A0A077Z7N9_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077Z7N9, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 76 aa.

						>A0A077Z7N9_TRITR|A0A077Z7N9
MSQLTNKTSTLLSSSSYHLMEKTILLRVDAERETNGLRIAADETQYRSSQSPTSSGGRISVKEDAAGLEKAVVKLE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	56.6	Low	79.6	Confident	217 Å²	217	110.5 Å²	110.5	100%	1.069	60%	0.598	S	S	*	*				0	14.4	0	-86.6	-151	-95.1	0	0	115.3	T5	M1-T5 PolarHBondContact O-OG1 3.14Å; M1-T5 VanDerWaalsContact O-OG1 3.11Å
2	S	82.6	Confident	79.7	Confident	85 Å²	85	110.4 Å²	110.4	59%	0.594	60%	0.595	S	S	*	*	H	α-helix	trans	-86.4	-30.6	-172.2	-174.6	0	0	0	0	116.2	T5 N6	S2-T5 PolarHBondContact O-OG1 3.13Å; S2-N6 VanDerWaalsContact O-CG 3.25Å; S2-N6 PolarHBondContact O-ND2 3.04Å; S2-N6 VanDerWaalsContact O-ND2 3.14Å
3	Q	83.8	Confident	80	Confident	149 Å²	149	106.2 Å²	106.2	70%	0.696	58%	0.579	S	S	*	*	H	α-helix	trans	-86.7	-36.7	-173.5	-67.6	-174.9	-1.1	0	0	114.9	K7	Q3-K7 WeakPolarHBondContact O-CG 3.36Å; Q3-K7 PolarHBondContact O-N 3.25Å; Q3-K7 VanDerWaalsContact O-N 3.13Å
4	L	86.9	Confident	80.3	Confident	132 Å²	132	101.6 Å²	101.6	69%	0.691	56%	0.559	S	S	*	*	H	α-helix	trans	-68.1	-44.1	-178	-178.1	62.6	0	0	0	110.9	N6 K7 T8	L4-N6 VanDerWaalsContact C-N 3.34Å; L4-N6 PolarHBondContact O-N 3.11Å; L4-K7 PolarHBondContact O-N 3.3Å; L4-T8 PolarHBondContact O-N 3.44Å; L4-T8 PolarHBondContact O-OG1 3.46Å
5	T	85.3	Confident	80.9	Confident	77 Å²	77	99 Å²	99	47%	0.472	55%	0.551	S	S	.	*	H	α-helix	trans	-60.2	-43.2	178.1	50	0	0	0	0	111.8	M1 S2 T8 S9	M1-T5 PolarHBondContact O-OG1 3.14Å; M1-T5 VanDerWaalsContact O-OG1 3.11Å; S2-T5 PolarHBondContact O-OG1 3.13Å; T5-T8 PolarHBondContact O-N 3.47Å; T5-S9 PolarHBondContact O-N 3.01Å; T5-S9 PolarHBondContact O-OG 2.97Å
6	N	77.7	Confident	81.5	Confident	92 Å²	92	97.4 Å²	97.4	49%	0.492	55%	0.549	S	S	.	.	H	α-helix	trans	-64.6	-44	177.5	-71.7	-11.5	0	0	0	112.1	S2 L4 T8 S9 T10	S2-N6 VanDerWaalsContact O-CG 3.25Å; S2-N6 PolarHBondContact O-ND2 3.04Å; S2-N6 VanDerWaalsContact O-ND2 3.14Å; L4-N6 VanDerWaalsContact C-N 3.34Å; L4-N6 PolarHBondContact O-N 3.11Å; N6-T8 VanDerWaalsContact C-N 3.34Å; N6-T8 PolarHBondContact O-N 3.4Å; N6-S9 PolarHBondContact O-N 2.99Å; N6-S9 PolarHBondContact O-OG 3.4Å; N6-T10 PolarHBondContact O-N 2.94Å; N6-T10 PolarHBondContact O-OG1 3.38Å
7	K	81.5	Confident	82.1	Confident	135 Å²	135	101.1 Å²	101.1	59%	0.587	55%	0.553	S	S	*	*	H	α-helix	trans	-62.1	-43.6	176.9	-71.4	177	-177.5	-177.1	0	111.2	Q3 L4 T10 L11	Q3-K7 WeakPolarHBondContact O-CG 3.36Å; Q3-K7 PolarHBondContact O-N 3.25Å; Q3-K7 VanDerWaalsContact O-N 3.13Å; L4-K7 PolarHBondContact O-N 3.3Å; K7-T10 PolarHBondContact O-N 2.93Å; K7-L11 WeakPolarHBondContact O-CG 3.21Å; K7-L11 PolarHBondContact O-N 3.3Å
8	T	81.9	Confident	82.7	Confident	66 Å²	66	102.4 Å²	102.4	41%	0.405	56%	0.555	S	S	.	*	H	α-helix	trans	-64.2	-43.4	177.8	-55.6	0	0	0	0	111.9	L4 T5 N6 L11 L12	L4-T8 PolarHBondContact O-N 3.44Å; L4-T8 PolarHBondContact O-OG1 3.46Å; T5-T8 PolarHBondContact O-N 3.47Å; N6-T8 VanDerWaalsContact C-N 3.34Å; N6-T8 PolarHBondContact O-N 3.4Å; T8-L11 PolarHBondContact O-N 3.03Å; T8-L12 HydrophobicContact CG2-CD1 3.99Å; T8-L12 HydrophobicContact CG2-CG 4.38Å; T8-L12 WeakPolarHBondContact O-CB 3.28Å; T8-L12 VanDerWaalsContact O-CG 3.28Å; T8-L12 WeakPolarHBondContact O-CG 3.48Å; T8-L12 PolarHBondContact O-N 2.72Å
9	S	78.9	Confident	83.3	Confident	63 Å²	63	103.2 Å²	103.2	44%	0.441	56%	0.558	S	S	.	*	H	α-helix	trans	-66.1	-38.3	178.5	65.1	0	0	0	0	112.6	T5 N6 L12 S13	T5-S9 PolarHBondContact O-N 3.01Å; T5-S9 PolarHBondContact O-OG 2.97Å; N6-S9 PolarHBondContact O-N 2.99Å; N6-S9 PolarHBondContact O-OG 3.4Å; S9-L12 PolarHBondContact O-N 2.95Å; S9-S13 WeakPolarHBondContact O-CB 3.33Å; S9-S13 PolarHBondContact O-N 3.45Å; S9-S13 PolarHBondContact O-OG 3.15Å
