A0A077Z7M1_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077Z7M1, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 69 aa.

						>A0A077Z7M1_TRITR|A0A077Z7M1
MRCASSSRDCNSLAIASASVRAKRQPSAENWVPVIPTDAYFRVEQSLCVHQGRPVDDVYWWPGDQLKIG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	38.4	Very low	43.2	Very low	239 Å²	239	128.9 Å²	128.9	100%	1.177	70%	0.698	S	S	*	*				0	110.3	0	-161.4	176	-126.2	0	0	106.3
2	R	35.3	Very low	43.7	Very low	251 Å²	251	124 Å²	124	95%	0.947	68%	0.681	S	S	*	*			trans	42.3	84.6	-172.8	-67.7	-177.5	174	-179.2	-2	115.6
3	C	38.5	Very low	43.9	Very low	119 Å²	119	123.4 Å²	123.4	80%	0.804	68%	0.675	S	S	*	*			trans	-93.1	108.4	157.5	-80.7	0	0	0	0	108.7	S5	C3-S5 PolarHBondContact O-N 2.97Å
4	A	37.7	Very low	44.2	Very low	95 Å²	95	118.9 Å²	118.9	79%	0.785	66%	0.663	S	S	*	*			trans	-75.9	95.8	159.9	0	0	0	0	0	106.4	S6	A4-S6 VanDerWaalsContact C-N 3.29Å; A4-S6 PolarHBondContact O-N 3.41Å
5	S	42.7	Very low	44.3	Very low	88 Å²	88	118.1 Å²	118.1	62%	0.615	66%	0.656	S	S	*	*			trans	-70.6	82.3	-174.8	-56.8	0	0	0	0	110.9	C3 S7	C3-S5 PolarHBondContact O-N 2.97Å; S5-S7 PolarHBondContact O-N 3.41Å
6	S	44.7	Very low	44.5	Very low	54 Å²	54	114.1 Å²	114.1	38%	0.378	64%	0.642	S	S	.	*			trans	-63.4	122.9	156.5	97	0	0	0	0	106.4	A4 R8 D9	A4-S6 VanDerWaalsContact C-N 3.29Å; A4-S6 PolarHBondContact O-N 3.41Å; S6-R8 PolarHBondContact O-N 3.06Å; S6-D9 WeakPolarHBondContact CB-OD2 3.38Å; S6-D9 PolarHBondContact O-N 3Å; S6-D9 PolarHBondContact OG-N 3.11Å; S6-D9 PolarHBondContact OG-OD2 3.08Å
7	S	49.7	Very low	44.7	Very low	95 Å²	95	112.6 Å²	112.6	66%	0.664	64%	0.641	S	S	*	*	H	α-helix	trans	-58.5	-11.4	-178.3	-44.1	0	0	0	0	113.3	S5 N11	S5-S7 PolarHBondContact O-N 3.41Å; S7-N11 PolarHBondContact O-ND2 3.34Å
8	R	50.7	Low	44.6	Very low	215 Å²	215	110.7 Å²	110.7	81%	0.811	64%	0.641	S	S	*	*	H	α-helix	trans	-77.9	-37.2	171.5	-75.9	178.9	172.1	169.7	-2.6	112.7	S6 N11 S12	S6-R8 PolarHBondContact O-N 3.06Å; R8-N11 PolarHBondContact O-N 2.77Å; R8-S12 PolarHBondContact O-N 2.83Å; R8-S12 VanDerWaalsContact O-N 3.12Å
9	D	44.8	Very low	44.6	Very low	91 Å²	91	109.6 Å²	109.6	49%	0.487	64%	0.64	S	S	.	*	H	α-helix	trans	-70.9	-36.4	179.2	-64.4	-42.9	0	0	0	111.6	S6 N11 S12 L13	S6-D9 WeakPolarHBondContact CB-OD2 3.38Å; S6-D9 PolarHBondContact O-N 3Å; S6-D9 PolarHBondContact OG-N 3.11Å; S6-D9 PolarHBondContact OG-OD2 3.08Å; D9-N11 PolarHBondContact O-N 3.45Å; D9-N11 VanDerWaalsContact C-N 3.29Å; D9-S12 PolarHBondContact O-N 3.47Å; D9-S12 PolarHBondContact O-OG 3.17Å; D9-L13 PolarHBondContact O-N 3.04Å
