A0A077Z884_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077Z884, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 67 aa.

						>A0A077Z884_TRITR|A0A077Z884
MLNPPKLTEPKQGPSKAAKQAKAAMQAQLMARVNGYREKCYPMPKDGCRCEENGKVKRYKRDIECKK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	51.9	Low	63.9	Low	243 Å²	243	159.8 Å²	159.8	100%	1.197	84%	0.841	S	S	*	*				0	85	0	-62.9	178.5	178.6	0	0	108.4
2	L	65.6	Low	64.6	Low	175 Å²	175	162.5 Å²	162.5	92%	0.916	85%	0.846	S	S	*	*			trans	-109.9	109.4	171.9	-84.5	141.1	0	0	0	106.2
3	N	67.7	Low	65.4	Low	154 Å²	154	154.4 Å²	154.4	82%	0.824	83%	0.826	S	S	*	*	P	Polyproline II helix	trans	-66	130.4	171.6	-86.1	-67.3	0	0	0	108.4
4	P	70.9	Confident	66.6	Low	106 Å²	106	149.3 Å²	149.3	69%	0.688	81%	0.805	S	S	*	*	P	Polyproline II helix	trans	-66.2	141.7	174.6	26.6	-31.6	0	0	0	109.8	K6	P4-K6 PolarHBondContact O-N 3.22Å
5	P	73.6	Confident	68	Low	119 Å²	119	144.2 Å²	144.2	77%	0.773	79%	0.786	S	S	*	*	P	Polyproline II helix	trans	-60.7	124.3	172.7	25.4	-32.1	0	0	0	108.8	L7	P5-L7 PolarHBondContact O-N 3.11Å; P5-L7 VanDerWaalsContact O-N 3.11Å
6	K	63.9	Low	69.3	Low	195 Å²	195	145.4 Å²	145.4	85%	0.848	78%	0.781	S	S	*	*			trans	-62.3	115.2	169.1	-72.6	-172.9	173.8	169.6	0	107.5	P4 T8	P4-K6 PolarHBondContact O-N 3.22Å; K6-T8 VanDerWaalsContact C-N 3.3Å; K6-T8 PolarHBondContact O-N 3.25Å
7	L	60	Low	70.6	Confident	180 Å²	180	140.6 Å²	140.6	94%	0.942	77%	0.766	S	S	*	*			trans	-59.3	97	167.3	-72.3	164	0	0	0	107.2	P5 E9	P5-L7 PolarHBondContact O-N 3.11Å; P5-L7 VanDerWaalsContact O-N 3.11Å; L7-E9 PolarHBondContact O-N 2.87Å
8	T	60.1	Low	71.7	Confident	111 Å²	111	135.2 Å²	135.2	68%	0.681	74%	0.743	S	S	*	*			trans	-72.3	110.6	177.8	36.4	0	0	0	0	109.3	K6	K6-T8 VanDerWaalsContact C-N 3.3Å; K6-T8 PolarHBondContact O-N 3.25Å
9	E	61.9	Low	72.8	Confident	169 Å²	169	134.7 Å²	134.7	79%	0.79	73%	0.733	S	S	*	*			trans	45	139.9	163.6	-63.8	-172.9	93.4	0	0	118.7	L7 K11	L7-E9 PolarHBondContact O-N 2.87Å; E9-K11 PolarHBondContact O-N 2.81Å
10	P	63.2	Low	73.8	Confident	121 Å²	121	134.1 Å²	134.1	79%	0.786	73%	0.725	S	S	*	*			trans	-60.3	104.2	167.3	26.5	-31	0	0	0	107.6	Q12	P10-Q12 VanDerWaalsContact C-N 3.33Å; P10-Q12 PolarHBondContact O-N 2.99Å
11	K	64.3	Low	74.7	Confident	185 Å²	185	130.4 Å²	130.4	80%	0.804	71%	0.712	S	S	*	*			trans	-57.8	102.1	170.2	-73	-170.6	174.4	67.1	0	106.4	E9 G13	E9-K11 PolarHBondContact O-N 2.81Å; K11-G13 PolarHBondContact O-N 2.81Å