10	T	79.8	Confident	83.9	Confident	88 Å²	88	102.9 Å²	102.9	54%	0.54	55%	0.554	S	S	.	*	H	α-helix	trans	-63.6	-40.3	172.9	-56.3	0	0	0	0	112.5	N6 K7 S13 S14	N6-T10 PolarHBondContact O-N 2.94Å; N6-T10 PolarHBondContact O-OG1 3.38Å; K7-T10 PolarHBondContact O-N 2.93Å; T10-S13 PolarHBondContact O-OG 3.01Å; T10-S14 WeakPolarHBondContact O-CB 3.33Å; T10-S14 PolarHBondContact O-N 3.32Å; T10-S14 PolarHBondContact O-OG 3.04Å
11	L	80.1	Confident	84.5	Confident	112 Å²	112	103.5 Å²	103.5	59%	0.586	55%	0.553	S	S	*	*	H	α-helix	trans	-68.7	-36.8	176.6	-71.4	173.3	0	0	0	112.4	K7 T8 S14 S15	K7-L11 WeakPolarHBondContact O-CG 3.21Å; K7-L11 PolarHBondContact O-N 3.3Å; T8-L11 PolarHBondContact O-N 3.03Å; L11-S14 PolarHBondContact O-OG 2.96Å; L11-S14 VanDerWaalsContact O-OG 3.09Å; L11-S15 WeakPolarHBondContact O-CB 3.48Å; L11-S15 PolarHBondContact O-N 3.34Å; L11-S15 PolarHBondContact O-OG 3.37Å
12	L	80.7	Confident	86.3	Confident	109 Å²	109	99.9 Å²	99.9	57%	0.571	53%	0.532	S	S	*	.	H	α-helix	trans	-70	-42.7	176.8	-72.3	172.3	0	0	0	111.5	T8 S9 S16	T8-L12 HydrophobicContact CG2-CD1 3.99Å; T8-L12 HydrophobicContact CG2-CG 4.38Å; T8-L12 WeakPolarHBondContact O-CB 3.28Å; T8-L12 VanDerWaalsContact O-CG 3.28Å; T8-L12 WeakPolarHBondContact O-CG 3.48Å; T8-L12 PolarHBondContact O-N 2.72Å; S9-L12 PolarHBondContact O-N 2.95Å; L12-S16 WeakPolarHBondContact O-CB 3.49Å; L12-S16 PolarHBondContact O-N 2.72Å; L12-S16 PolarHBondContact O-OG 3.22Å
13	S	83.9	Confident	86.9	Confident	55 Å²	55	99.2 Å²	99.2	39%	0.385	52%	0.524	S	S	.	.	H	α-helix	trans	-65.7	-47.1	176.8	66	0	0	0	0	110.8	S9 T10 S15 S16 Y17	S9-S13 WeakPolarHBondContact O-CB 3.33Å; S9-S13 PolarHBondContact O-N 3.45Å; S9-S13 PolarHBondContact O-OG 3.15Å; T10-S13 PolarHBondContact O-OG 3.01Å; S13-S15 PolarHBondContact O-N 3.19Å; S13-S16 WeakPolarHBondContact O-CB 3.38Å; S13-S16 PolarHBondContact O-N 2.99Å; S13-Y17 WeakPolarHBondContact O-CD2 3.3Å; S13-Y17 PolarHBondContact O-N 3.09Å
14	S	84.8	Confident	87.6	Confident	42 Å²	42	95.6 Å²	95.6	29%	0.294	51%	0.509	S	S	.	.	H	α-helix	trans	-60.5	-46.1	177.2	70.8	0	0	0	0	111.3	T10 L11 S16 Y17 H18	T10-S14 WeakPolarHBondContact O-CB 3.33Å; T10-S14 PolarHBondContact O-N 3.32Å; T10-S14 PolarHBondContact O-OG 3.04Å; L11-S14 PolarHBondContact O-OG 2.96Å; L11-S14 VanDerWaalsContact O-OG 3.09Å; S14-S16 VanDerWaalsContact C-N 3.29Å; S14-S16 PolarHBondContact O-N 2.91Å; S14-Y17 PolarHBondContact O-N 2.72Å; S14-H18 PolarHBondContact O-N 2.98Å; S14-H18 PolarHBondContact O-ND1 3.2Å
15	S	88.6	Confident	88.1	Confident	63 Å²	63	94 Å²	94	44%	0.441	50%	0.5	S	S	.	.	H	α-helix	trans	-59.9	-39.4	177.1	-61.5	0	0	0	0	112.1	L11 S13 H18 L19	L11-S15 WeakPolarHBondContact O-CB 3.48Å; L11-S15 PolarHBondContact O-N 3.34Å; L11-S15 PolarHBondContact O-OG 3.37Å; S13-S15 PolarHBondContact O-N 3.19Å; S15-H18 PolarHBondContact O-N 2.97Å; S15-L19 WeakPolarHBondContact O-CB 3.32Å; S15-L19 VanDerWaalsContact O-CG 3.3Å; S15-L19 WeakPolarHBondContact O-CG 3.37Å; S15-L19 PolarHBondContact O-N 2.97Å
16	S	90.5	Very high	88.7	Confident	74 Å²	74	95.4 Å²	95.4	52%	0.517	50%	0.504	S	S	.	.	H	α-helix	trans	-64.7	-41.7	177.1	-57.6	0	0	0	0	111.9	L12 S13 S14 L19 M20	L12-S16 WeakPolarHBondContact O-CB 3.49Å; L12-S16 PolarHBondContact O-N 2.72Å; L12-S16 PolarHBondContact O-OG 3.22Å; S13-S16 WeakPolarHBondContact O-CB 3.38Å; S13-S16 PolarHBondContact O-N 2.99Å; S14-S16 VanDerWaalsContact C-N 3.29Å; S14-S16 PolarHBondContact O-N 2.91Å; S16-L19 PolarHBondContact O-N 2.69Å; S16-M20 WeakPolarHBondContact O-CB 3.18Å; S16-M20 PolarHBondContact O-N 2.96Å
17	Y	92.2	Very high	89.6	Confident	159 Å²	159	97.5 Å²	97.5	62%	0.624	51%	0.505	S	S	*	.	H	α-helix	trans	-64	-43.4	174.4	-82.2	-70.8	0	0	0	112.4	S13 S14 L19 M20 E21	S13-Y17 WeakPolarHBondContact O-CD2 3.3Å; S13-Y17 PolarHBondContact O-N 3.09Å; S14-Y17 PolarHBondContact O-N 2.72Å; Y17-L19 VanDerWaalsContact C-N 3.35Å; Y17-L19 PolarHBondContact O-N 2.83Å; Y17-M20 HydrophobicContact CD1-CE 3.8Å; Y17-M20 HydrophobicContact CE1-CE 4.07Å; Y17-M20 PolarHBondContact O-N 3.47Å; Y17-E21 WeakPolarHBondContact O-CB 3.45Å; Y17-E21 PolarHBondContact O-N 2.96Å