10	C	45.3	Very low	44.5	Very low	71 Å²	71	110.5 Å²	110.5	48%	0.48	65%	0.647	S	S	.	*	H	α-helix	trans	-63.2	-35.3	172.3	-63.4	0	0	0	0	112.2	A14	C10-A14 PolarHBondContact O-N 3.05Å
11	N	47.5	Very low	44.4	Very low	100 Å²	100	116.8 Å²	116.8	54%	0.535	66%	0.66	S	S	.	*	H	α-helix	trans	-70.7	-37	176.8	-96.4	-59	0	0	0	112.5	S7 R8 D9 L13 A14 I15	S7-N11 PolarHBondContact O-ND2 3.34Å; R8-N11 PolarHBondContact O-N 2.77Å; D9-N11 PolarHBondContact O-N 3.45Å; D9-N11 VanDerWaalsContact C-N 3.29Å; N11-L13 VanDerWaalsContact C-N 3.33Å; N11-L13 PolarHBondContact O-N 3.37Å; N11-A14 PolarHBondContact O-N 3.45Å; N11-I15 VanDerWaalsContact O-N 3.15Å; N11-I15 PolarHBondContact O-N 3.04Å; N11-I15 WeakPolarHBondContact O-CG1 3.4Å; N11-I15 WeakPolarHBondContact O-CD1 3.34Å; N11-I15 VanDerWaalsContact O-CG1 3.27Å
12	S	48.7	Very low	44.5	Very low	70 Å²	70	109.6 Å²	109.6	49%	0.49	64%	0.638	S	S	.	*	H	α-helix	trans	-66.9	-35.2	177.7	89.8	0	0	0	0	112.4	R8 D9 A16	R8-S12 PolarHBondContact O-N 2.83Å; R8-S12 VanDerWaalsContact O-N 3.12Å; D9-S12 PolarHBondContact O-N 3.47Å; D9-S12 PolarHBondContact O-OG 3.17Å; S12-A16 WeakPolarHBondContact O-CB 3.24Å; S12-A16 PolarHBondContact O-N 3.43Å
13	L	46.4	Very low	44.8	Very low	116 Å²	116	107.2 Å²	107.2	61%	0.607	64%	0.635	S	S	*	*	H	α-helix	trans	-72.2	-36.4	178	-94.3	145.9	0	0	0	113	D9 N11 S17	D9-L13 PolarHBondContact O-N 3.04Å; N11-L13 VanDerWaalsContact C-N 3.33Å; N11-L13 PolarHBondContact O-N 3.37Å; L13-S17 WeakPolarHBondContact O-CB 3.45Å; L13-S17 PolarHBondContact O-N 3.11Å; L13-S17 PolarHBondContact O-OG 3.16Å
14	A	47.8	Very low	45.1	Very low	61 Å²	61	113.1 Å²	113.1	50%	0.504	64%	0.64	S	S	.	*	H	α-helix	trans	-65.1	-41.6	173.6	0	0	0	0	0	111.6	C10 N11 A18	C10-A14 PolarHBondContact O-N 3.05Å; N11-A14 PolarHBondContact O-N 3.45Å; A14-A18 PolarHBondContact O-N 3.47Å; A14-A18 VanDerWaalsContact O-N 3.16Å
15	I	46.3	Very low	45.1	Very low	107 Å²	107	118.2 Å²	118.2	55%	0.549	65%	0.648	S	S	.	*	H	α-helix	trans	-74.6	-38.1	179.4	-63.5	166.8	0	0	0	111.8	N11 S17 A18 S19	N11-I15 VanDerWaalsContact O-N 3.15Å; N11-I15 PolarHBondContact O-N 3.04Å; N11-I15 WeakPolarHBondContact O-CG1 3.4Å; N11-I15 WeakPolarHBondContact O-CD1 3.34Å; N11-I15 VanDerWaalsContact O-CG1 3.27Å; I15-S17 VanDerWaalsContact C-N 3.31Å; I15-S17 PolarHBondContact O-N 3.34Å; I15-A18 PolarHBondContact O-N 3.04Å; I15-S19 PolarHBondContact O-N 2.87Å; I15-S19 VanDerWaalsContact O-N 3.11Å; I15-S19 PolarHBondContact O-OG 3.15Å
