2Å; F135-F137 VanDerWaalsContact C-N 3.33Å; F135-R138 PolarHBondContact O-N 2.73Å; F135-V139 HydrophobicContact CD1-CG2 4.2Å; F135-V139 HydrophobicContact CE1-CG2 4.08Å; F135-V139 PolarHBondContact O-N 3.15Å
136	K	43	Very low	44.5	Very low	170 Å²	170	126.4 Å²	126.4	74%	0.739	65%	0.647	S	S	*	*	H	α-helix	trans	-65.7	-36.2	171.2	-98.1	-172.9	175.7	-176.2	0	112.4	K132 E133 R138 T140	K132-K136 PolarHBondContact O-N 2.77Å; E133-K136 PolarHBondContact O-N 3.36Å; K136-R138 VanDerWaalsContact C-N 3.32Å; K136-R138 PolarHBondContact O-N 3.24Å; K136-T140 PolarHBondContact O-OG1 2.91Å
137	F	40.9	Very low	44	Very low	171 Å²	171	127.7 Å²	127.7	75%	0.75	65%	0.647	S	S	*	*	H	α-helix	trans	-70.1	-27.1	178.5	-119.8	-85.3	0	0	0	113.6	E133 F135	E133-F137 PolarHBondContact O-N 2.83Å; F135-F137 VanDerWaalsContact C-N 3.33Å
138	R	41.8	Very low	43.8	Very low	203 Å²	203	128.9 Å²	128.9	77%	0.766	65%	0.652	S	S	*	*	H	α-helix	trans	-82	-25.9	178.5	-92.2	-174	153.8	-170.8	-6.3	114.9	T134 F135 K136	T134-R138 PolarHBondContact O-N 3.07Å; F135-R138 PolarHBondContact O-N 2.73Å; K136-R138 VanDerWaalsContact C-N 3.32Å; K136-R138 PolarHBondContact O-N 3.24Å
139	V	46.9	Very low	44	Very low	87 Å²	87	130.7 Å²	130.7	53%	0.527	66%	0.664	S	S	.	*	H	α-helix	trans	-79.3	-30.2	179.9	178.7	0	0	0	0	112	F135 V141 I142	F135-V139 HydrophobicContact CD1-CG2 4.2Å; F135-V139 HydrophobicContact CE1-CG2 4.08Å; F135-V139 PolarHBondContact O-N 3.15Å; V139-V141 VanDerWaalsContact C-N 3.28Å; V139-V141 PolarHBondContact O-N 2.7Å; V139-I142 PolarHBondContact O-N 2.88Å
140	T	44.2	Very low	43.8	Very low	115 Å²	115	137 Å²	137	71%	0.706	68%	0.68	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.9	-11.1	-179.3	-44.7	0	0	0	0	114.1	K136	K136-T140 PolarHBondContact O-OG1 2.91Å
141	V	46.3	Very low	43.9	Very low	116 Å²	116	142.2 Å²	142.2	70%	0.703	70%	0.695	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.5	3.5	179.1	-175.1	0	0	0	0	112.2	V139	V139-V141 VanDerWaalsContact C-N 3.28Å; V139-V141 PolarHBondContact O-N 2.7Å
142	I	41.5	Very low	43.7	Very low	146 Å²	146	146.7 Å²	146.7	75%	0.749	72%	0.715	S	S	*	*			trans	-128.9	60.6	176.4	-43.7	177.7	0	0	0	109.9	V139	V139-I142 PolarHBondContact O-N 2.88Å
143	I	42.4	Very low	43.6	Very low	218 Å²	218	146.3 Å²	146.3	100%	1.118	72%	0.721	S	S	*	*			trans	-141.4	0	154	-56	-179.1	0	0	0	105.8

Retrieved 143 of 143 residues in 103.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).