18	H	92.6	Very high	90.4	Very high	126 Å²	126	94.6 Å²	94.6	58%	0.583	50%	0.499	S	S	*	.	H	α-helix	trans	-64.6	-40.1	178.3	-72.9	70.8	0	0	0	111.7	S14 S15 K22	S14-H18 PolarHBondContact O-N 2.98Å; S14-H18 PolarHBondContact O-ND1 3.2Å; S15-H18 PolarHBondContact O-N 2.97Å; H18-K22 VanDerWaalsContact O-CB 3.32Å; H18-K22 WeakPolarHBondContact O-CB 3.31Å; H18-K22 PolarHBondContact O-N 3.32Å
19	L	93.9	Very high	91.2	Very high	117 Å²	117	95.9 Å²	95.9	61%	0.613	50%	0.503	S	S	*	.	H	α-helix	trans	-63.5	-43	174.6	-73.5	171.3	0	0	0	111.3	S15 S16 Y17 T23	S15-L19 WeakPolarHBondContact O-CB 3.32Å; S15-L19 VanDerWaalsContact O-CG 3.3Å; S15-L19 WeakPolarHBondContact O-CG 3.37Å; S15-L19 PolarHBondContact O-N 2.97Å; S16-L19 PolarHBondContact O-N 2.69Å; Y17-L19 VanDerWaalsContact C-N 3.35Å; Y17-L19 PolarHBondContact O-N 2.83Å; L19-T23 WeakPolarHBondContact O-CB 3.33Å; L19-T23 PolarHBondContact O-N 3.18Å; L19-T23 PolarHBondContact O-OG1 3.24Å
20	M	95.5	Very high	92.1	Very high	96 Å²	96	95.1 Å²	95.1	47%	0.473	50%	0.501	S	S	.	.	H	α-helix	trans	-64.1	-47.5	177.2	-175.3	178.8	75.7	0	0	111.7	S16 Y17 T23 I24	S16-M20 WeakPolarHBondContact O-CB 3.18Å; S16-M20 PolarHBondContact O-N 2.96Å; Y17-M20 HydrophobicContact CD1-CE 3.8Å; Y17-M20 HydrophobicContact CE1-CE 4.07Å; Y17-M20 PolarHBondContact O-N 3.47Å; M20-T23 WeakPolarHBondContact O-CB 3.48Å; M20-T23 PolarHBondContact O-N 2.9Å; M20-I24 HydrophobicContact CG-CD1 4.02Å; M20-I24 VanDerWaalsContact O-CG1 3.3Å; M20-I24 WeakPolarHBondContact O-CG1 3.39Å; M20-I24 PolarHBondContact O-N 3.46Å
21	E	95.8	Very high	92.9	Very high	117 Å²	117	96.8 Å²	96.8	55%	0.547	50%	0.502	S	S	.	.	H	α-helix	trans	-59.1	-49.3	177.9	-178.2	175.9	-155.4	0	0	111.2	Y17 T23 I24 L25	Y17-E21 WeakPolarHBondContact O-CB 3.45Å; Y17-E21 PolarHBondContact O-N 2.96Å; E21-T23 VanDerWaalsContact C-N 3.27Å; E21-T23 PolarHBondContact O-N 3.39Å; E21-I24 WeakPolarHBondContact O-CB 3.49Å; E21-I24 PolarHBondContact O-N 2.97Å; E21-L25 HydrophobicContact CG-CD1 4.39Å; E21-L25 WeakPolarHBondContact O-CG 3.3Å; E21-L25 PolarHBondContact O-N 3.47Å
22	K	95	Very high	93.7	Very high	141 Å²	141	100.8 Å²	100.8	61%	0.613	51%	0.51	S	S	*	.	H	α-helix	trans	-60.5	-38.5	176.6	-170.8	173.3	-177.7	178.7	0	112.1	H18 I24 L25 L26	H18-K22 VanDerWaalsContact O-CB 3.32Å; H18-K22 WeakPolarHBondContact O-CB 3.31Å; H18-K22 PolarHBondContact O-N 3.32Å; K22-I24 VanDerWaalsContact C-N 3.33Å; K22-L25 PolarHBondContact O-N 2.94Å; K22-L26 HydrophobicContact CG-CD1 4.36Å; K22-L26 VanDerWaalsContact O-CG 3.31Å; K22-L26 WeakPolarHBondContact O-CG 3.4Å; K22-L26 PolarHBondContact O-N 3.08Å
23	T	96.5	Very high	94.5	Very high	71 Å²	71	102 Å²	102	44%	0.436	51%	0.512	S	S	.	.	H	α-helix	trans	-68.1	-32.8	176.2	-56.5	0	0	0	0	112.1	L19 M20 E21 R27	L19-T23 WeakPolarHBondContact O-CB 3.33Å; L19-T23 PolarHBondContact O-N 3.18Å; L19-T23 PolarHBondContact O-OG1 3.24Å; M20-T23 WeakPolarHBondContact O-CB 3.48Å; M20-T23 PolarHBondContact O-N 2.9Å; E21-T23 VanDerWaalsContact C-N 3.27Å; E21-T23 PolarHBondContact O-N 3.39Å; T23-R27 WeakPolarHBondContact O-CG 3.45Å; T23-R27 PolarHBondContact O-N 2.89Å; T23-R27 PolarHBondContact O-NE 3.29Å; T23-R27 VanDerWaalsContact O-NE 3.1Å
24	I	97.8	Very high	95.1	Very high	73 Å²	73	103.8 Å²	103.8	37%	0.374	52%	0.521	S	S	.	.	H	α-helix	trans	-69.2	-48.7	174.2	-68.6	163.1	0	0	0	110.2	M20 E21 K22 L26 R27 V28	M20-I24 HydrophobicContact CG-CD1 4.02Å; M20-I24 VanDerWaalsContact O-CG1 3.3Å; M20-I24 WeakPolarHBondContact O-CG1 3.39Å; M20-I24 PolarHBondContact O-N 3.46Å; E21-I24 WeakPolarHBondContact O-CB 3.49Å; E21-I24 PolarHBondContact O-N 2.97Å; K22-I24 VanDerWaalsContact C-N 3.33Å; I24-L26 VanDerWaalsContact C-N 3.34Å; I24-L26 PolarHBondContact O-N 3.1Å; I24-R27 WeakPolarHBondContact O-CB 3.36Å; I24-R27 PolarHBondContact O-N 3.21Å; I24-V28 HydrophobicContact CG2-CG2 4.34Å; I24-V28 WeakPolarHBondContact O-CG2 3.48Å; I24-V28 PolarHBondContact O-N 3.07Å