16	A	46.8	Very low	44.9	Very low	54 Å²	54	118 Å²	118	45%	0.446	64%	0.644	S	S	.	*	H	α-helix	trans	-64.6	-35.3	174.5	0	0	0	0	0	111.9	S12 V20	S12-A16 WeakPolarHBondContact O-CB 3.24Å; S12-A16 PolarHBondContact O-N 3.43Å; A16-V20 VanDerWaalsContact O-CG2 3.27Å; A16-V20 WeakPolarHBondContact O-CG2 3.27Å
17	S	48.3	Very low	44.8	Very low	89 Å²	89	119.5 Å²	119.5	62%	0.622	66%	0.655	S	S	*	*	H	α-helix	trans	-75.4	-28	177.1	-57.7	0	0	0	0	113	L13 I15	L13-S17 WeakPolarHBondContact O-CB 3.45Å; L13-S17 PolarHBondContact O-N 3.11Å; L13-S17 PolarHBondContact O-OG 3.16Å; I15-S17 VanDerWaalsContact C-N 3.31Å; I15-S17 PolarHBondContact O-N 3.34Å
18	A	44.1	Very low	44.6	Very low	77 Å²	77	119.9 Å²	119.9	64%	0.636	66%	0.664	S	S	*	*	H	α-helix	trans	-77.6	-25.1	174.2	0	0	0	0	0	113.6	A14 I15	A14-A18 PolarHBondContact O-N 3.47Å; A14-A18 VanDerWaalsContact O-N 3.16Å; I15-A18 PolarHBondContact O-N 3.04Å
19	S	44.4	Very low	44.5	Very low	90 Å²	90	117.6 Å²	117.6	63%	0.629	66%	0.662	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.5	-7	-174.4	-63.6	0	0	0	0	115.1	I15	I15-S19 PolarHBondContact O-N 2.87Å; I15-S19 VanDerWaalsContact O-N 3.11Å; I15-S19 PolarHBondContact O-OG 3.15Å
20	V	41.3	Very low	44.8	Very low	128 Å²	128	119.2 Å²	119.2	78%	0.776	67%	0.671	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.9	-1.1	-174.5	176.6	0	0	0	0	113.2	A16	A16-V20 VanDerWaalsContact O-CG2 3.27Å; A16-V20 WeakPolarHBondContact O-CG2 3.27Å
21	R	42.1	Very low	44.9	Very low	243 Å²	243	127.2 Å²	127.2	92%	0.917	69%	0.691	S	S	*	*	S	Bend	trans	-130.5	49	-177.7	-135.6	177	-161.8	-173.6	3.9	114.3
22	A	41.5	Very low	45.1	Very low	87 Å²	87	128 Å²	128	72%	0.719	70%	0.699	S	S	*	*			trans	-129.8	55	170.6	0	0	0	0	0	111
23	K	41.9	Very low	45.5	Very low	202 Å²	202	129.7 Å²	129.7	88%	0.878	71%	0.709	S	S	*	*			trans	-143	122.2	169	-69.8	-170.3	179.7	178.7	0	110.1
24	R	44.8	Very low	46	Very low	242 Å²	242	130.7 Å²	130.7	91%	0.913	72%	0.719	S	S	*	*			trans	96.8	94	179.7	-62	-178.8	169.8	-152.8	-3.5	115.3	P26	R24-P26 WeakPolarHBondContact O-CD 3.44Å
25	Q	37.3	Very low	46.4	Very low	202 Å²	202	132.2 Å²	132.2	94%	0.944	72%	0.718	S	S	*	*			trans	-84.1	119.6	150.6	-70.4	-164.3	-27.3	0	0	108.7
26	P	39.1	Very low	46.7	Very low	84 Å²	84	131.2 Å²	131.2	55%	0.545	72%	0.719	S	S	.	*			trans	-112.8	131.5	155.6	32.6	-22	0	0	0	110.1	R24	R24-P26 WeakPolarHBondContact O-CD 3.44Å
27	S	42.1	Very low	47	Very low	86 Å²	86	134 Å²	134	60%	0.601	73%	0.73	S	S	*	*	S	Bend	trans	57.1	147.7	166.5	64	0	0	0	0	118.9	E29	S27-E29 PolarHBondContact O-N 3.05Å
28	A	44.8	Very low	47	Very low	102 Å²	102	136.6 Å²	136.6	84%	0.843	74%	0.737	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.5	22.6	-177.7	0	0	0	0	0	115.2
29	E	49.4	Very low	47.2	Very low	167 Å²	167	135.5 Å²	135.5	78%	0.78	73%	0.728	S	S	*	*	T	Hydrogen-bonded Turn	trans	-97.9	-3.4	176.1	-76.8	177.8	98.9	0	0	113.2	S27	S27-E29 PolarHBondContact O-N 3.05Å
30	N	50.9	Low	47.3	Very low	126 Å²	126	138.6 Å²	138.6	67%	0.674	73%	0.727	S	S	*	*			trans	-107.3	77.2	-178.7	-108	-6	0	0	0	111.6	V32	N30-V32 PolarHBondContact O-N 3.47Å
31	W	48.4	Very low	47.4	Very low	238 Å²	238	140.5 Å²	140.5	90%	0.902	73%	0.725	S	S	*	*			trans	-69.1	95	165.4	-68.6	84.4	0	0	0	108.7	P33	W31-P33 WeakPolarHBondContact O-CD 3.27Å
32	V	51.2	Low	47.3	Very low	116 Å²	116	139.5 Å²	139.5	70%	0.703	72%	0.721	S	S	*	*			trans	-76.4	118.9	166.5	-179.7	0	0	0	0	106.8	N30 V34	N30-V32 PolarHBondContact O-N 3.47Å; V32-V34 VanDerWaalsContact O-N 3.11Å; V32-V34 PolarHBondContact O-N 3.06Å
33	P	57.1	Low	47.6	Very low	106 Å²	106	139.7 Å²	139.7	69%	0.688	71%	0.713	S	S	*	*			trans	-62.2	118.5	177.1	23.1	-30.6	0	0	0	109.4	W31 I35	W31-P33 WeakPolarHBondContact O-CD 3.27Å; P33-I35 PolarHBondContact O-N 3.39Å; P33-I35 VanDerWaalsContact O-N 3.08Å
34	V	57.4	Low	47.8	Very low	137 Å²	137	138.8 Å²	138.8	83%	0.83	71%	0.712	S	S	*	*			trans	-69.7	100.2	167.8	178.3	0	0	0	0	106.5	V32 P36	V32-V34 VanDerWaalsContact O-N 3.11Å; V32-V34 PolarHBondContact O-N 3.06Å; V34-P36 WeakPolarHBondContact O-CD 3.27Å
35	I	56.3	Low	47.9	Very low	94 Å²	94	136.6 Å²	136.6	48%	0.482	71%	0.712	S	S	.	*			trans	-69.6	121.1	169.8	-60.5	176	0	0	0	106.7	P33 T37 A39 Y40	P33-I35 PolarHBondContact O-N 3.39Å; P33-I35 VanDerWaalsContact O-N 3.08Å; I35-T37 PolarHBondContact O-N 3.29Å; I35-A39 HydrophobicContact CG2-CB 3.84Å; I35-Y40 HydrophobicContact CB-CE2 4.44Å; I35-Y40 HydrophobicContact CG2-CE2 4.08Å
36	P	51.3	Low	48.3	Very low	86 Å²	86	130.4 Å²	130.4	56%	0.558	69%	0.691	S	S	*	*			trans	-59.1	132.5	176.2	21.8	-29.2	0	0	0	109.1	V34 D38 A39	V34-P36 WeakPolarHBondContact O-CD 3.27Å; P36-D38 PolarHBondContact O-N 3.32Å; P36-A39 HydrophobicContact CG-CB 4.4Å; P36-A39 VanDerWaalsContact O-CB 3.24Å; P36-A39 WeakPolarHBondContact O-CB 3.34Å; P36-A39 PolarHBondContact O-N 3.42Å
37	T	52.5	Low	48.7	Very low	112 Å²	112	133.4 Å²	133.4	69%	0.687	70%	0.702	S	S	*	*	G	3₁₀ helix	trans	-62.1	-19.2	-171.2	-25	0	0	0	0	112.8	I35 A39 Y40	I35-T37 PolarHBondContact O-N 3.29Å; T37-A39 VanDerWaalsContact C-N 3.28Å; T37-A39 PolarHBondContact O-N 3.46Å; T37-Y40 PolarHBondContact O-N 3.21Å