25	L	96.2	Very high	95.7	Very high	99 Å²	99	105.6 Å²	105.6	52%	0.518	53%	0.528	S	S	.	.	H	α-helix	trans	-57.6	-46.2	179.5	-69	173.4	0	0	0	111.9	E21 K22 R27 V28 D29	E21-L25 HydrophobicContact CG-CD1 4.39Å; E21-L25 WeakPolarHBondContact O-CG 3.3Å; E21-L25 PolarHBondContact O-N 3.47Å; K22-L25 PolarHBondContact O-N 2.94Å; L25-R27 VanDerWaalsContact C-N 3.27Å; L25-R27 PolarHBondContact O-N 3.07Å; L25-V28 PolarHBondContact O-N 3.06Å; L25-D29 PolarHBondContact O-N 3.32Å
26	L	97.8	Very high	96	Very high	106 Å²	106	104.5 Å²	104.5	56%	0.555	53%	0.526	S	S	*	.	H	α-helix	trans	-60.2	-35.2	176.3	-72.5	171	0	0	0	113.1	K22 I24 A30	K22-L26 HydrophobicContact CG-CD1 4.36Å; K22-L26 VanDerWaalsContact O-CG 3.31Å; K22-L26 WeakPolarHBondContact O-CG 3.4Å; K22-L26 PolarHBondContact O-N 3.08Å; I24-L26 VanDerWaalsContact C-N 3.34Å; I24-L26 PolarHBondContact O-N 3.1Å; L26-A30 WeakPolarHBondContact O-CB 3.39Å; L26-A30 PolarHBondContact O-N 2.96Å; L26-A30 VanDerWaalsContact O-N 3.08Å
27	R	98.1	Very high	96.1	Very high	135 Å²	135	106.3 Å²	106.3	51%	0.509	53%	0.529	S	S	.	.	H	α-helix	trans	-70.1	-44.8	176.2	-78.3	-178.4	-76.7	170.9	-5.1	111.7	T23 I24 L25 D29 A30 E31	T23-R27 WeakPolarHBondContact O-CG 3.45Å; T23-R27 PolarHBondContact O-N 2.89Å; T23-R27 PolarHBondContact O-NE 3.29Å; T23-R27 VanDerWaalsContact O-NE 3.1Å; I24-R27 WeakPolarHBondContact O-CB 3.36Å; I24-R27 PolarHBondContact O-N 3.21Å; L25-R27 VanDerWaalsContact C-N 3.27Å; L25-R27 PolarHBondContact O-N 3.07Å; R27-D29 VanDerWaalsContact C-N 3.31Å; R27-D29 PolarHBondContact O-N 2.93Å; R27-A30 PolarHBondContact O-N 2.9Å; R27-E31 WeakPolarHBondContact O-CB 3.46Å; R27-E31 WeakPolarHBondContact O-CG 3.45Å; R27-E31 PolarHBondContact O-N 2.95Å
28	V	97.9	Very high	96.2	Very high	75 Å²	75	105.1 Å²	105.1	46%	0.455	52%	0.524	S	S	.	.	H	α-helix	trans	-60.5	-42.9	176.5	172.9	0	0	0	0	110.8	I24 L25 E31 R32	I24-V28 HydrophobicContact CG2-CG2 4.34Å; I24-V28 WeakPolarHBondContact O-CG2 3.48Å; I24-V28 PolarHBondContact O-N 3.07Å; L25-V28 PolarHBondContact O-N 3.06Å; V28-E31 PolarHBondContact O-N 3.42Å; V28-R32 WeakPolarHBondContact O-CB 3.34Å; V28-R32 PolarHBondContact O-N 3.3Å
29	D	97.9	Very high	96.2	Very high	93 Å²	93	103 Å²	103	50%	0.497	52%	0.516	S	S	.	.	H	α-helix	trans	-63.3	-44.5	177.5	-71.9	-23.3	0	0	0	111.7	L25 R27 R32 E33	L25-D29 PolarHBondContact O-N 3.32Å; R27-D29 VanDerWaalsContact C-N 3.31Å; R27-D29 PolarHBondContact O-N 2.93Å; D29-R32 PolarHBondContact O-N 3.45Å; D29-E33 WeakPolarHBondContact O-CB 3.29Å; D29-E33 PolarHBondContact O-N 2.94Å
30	A	97.8	Very high	96.1	Very high	47 Å²	47	99.8 Å²	99.8	39%	0.388	51%	0.506	S	S	.	.	H	α-helix	trans	-65.4	-39.1	177.5	0	0	0	0	0	112.9	L26 R27 R32 T34	L26-A30 WeakPolarHBondContact O-CB 3.39Å; L26-A30 PolarHBondContact O-N 2.96Å; L26-A30 VanDerWaalsContact O-N 3.08Å; R27-A30 PolarHBondContact O-N 2.9Å; A30-R32 VanDerWaalsContact C-N 3.35Å; A30-T34 WeakPolarHBondContact O-CB 3.34Å; A30-T34 PolarHBondContact O-N 3.43Å; A30-T34 PolarHBondContact O-OG1 3.28Å
31	E	97.7	Very high	95.9	Very high	122 Å²	122	97.9 Å²	97.9	57%	0.57	51%	0.506	S	S	*	.	H	α-helix	trans	-64.2	-41.7	174.4	-75.5	173.4	-166.5	0	0	111.1	R27 V28 N35	R27-E31 WeakPolarHBondContact O-CB 3.46Å; R27-E31 WeakPolarHBondContact O-CG 3.45Å; R27-E31 PolarHBondContact O-N 2.95Å; V28-E31 PolarHBondContact O-N 3.42Å; E31-N35 VanDerWaalsContact O-CB 3.29Å; E31-N35 WeakPolarHBondContact O-CB 3.48Å; E31-N35 VanDerWaalsContact O-CG 3.27Å; E31-N35 PolarHBondContact O-N 2.92Å; E31-N35 PolarHBondContact O-ND2 2.79Å