38	D	48.9	Very low	48.6	Very low	143 Å²	143	135.4 Å²	135.4	77%	0.765	71%	0.714	S	S	*	*	G	3₁₀ helix	trans	-71.8	-15.1	170.9	-79.7	-36.4	0	0	0	114.2	P36 Y40	P36-D38 PolarHBondContact O-N 3.32Å; D38-Y40 VanDerWaalsContact C-N 3.3Å
39	A	49.1	Very low	48.5	Very low	54 Å²	54	135.7 Å²	135.7	45%	0.446	71%	0.706	S	S	.	*	G	3₁₀ helix	trans	-79.2	-11.5	175.6	0	0	0	0	0	113.3	I35 P36 T37 F41	I35-A39 HydrophobicContact CG2-CB 3.84Å; P36-A39 HydrophobicContact CG-CB 4.4Å; P36-A39 VanDerWaalsContact O-CB 3.24Å; P36-A39 WeakPolarHBondContact O-CB 3.34Å; P36-A39 PolarHBondContact O-N 3.42Å; T37-A39 VanDerWaalsContact C-N 3.28Å; T37-A39 PolarHBondContact O-N 3.46Å; A39-F41 VanDerWaalsContact C-N 3.29Å
40	Y	45.9	Very low	48.3	Very low	155 Å²	155	135.9 Å²	135.9	61%	0.608	71%	0.706	S	S	*	*	G	3₁₀ helix	trans	-76.2	-17.3	174.7	-82.4	-89.8	0	0	0	112.9	I35 T37 D38 R42	I35-Y40 HydrophobicContact CB-CE2 4.44Å; I35-Y40 HydrophobicContact CG2-CE2 4.08Å; T37-Y40 PolarHBondContact O-N 3.21Å; D38-Y40 VanDerWaalsContact C-N 3.3Å; Y40-R42 VanDerWaalsContact C-N 3.32Å; Y40-R42 PolarHBondContact O-N 3.12Å
41	F	42.6	Very low	48.1	Very low	169 Å²	169	139 Å²	139	74%	0.741	72%	0.717	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.5	53.3	-177.3	-68.6	-85	0	0	0	112.5	A39	A39-F41 VanDerWaalsContact C-N 3.29Å
42	R	41.7	Very low	47.7	Very low	221 Å²	221	131.1 Å²	131.1	83%	0.834	71%	0.709	S	S	*	*	T	Hydrogen-bonded Turn	trans	-157.4	11.9	161.3	-119.6	173.7	176.3	-159.6	-2.4	115.5	Y40	Y40-R42 VanDerWaalsContact C-N 3.32Å; Y40-R42 PolarHBondContact O-N 3.12Å
43	V	47	Very low	47.5	Very low	92 Å²	92	136.7 Å²	136.7	56%	0.558	72%	0.717	S	S	*	*	S	Bend	trans	-104.8	-20.7	-175.4	-178.2	0	0	0	0	113	L47	V43-L47 HydrophobicContact CG1-CD1 4.35Å; V43-L47 VanDerWaalsContact O-CD1 3.27Å; V43-L47 WeakPolarHBondContact O-CD1 3.18Å
44	E	45.7	Very low	47.3	Very low	183 Å²	183	137.3 Å²	137.3	86%	0.855	72%	0.722	S	S	*	*	S	Bend	trans	-92	-8.9	-179.6	-70.3	-153.4	128.1	0	0	115.9
45	Q	47.2	Very low	47.2	Very low	196 Å²	196	137 Å²	137	92%	0.916	72%	0.72	S	S	*	*	S	Bend	trans	-96.1	-4.4	179.1	-72	-173.2	6.1	0	0	114.6
46	S	46.7	Very low	47.1	Very low	71 Å²	71	139.4 Å²	139.4	50%	0.497	73%	0.734	S	S	.	*	S	Bend	trans	-115.6	-3.8	-172.4	-35.4	0	0	0	0	113.8	C48 V49	S46-C48 PolarHBondContact O-N 2.79Å; S46-V49 PolarHBondContact O-N 3.42Å
47	L	46.3	Very low	47.4	Very low	147 Å²	147	141.2 Å²	141.2	77%	0.77	74%	0.739	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.3	20.3	-171.6	-92	159.9	0	0	0	115	V43	V43-L47 HydrophobicContact CG1-CD1 4.35Å; V43-L47 VanDerWaalsContact O-CD1 3.27Å; V43-L47 WeakPolarHBondContact O-CD1 3.18Å