32	R	97.4	Very high	95.8	Very high	196 Å²	196	96.1 Å²	96.1	74%	0.74	50%	0.5	S	S	*	.	H	α-helix	trans	-65	-45.7	177.2	-169.3	179.5	-165.2	-173.8	4.1	111.6	V28 D29 A30 N35 G36	V28-R32 WeakPolarHBondContact O-CB 3.34Å; V28-R32 PolarHBondContact O-N 3.3Å; D29-R32 PolarHBondContact O-N 3.45Å; A30-R32 VanDerWaalsContact C-N 3.35Å; R32-N35 PolarHBondContact O-N 2.95Å; R32-G36 PolarHBondContact O-N 3.46Å
33	E	97.4	Very high	95.6	Very high	134 Å²	134	94.8 Å²	94.8	63%	0.626	50%	0.496	S	S	*	.	H	α-helix	trans	-60.2	-49.4	176.7	-175.7	176.6	-168.5	0	0	111	D29 N35 G36 L37	D29-E33 WeakPolarHBondContact O-CB 3.29Å; D29-E33 PolarHBondContact O-N 2.94Å; E33-N35 PolarHBondContact O-N 2.92Å; E33-G36 PolarHBondContact O-N 3.06Å; E33-L37 HydrophobicContact CG-CD1 4.3Å; E33-L37 WeakPolarHBondContact O-CG 3.48Å; E33-L37 PolarHBondContact O-N 3.43Å
34	T	96.1	Very high	95.1	Very high	93 Å²	93	96 Å²	96	57%	0.571	50%	0.503	S	S	*	.	H	α-helix	trans	-60	-44.4	178.6	-57.4	0	0	0	0	111.8	A30 L37 R38	A30-T34 WeakPolarHBondContact O-CB 3.34Å; A30-T34 PolarHBondContact O-N 3.43Å; A30-T34 PolarHBondContact O-OG1 3.28Å; T34-L37 PolarHBondContact O-N 2.95Å; T34-R38 PolarHBondContact O-N 2.98Å
35	N	96.5	Very high	94.4	Very high	81 Å²	81	98.6 Å²	98.6	43%	0.433	51%	0.514	S	S	.	.	H	α-helix	trans	-65	-39.3	177	-78.4	-43.6	0	0	0	112.4	E31 R32 E33 R38 I39	E31-N35 VanDerWaalsContact O-CB 3.29Å; E31-N35 WeakPolarHBondContact O-CB 3.48Å; E31-N35 VanDerWaalsContact O-CG 3.27Å; E31-N35 PolarHBondContact O-N 2.92Å; E31-N35 PolarHBondContact O-ND2 2.79Å; R32-N35 PolarHBondContact O-N 2.95Å; E33-N35 PolarHBondContact O-N 2.92Å; N35-R38 PolarHBondContact O-N 3.36Å; N35-I39 WeakPolarHBondContact O-CG1 3.37Å; N35-I39 PolarHBondContact O-N 3.33Å; N35-I39 VanDerWaalsContact O-N 3.1Å
36	G	94.9	Very high	93.7	Very high	39 Å²	39	100.9 Å²	100.9	40%	0.402	52%	0.517	S	S	.	.	H	α-helix	trans	-63.2	-44.6	175.6	0	0	0	0	0	112.5	R32 E33 R38 I39 A40	R32-G36 PolarHBondContact O-N 3.46Å; E33-G36 PolarHBondContact O-N 3.06Å; G36-R38 VanDerWaalsContact C-N 3.32Å; G36-R38 PolarHBondContact O-N 3.18Å; G36-I39 PolarHBondContact O-N 2.91Å; G36-A40 PolarHBondContact O-N 3.4Å
37	L	92.6	Very high	92.9	Very high	112 Å²	112	104.9 Å²	104.9	59%	0.586	53%	0.525	S	S	*	.	H	α-helix	trans	-61.9	-40.1	175.1	-69.6	174.3	0	0	0	111.9	E33 T34 A40 A41	E33-L37 HydrophobicContact CG-CD1 4.3Å; E33-L37 WeakPolarHBondContact O-CG 3.48Å; E33-L37 PolarHBondContact O-N 3.43Å; T34-L37 PolarHBondContact O-N 2.95Å; L37-A40 PolarHBondContact O-N 3.28Å; L37-A41 WeakPolarHBondContact O-CB 3.46Å; L37-A41 PolarHBondContact O-N 3.49Å
38	R	94.2	Very high	91.9	Very high	134 Å²	134	102.6 Å²	102.6	51%	0.506	53%	0.529	S	S	.	.	H	α-helix	trans	-60.6	-46.6	176.3	-172.1	-179.3	62.3	73.7	-2.5	111.8	T34 N35 G36 A40 A41 D42	T34-R38 PolarHBondContact O-N 2.98Å; N35-R38 PolarHBondContact O-N 3.36Å; G36-R38 VanDerWaalsContact C-N 3.32Å; G36-R38 PolarHBondContact O-N 3.18Å; R38-A40 PolarHBondContact O-N 3.36Å; R38-A41 PolarHBondContact O-N 2.99Å; R38-D42 IonicContact NH1-OD2 3.18Å; R38-D42 PolarHBondContact NH1-OD2 2.94Å; R38-D42 VanDerWaalsContact O-CG 3.31Å; R38-D42 PolarHBondContact O-N 3.1Å
39	I	92.2	Very high	90.7	Very high	82 Å²	82	102.8 Å²	102.8	42%	0.421	53%	0.534	S	S	.	.	H	α-helix	trans	-61.5	-44.9	177.6	-66	164.4	0	0	0	110.8	N35 G36 A41 D42 E43	N35-I39 WeakPolarHBondContact O-CG1 3.37Å; N35-I39 PolarHBondContact O-N 3.33Å; N35-I39 VanDerWaalsContact O-N 3.1Å; G36-I39 PolarHBondContact O-N 2.91Å; I39-A41 VanDerWaalsContact C-N 3.29Å; I39-A41 PolarHBondContact O-N 2.77Å; I39-D42 PolarHBondContact O-N 3.39Å; I39-E43 HydrophobicContact CG2-CG 4.35Å; I39-E43 WeakPolarHBondContact O-CB 3.37Å; I39-E43 WeakPolarHBondContact O-CG 3.41Å; I39-E43 PolarHBondContact O-N 3.5Å
40	A	91.8	Very high	89.1	Confident	49 Å²	49	103.2 Å²	103.2	41%	0.405	53%	0.533	S	S	.	.	H	α-helix	trans	-62.3	-36.8	178.6	0	0	0	0	0	112.7	G36 L37 R38 T44	G36-A40 PolarHBondContact O-N 3.4Å; L37-A40 PolarHBondContact O-N 3.28Å; R38-A40 PolarHBondContact O-N 3.36Å; A40-T44 WeakPolarHBondContact O-CB 3.43Å; A40-T44 PolarHBondContact O-N 3.03Å; A40-T44 PolarHBondContact O-OG1 2.77Å