48	C	39.5	Very low	47.7	Very low	128 Å²	128	141.2 Å²	141.2	87%	0.865	74%	0.738	S	S	*	*	T	Hydrogen-bonded Turn	trans	-124.8	34.1	168.6	-157.6	0	0	0	0	111.6	S46	S46-C48 PolarHBondContact O-N 2.79Å
49	V	43.5	Very low	48.2	Very low	109 Å²	109	143.2 Å²	143.2	66%	0.661	74%	0.736	S	S	*	*	S	Bend	trans	-129.4	104.5	-178.9	-172.8	0	0	0	0	110.1	S46	S46-V49 PolarHBondContact O-N 3.42Å
50	H	46.1	Very low	48.6	Very low	170 Å²	170	149.6 Å²	149.6	79%	0.787	75%	0.749	S	S	*	*			trans	46	108.6	152.5	-71.4	-70.9	0	0	0	119.7	G52	H50-G52 PolarHBondContact O-N 2.88Å
51	Q	44.9	Very low	49.3	Very low	193 Å²	193	151.7 Å²	151.7	90%	0.902	76%	0.756	S	S	*	*			trans	6.1	109.7	140.1	-72.5	179	-11.8	0	0	116.3
52	G	40.8	Very low	49.7	Very low	72 Å²	72	150.1 Å²	150.1	74%	0.742	76%	0.763	S	S	*	*			trans	68.9	96.5	136.2	0	0	0	0	0	117.4	H50	H50-G52 PolarHBondContact O-N 2.88Å
53	R	46.2	Very low	50.9	Low	232 Å²	232	143.3 Å²	143.3	88%	0.875	76%	0.762	S	S	*	*				-159.3	145.3	110.3	-71.7	-139	-168.2	-158.2	6.4	109.4	V55	R53-V55 PolarHBondContact O-N 3.26Å
54	P	53.8	Low	51.8	Low	119 Å²	119	145 Å²	145	77%	0.773	77%	0.767	S	S	*	*	P	Polyproline II helix	trans	-64.5	130.2	177.2	27.7	-33	0	0	0	109.4
55	V	55.6	Low	52	Low	132 Å²	132	144.4 Å²	144.4	80%	0.8	77%	0.765	S	S	*	*	P	Polyproline II helix	trans	-87.3	116.4	169.9	-177	0	0	0	0	105.8	R53 D57	R53-V55 PolarHBondContact O-N 3.26Å; V55-D57 PolarHBondContact O-N 2.92Å
56	D	54.6	Low	52.5	Low	144 Å²	144	139.9 Å²	139.9	77%	0.77	75%	0.746	S	S	*	*	P	Polyproline II helix	trans	-61.5	123.1	171.4	-79.8	-69.2	0	0	0	109.4	V58	D56-V58 PolarHBondContact O-N 3.43Å
57	D	57.4	Low	52.4	Low	124 Å²	124	145.4 Å²	145.4	66%	0.663	76%	0.761	S	S	*	*			trans	-68.9	99.3	178.1	-71.6	-41.8	0	0	0	110.3	V55 Y59	V55-D57 PolarHBondContact O-N 2.92Å; D57-Y59 HydrophobicContact CB-CD2 4.23Å; D57-Y59 HydrophobicContact CB-CE2 3.45Å; D57-Y59 VanDerWaalsContact CB-CE2 3.45Å; D57-Y59 WeakPolarHBondContact O-CD2 3.49Å; D57-Y59 PolarHBondContact O-N 3.22Å
58	V	57.6	Low	52.8	Low	112 Å²	112	145.4 Å²	145.4	68%	0.679	76%	0.76	S	S	*	*			trans	-86.6	104.9	171.8	-178.8	0	0	0	0	109.3	D56	D56-V58 PolarHBondContact O-N 3.43Å
59	Y	59.9	Low	52.6	Low	185 Å²	185	146.1 Å²	146.1	73%	0.725	79%	0.79	S	S	*	*	P	Polyproline II helix	trans	-86.5	129.2	173.1	-61.3	-85.6	0	0	0	110.7	D57	D57-Y59 HydrophobicContact CB-CD2 4.23Å; D57-Y59 HydrophobicContact CB-CE2 3.45Å; D57-Y59 VanDerWaalsContact CB-CE2 3.45Å; D57-Y59 WeakPolarHBondContact O-CD2 3.49Å; D57-Y59 PolarHBondContact O-N 3.22Å