41	A	92.7	Very high	87.1	Confident	57 Å²	57	104.5 Å²	104.5	47%	0.471	54%	0.539	S	S	.	.	H	α-helix	trans	-67.5	-47.3	174.7	0	0	0	0	0	111.6	L37 R38 I39 E43 T44 Q45	L37-A41 WeakPolarHBondContact O-CB 3.46Å; L37-A41 PolarHBondContact O-N 3.49Å; R38-A41 PolarHBondContact O-N 2.99Å; I39-A41 VanDerWaalsContact C-N 3.29Å; I39-A41 PolarHBondContact O-N 2.77Å; A41-E43 VanDerWaalsContact C-N 3.32Å; A41-E43 PolarHBondContact O-N 2.85Å; A41-T44 PolarHBondContact O-N 3.42Å; A41-Q45 WeakPolarHBondContact O-CB 3.37Å; A41-Q45 PolarHBondContact O-N 3.18Å
42	D	92.6	Very high	85.3	Confident	79 Å²	79	104.3 Å²	104.3	42%	0.422	55%	0.548	S	S	.	.	H	α-helix	trans	-59.9	-42.1	177.2	-69.4	-22.1	0	0	0	111	R38 I39 Q45 Y46	R38-D42 IonicContact NH1-OD2 3.18Å; R38-D42 PolarHBondContact NH1-OD2 2.94Å; R38-D42 VanDerWaalsContact O-CG 3.31Å; R38-D42 PolarHBondContact O-N 3.1Å; I39-D42 PolarHBondContact O-N 3.39Å; D42-Q45 PolarHBondContact O-N 2.81Å; D42-Y46 VanDerWaalsContact O-CB 3.32Å; D42-Y46 WeakPolarHBondContact O-CB 3.46Å; D42-Y46 PolarHBondContact O-N 3.4Å
43	E	90.8	Very high	83.2	Confident	113 Å²	113	100.5 Å²	100.5	53%	0.528	55%	0.547	S	S	.	.	H	α-helix	trans	-64.6	-41.4	175.8	-75.8	-179.1	-171.6	0	0	112.6	I39 A41 Y46 R47	I39-E43 HydrophobicContact CG2-CG 4.35Å; I39-E43 WeakPolarHBondContact O-CB 3.37Å; I39-E43 WeakPolarHBondContact O-CG 3.41Å; I39-E43 PolarHBondContact O-N 3.5Å; A41-E43 VanDerWaalsContact C-N 3.32Å; A41-E43 PolarHBondContact O-N 2.85Å; E43-Y46 PolarHBondContact O-N 3.21Å; E43-R47 WeakPolarHBondContact O-CB 3.36Å; E43-R47 WeakPolarHBondContact O-CG 3.48Å; E43-R47 PolarHBondContact O-N 3.37Å
44	T	86.5	Confident	80.8	Confident	97 Å²	97	99.3 Å²	99.3	60%	0.595	55%	0.553	S	S	*	*	H	α-helix	trans	-64.4	-44.2	176	-58.9	0	0	0	0	110.6	A40 A41 R47 S48	A40-T44 WeakPolarHBondContact O-CB 3.43Å; A40-T44 PolarHBondContact O-N 3.03Å; A40-T44 PolarHBondContact O-OG1 2.77Å; A41-T44 PolarHBondContact O-N 3.42Å; T44-R47 PolarHBondContact O-N 2.88Å; T44-S48 PolarHBondContact O-N 3.27Å; T44-S48 PolarHBondContact O-OG 3.37Å
45	Q	83.8	Confident	78.6	Confident	128 Å²	128	99.7 Å²	99.7	60%	0.598	56%	0.56	S	S	*	*	H	α-helix	trans	-64.8	-45.6	177.4	-176.2	175	-11.6	0	0	111.1	A41 D42 R47 S48 S49	A41-Q45 WeakPolarHBondContact O-CB 3.37Å; A41-Q45 PolarHBondContact O-N 3.18Å; D42-Q45 PolarHBondContact O-N 2.81Å; Q45-R47 VanDerWaalsContact C-N 3.34Å; Q45-R47 PolarHBondContact O-N 3.09Å; Q45-S48 WeakPolarHBondContact CA-OG 3.36Å; Q45-S48 PolarHBondContact O-N 2.98Å; Q45-S48 VanDerWaalsContact O-N 3.09Å; Q45-S48 PolarHBondContact O-OG 2.84Å; Q45-S49 WeakPolarHBondContact O-CB 3.43Å; Q45-S49 PolarHBondContact O-N 2.85Å; Q45-S49 PolarHBondContact O-OG 3.38Å
46	Y	80.4	Confident	76.5	Confident	146 Å²	146	99 Å²	99	57%	0.573	57%	0.572	S	S	*	*	H	α-helix	trans	-56.1	-48.7	175.7	-177.6	-105.2	0	0	0	110.9	D42 E43 S48 S49 Q50	D42-Y46 VanDerWaalsContact O-CB 3.32Å; D42-Y46 WeakPolarHBondContact O-CB 3.46Å; D42-Y46 PolarHBondContact O-N 3.4Å; E43-Y46 PolarHBondContact O-N 3.21Å; Y46-S48 VanDerWaalsContact C-N 3.32Å; Y46-S48 PolarHBondContact O-N 3.42Å; Y46-S49 WeakPolarHBondContact CA-OG 3.45Å; Y46-S49 PolarHBondContact O-N 3.26Å; Y46-S49 PolarHBondContact O-OG 2.89Å; Y46-Q50 HydrophobicContact CE1-CG 4.26Å; Y46-Q50 WeakPolarHBondContact O-CG 3.32Å; Y46-Q50 PolarHBondContact O-N 3.18Å; Y46-Q50 PolarHBondContact OH-NE2 2.62Å
47	R	80.9	Confident	74.4	Confident	191 Å²	191	99.7 Å²	99.7	72%	0.721	58%	0.579	S	S	*	*	H	α-helix	trans	-60.6	-36.2	174.8	-73.7	-177	179.8	-146.1	2.3	113.6	E43 T44 Q45	E43-R47 WeakPolarHBondContact O-CB 3.36Å; E43-R47 WeakPolarHBondContact O-CG 3.48Å; E43-R47 PolarHBondContact O-N 3.37Å; T44-R47 PolarHBondContact O-N 2.88Å; Q45-R47 VanDerWaalsContact C-N 3.34Å; Q45-R47 PolarHBondContact O-N 3.09Å
48	S	78.1	Confident	73.2	Confident	87 Å²	87	106 Å²	106	61%	0.608	60%	0.595	S	S	*	*	H	α-helix	trans	-74.8	-35	177	72.6	0	0	0	0	113.2	T44 Q45 Y46 S51	T44-S48 PolarHBondContact O-N 3.27Å; T44-S48 PolarHBondContact O-OG 3.37Å; Q45-S48 WeakPolarHBondContact CA-OG 3.36Å; Q45-S48 PolarHBondContact O-N 2.98Å; Q45-S48 VanDerWaalsContact O-N 3.09Å; Q45-S48 PolarHBondContact O-OG 2.84Å; Y46-S48 VanDerWaalsContact C-N 3.32Å; Y46-S48 PolarHBondContact O-N 3.42Å; S48-S51 PolarHBondContact O-N 3.49Å
49	S	72	Confident	71.4	Confident	78 Å²	78	105.9 Å²	105.9	55%	0.545	60%	0.603	S	S	.	*	H	α-helix	trans	-77.4	-23.8	177.6	70.2	0	0	0	0	112.5	Q45 Y46 S51	Q45-S49 WeakPolarHBondContact O-CB 3.43Å; Q45-S49 PolarHBondContact O-N 2.85Å; Q45-S49 PolarHBondContact O-OG 3.38Å; Y46-S49 WeakPolarHBondContact CA-OG 3.45Å; Y46-S49 PolarHBondContact O-N 3.26Å; Y46-S49 PolarHBondContact O-OG 2.89Å; S49-S51 PolarHBondContact O-N 2.79Å
50	Q	64.1	Low	69.9	Low	103 Å²	103	104.3 Å²	104.3	48%	0.481	60%	0.599	S	S	.	*			trans	-68.2	68.1	151.1	-65.6	-167.7	-9.8	0	0	108.5	Y46 P52	Y46-Q50 HydrophobicContact CE1-CG 4.26Å; Y46-Q50 WeakPolarHBondContact O-CG 3.32Å; Y46-Q50 PolarHBondContact O-N 3.18Å; Y46-Q50 PolarHBondContact OH-NE2 2.62Å; Q50-P52 VanDerWaalsContact O-N 3.17Å
51	S	57.4	Low	68.4	Low	73 Å²	73	108.3 Å²	108.3	51%	0.51	62%	0.618	S	S	.	*			trans	-45.5	127.1	137.6	64.4	0	0	0	0	104.1	S48 S49 T53	S48-S51 PolarHBondContact O-N 3.49Å; S49-S51 PolarHBondContact O-N 2.79Å; S51-T53 VanDerWaalsContact C-N 3.29Å; S51-T53 PolarHBondContact O-N 2.7Å
52	P	58.4	Low	66.9	Low	118 Å²	118	114.8 Å²	114.8	77%	0.766	64%	0.636	S	S	*	*			trans	-49.9	112.3	170.2	20.7	-29.6	0	0	0	103.7	Q50 S54	Q50-P52 VanDerWaalsContact O-N 3.17Å; P52-S54 PolarHBondContact O-N 2.96Å
53	T	54.5	Low	65.5	Low	116 Å²	116	118.3 Å²	118.3	71%	0.712	65%	0.65	S	S	*	*			trans	-63.5	95.6	-179.7	36.2	0	0	0	0	103.1	S51 S55	S51-T53 VanDerWaalsContact C-N 3.29Å; S51-T53 PolarHBondContact O-N 2.7Å; T53-S55 PolarHBondContact O-N 2.78Å
54	S	45.4	Very low	64	Low	109 Å²	109	117.3 Å²	117.3	76%	0.762	65%	0.648	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.9	66.1	174	154.7	0	0	0	0	105.7	P52	P52-S54 PolarHBondContact O-N 2.96Å
55	S	51.5	Low	63	Low	102 Å²	102	116 Å²	116	71%	0.713	65%	0.647	S	S	*	*	T	Hydrogen-bonded Turn	trans	-126.3	-3	163.8	65.5	0	0	0	0	111.4	T53 G57	T53-S55 PolarHBondContact O-N 2.78Å; S55-G57 PolarHBondContact O-N 2.68Å
56	G	51	Low	62.3	Low	67 Å²	67	113.2 Å²	113.2	69%	0.691	65%	0.646	S	S	*	*	S	Bend	trans	-62.1	90.7	143.8	0	0	0	0	0	105.8
57	G	50.9	Low	61.5	Low	53 Å²	53	108.3 Å²	108.3	55%	0.546	64%	0.64	S	S	.	*			trans	-45.4	147.7	-172.9	0	0	0	0	0	110.2	S55 I59	S55-G57 PolarHBondContact O-N 2.68Å; G57-I59 VanDerWaalsContact C-N 3.28Å; G57-I59 PolarHBondContact O-N 2.86Å
58	R	67.6	Low	60.7	Low	245 Å²	245	104.8 Å²	104.8	93%	0.925	64%	0.635	S	S	*	*			trans	-44.2	101.1	168.5	-75.8	172.4	141.5	-167.4	-4.5	107.4	S60	R58-S60 PolarHBondContact O-N 2.81Å
59	I	57.7	Low	60.2	Low	131 Å²	131	107.5 Å²	107.5	67%	0.672	64%	0.638	S	S	*	*			trans	-66.1	99.5	157.8	-46.7	173.3	0	0	0	100.3	G57 V61	G57-I59 VanDerWaalsContact C-N 3.28Å; G57-I59 PolarHBondContact O-N 2.86Å; I59-V61 VanDerWaalsContact C-N 3.3Å; I59-V61 PolarHBondContact O-N 2.94Å
60	S	59.1	Low	59.9	Low	48 Å²	48	112 Å²	112	34%	0.336	65%	0.647	S	S	.	*			trans	-57.6	105	177.9	179.5	0	0	0	0	104.7	R58 K62 E63	R58-S60 PolarHBondContact O-N 2.81Å; S60-K62 PolarHBondContact O-N 2.82Å; S60-E63 PolarHBondContact O-N 2.82Å
61	V	61.9	Low	59.9	Low	133 Å²	133	110 Å²	110	81%	0.806	65%	0.649	S	S	*	*	T	Hydrogen-bonded Turn	trans	-56.8	-6.7	174.1	-179.6	0	0	0	0	110.9	I59	I59-V61 VanDerWaalsContact C-N 3.3Å; I59-V61 PolarHBondContact O-N 2.94Å
62	K	60.9	Low	60.3	Low	193 Å²	193	110.7 Å²	110.7	84%	0.839	65%	0.65	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.9	-13.7	173.6	-58.5	-169	173.7	-172.4	0	114.9	S60	S60-K62 PolarHBondContact O-N 2.82Å