60	W	57.5	Low	53.1	Low	187 Å²	187	148 Å²	148	71%	0.708	80%	0.796	S	S	*	*	P	Polyproline II helix	trans	-99.1	124.6	173.5	-79	58.2	0	0	0	110	L66	W60-L66 HydrophobicContact CH2-CD2 3.94Å; W60-L66 HydrophobicContact CZ2-CG 4.39Å; W60-L66 HydrophobicContact CZ2-CD2 4.05Å; W60-L66 HydrophobicContact CZ2-CD1 3.53Å; W60-L66 HydrophobicContact CH2-CG 4.35Å; W60-L66 HydrophobicContact CH2-CD1 3.85Å
61	W	59.8	Low	53.5	Low	200 Å²	200	146.8 Å²	146.8	76%	0.758	80%	0.797	S	S	*	*	P	Polyproline II helix	trans	-101.8	135.5	169.9	-96.5	45.8	0	0	0	110.4	G63 D64	W61-G63 PolarHBondContact O-N 2.58Å; W61-D64 PolarHBondContact O-N 3.31Å
62	P	52.4	Low	53.9	Low	135 Å²	135	144.3 Å²	144.3	88%	0.877	79%	0.791	S	S	*	*	T	Hydrogen-bonded Turn	trans	-70.6	97.3	174.6	28.1	-31	0	0	0	109.4
63	G	66	Low	54.7	Low	79 Å²	79	148.5 Å²	148.5	81%	0.814	79%	0.794	S	S	*	*	T	Hydrogen-bonded Turn	trans	148.3	-17.7	-177.4	0	0	0	0	0	114.3	W61	W61-G63 PolarHBondContact O-N 2.58Å
64	D	66.5	Low	55.2	Low	127 Å²	127	143.3 Å²	143.3	68%	0.679	79%	0.789	S	S	*	*			trans	-99.1	126.4	-180	-79.3	-51	0	0	0	112.4	W61 L66	W61-D64 PolarHBondContact O-N 3.31Å; D64-L66 PolarHBondContact O-N 2.85Å
65	Q	49.3	Very low	55.3	Low	171 Å²	171	144.9 Å²	144.9	80%	0.799	79%	0.79	S	S	*	*			trans	-77.2	113.9	177.1	-162	179.3	42.2	0	0	109.2	K67	Q65-K67 PolarHBondContact O-N 3.3Å
66	L	57.8	Low	55.3	Low	100 Å²	100	145.9 Å²	145.9	52%	0.524	79%	0.789	S	S	.	*			trans	-55.6	108.6	176.5	-162.1	84	0	0	0	110.6	W60 D64 I68	W60-L66 HydrophobicContact CH2-CD2 3.94Å; W60-L66 HydrophobicContact CZ2-CG 4.39Å; W60-L66 HydrophobicContact CZ2-CD2 4.05Å; W60-L66 HydrophobicContact CZ2-CD1 3.53Å; W60-L66 HydrophobicContact CH2-CG 4.35Å; W60-L66 HydrophobicContact CH2-CD1 3.85Å; D64-L66 PolarHBondContact O-N 2.85Å; L66-I68 HydrophobicContact CD2-CD1 3.82Å; L66-I68 HydrophobicContact CD2-CG1 4.01Å; L66-I68 HydrophobicContact CG-CG1 4.21Å
67	K	44.7	Very low	55.4	Low	188 Å²	188	146 Å²	146	82%	0.817	79%	0.791	S	S	*	*			trans	-101.2	108.9	166.8	-74.7	-176	-179.7	175.5	0	108.8	Q65	Q65-K67 PolarHBondContact O-N 3.3Å
68	I	54.3	Low	55.2	Low	146 Å²	146	147.8 Å²	147.8	75%	0.749	80%	0.801	S	S	*	*			trans	-93.8	119.9	168.1	-57.4	173.5	0	0	0	106.5	L66	L66-I68 HydrophobicContact CD2-CD1 3.82Å; L66-I68 HydrophobicContact CD2-CG1 4.01Å; L66-I68 HydrophobicContact CG-CG1 4.21Å
69	G	36.6	Very low	55	Low	144 Å²	144	151.1 Å²	151.1	100%	1.485	81%	0.812	S	S	*	*			trans	-88.6	0	160.4	0	0	0	0	0	110.5

Retrieved 69 of 69 residues in 58.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).