63	E	62.2	Low	60.8	Low	153 Å²	153	110.6 Å²	110.6	72%	0.715	65%	0.646	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100.2	-26	-178.5	-77.3	178.2	163.3	0	0	114.4	S60 A65	S60-E63 PolarHBondContact O-N 2.82Å; E63-A65 PolarHBondContact O-N 3.36Å
64	D	60.9	Low	61.6	Low	93 Å²	93	114 Å²	114	50%	0.497	65%	0.651	S	S	.	*	H	α-helix	trans	-75.7	-19	-172.7	-79.8	-25.7	0	0	0	115.1	A66 G67 L68	D64-A66 VanDerWaalsContact C-N 3.31Å; D64-A66 PolarHBondContact O-N 3.32Å; D64-G67 PolarHBondContact O-N 2.93Å; D64-L68 WeakPolarHBondContact O-CB 3.37Å; D64-L68 PolarHBondContact O-N 3.2Å
65	A	64.7	Low	62.4	Low	70 Å²	70	116.1 Å²	116.1	58%	0.579	65%	0.654	S	S	*	*	H	α-helix	trans	-61.5	-38.7	-178.9	0	0	0	0	0	112.5	E63	E63-A65 PolarHBondContact O-N 3.36Å
66	A	68.2	Low	62.3	Low	69 Å²	69	122.7 Å²	122.7	57%	0.57	67%	0.673	S	S	*	*	H	α-helix	trans	-78.8	-26.2	178.4	0	0	0	0	0	113.2	D64	D64-A66 VanDerWaalsContact C-N 3.31Å; D64-A66 PolarHBondContact O-N 3.32Å
67	G	63.2	Low	62.9	Low	43 Å²	43	125.5 Å²	125.5	44%	0.443	67%	0.672	S	S	.	*	H	α-helix	trans	-75.3	-36.9	176.1	0	0	0	0	0	112.4	D64 K70 A71	D64-G67 PolarHBondContact O-N 2.93Å; G67-K70 PolarHBondContact O-N 3.21Å; G67-A71 PolarHBondContact O-N 3.34Å
68	L	65.6	Low	63.5	Low	117 Å²	117	129.3 Å²	129.3	61%	0.613	68%	0.679	S	S	*	*	H	α-helix	trans	-68.6	-38.6	-178.2	-147.4	123.2	0	0	0	111.6	D64 K70 A71 V72	D64-L68 WeakPolarHBondContact O-CB 3.37Å; D64-L68 PolarHBondContact O-N 3.2Å; L68-K70 VanDerWaalsContact C-N 3.33Å; L68-K70 PolarHBondContact O-N 3.05Å; L68-A71 PolarHBondContact O-N 3.43Å; L68-V72 HydrophobicContact CD2-CG2 4.36Å; L68-V72 WeakPolarHBondContact O-CG2 3.33Å; L68-V72 PolarHBondContact O-N 3.4Å
69	E	66.3	Low	63.3	Low	144 Å²	144	122.8 Å²	122.8	67%	0.673	67%	0.665	S	S	*	*	H	α-helix	trans	-60.8	-39.5	174.8	-74.3	-178.9	176.1	0	0	112.4	V73	E69-V73 WeakPolarHBondContact O-CG2 3.35Å; E69-V73 PolarHBondContact O-N 3.31Å
70	K	65.6	Low	63.6	Low	172 Å²	172	122.4 Å²	122.4	75%	0.748	67%	0.665	S	S	*	*	H	α-helix	trans	-69.8	-32	176.6	-75	-172.9	179.2	179	0	113.4	G67 L68	G67-K70 PolarHBondContact O-N 3.21Å; L68-K70 VanDerWaalsContact C-N 3.33Å; L68-K70 PolarHBondContact O-N 3.05Å
71	A	64.4	Low	63.9	Low	62 Å²	62	127 Å²	127	51%	0.512	69%	0.685	S	S	.	*	H	α-helix	trans	-73.3	-36.1	178.4	0	0	0	0	0	111.9	G67 L68 K74	G67-A71 PolarHBondContact O-N 3.34Å; L68-A71 PolarHBondContact O-N 3.43Å; A71-K74 PolarHBondContact O-N 3.21Å
72	V	66.8	Low	64.1	Low	87 Å²	87	126.6 Å²	126.6	53%	0.527	68%	0.677	S	S	.	*	H	α-helix	trans	-69.5	-37.7	179.4	174.5	0	0	0	0	111.7	L68 K74 L75	L68-V72 HydrophobicContact CD2-CG2 4.36Å; L68-V72 WeakPolarHBondContact O-CG2 3.33Å; L68-V72 PolarHBondContact O-N 3.4Å; V72-K74 PolarHBondContact O-N 3.09Å; V72-K74 VanDerWaalsContact O-N 3.11Å; V72-L75 PolarHBondContact O-N 3.11Å; V72-L75 VanDerWaalsContact O-N 3.09Å
73	V	68.5	Low	64.3	Low	115 Å²	115	121.9 Å²	121.9	70%	0.697	67%	0.665	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.9	-18.2	178.8	174.1	0	0	0	0	113.3	E69	E69-V73 WeakPolarHBondContact O-CG2 3.35Å; E69-V73 PolarHBondContact O-N 3.31Å
74	K	70.7	Confident	64.5	Low	187 Å²	187	119.5 Å²	119.5	81%	0.813	66%	0.662	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.8	-6	178.4	-161.3	176.4	175.2	-175.5	0	113.6	A71 V72	A71-K74 PolarHBondContact O-N 3.21Å; V72-K74 PolarHBondContact O-N 3.09Å; V72-K74 VanDerWaalsContact O-N 3.11Å
75	L	63.7	Low	64.8	Low	155 Å²	155	121.7 Å²	121.7	81%	0.812	68%	0.675	S	S	*	*			trans	-96.5	-7.9	-175.9	-111.3	156.1	0	0	0	113.8	V72	V72-L75 PolarHBondContact O-N 3.11Å; V72-L75 VanDerWaalsContact O-N 3.09Å
76	E	49.4	Very low	64.8	Low	239 Å²	239	126.4 Å²	126.4	100%	1.117	68%	0.684	S	S	*	*			trans	-93.3	0	164.3	-67.3	-174.9	164	0	0	110.8

Retrieved 76 of 76 residues in 93.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).