12	Q	71.7	Confident	76.7	Confident	192 Å²	192	125.3 Å²	125.3	90%	0.897	68%	0.684	S	S	*	*	P	Polyproline II helix	trans	-52.4	117.2	172.5	-78	178	35.7	0	0	106.8	P10	P10-Q12 VanDerWaalsContact C-N 3.33Å; P10-Q12 PolarHBondContact O-N 2.99Å
13	G	75.3	Confident	78	Confident	57 Å²	57	119.5 Å²	119.5	59%	0.588	66%	0.661	S	S	*	*	P	Polyproline II helix	trans	-60.1	164.6	-179.9	0	0	0	0	0	110.8	K11 S15	K11-G13 PolarHBondContact O-N 2.81Å; G13-S15 PolarHBondContact O-N 3.38Å
14	P	81.7	Confident	79.3	Confident	83 Å²	83	115.1 Å²	115.1	54%	0.539	65%	0.646	S	S	.	*	P	Polyproline II helix	trans	-57.7	138.6	180	23.7	-32.8	0	0	0	110.8	A18 K19	P14-A18 HydrophobicContact CB-CB 3.84Å; P14-K19 HydrophobicContact CB-CG 4.21Å; P14-K19 HydrophobicContact CG-CG 3.97Å; P14-K19 VanDerWaalsContact O-CE 3.31Å; P14-K19 WeakPolarHBondContact O-CE 3.47Å
15	S	88.1	Confident	80.3	Confident	73 Å²	73	116 Å²	116	51%	0.51	64%	0.643	S	S	.	*	P	Polyproline II helix	trans	-57.3	160.3	172.8	66.1	0	0	0	0	111.2	G13 A17 A18 K19	G13-S15 PolarHBondContact O-N 3.38Å; S15-A17 PolarHBondContact O-N 3.15Å; S15-A18 PolarHBondContact O-N 2.95Å; S15-A18 WeakPolarHBondContact OG-CB 3.31Å; S15-A18 PolarHBondContact OG-N 3.43Å; S15-K19 PolarHBondContact O-N 3.04Å
16	K	89.1	Confident	81.1	Confident	163 Å²	163	115.1 Å²	115.1	71%	0.709	63%	0.628	S	S	*	*	H	α-helix	trans	-54.4	-40.9	175.7	-171.7	179	180	-176.3	0	111.5	K19 Q20	K16-K19 PolarHBondContact O-N 3.19Å; K16-Q20 WeakPolarHBondContact O-CG 3.49Å; K16-Q20 PolarHBondContact O-N 2.98Å
17	A	90.8	Very high	82.5	Confident	65 Å²	65	108.7 Å²	108.7	54%	0.537	61%	0.611	S	S	.	*	H	α-helix	trans	-61.1	-45	174.8	0	0	0	0	0	112.4	S15 K19 Q20 A21	S15-A17 PolarHBondContact O-N 3.15Å; A17-K19 VanDerWaalsContact C-N 3.33Å; A17-K19 PolarHBondContact O-N 3.25Å; A17-Q20 PolarHBondContact O-N 3.24Å; A17-A21 WeakPolarHBondContact O-CB 3.49Å; A17-A21 PolarHBondContact O-N 2.97Å
18	A	91.7	Very high	83.9	Confident	42 Å²	42	105.3 Å²	105.3	35%	0.347	59%	0.591	S	S	.	*	H	α-helix	trans	-63.7	-37.8	176.5	0	0	0	0	0	112.3	P14 S15 K22	P14-A18 HydrophobicContact CB-CB 3.84Å; S15-A18 PolarHBondContact O-N 2.95Å; S15-A18 WeakPolarHBondContact OG-CB 3.31Å; S15-A18 PolarHBondContact OG-N 3.43Å; A18-K22 WeakPolarHBondContact O-CB 3.46Å; A18-K22 PolarHBondContact O-N 3.29Å
19	K	91.4	Very high	85.2	Confident	127 Å²	127	104.5 Å²	104.5	55%	0.552	58%	0.582	S	S	*	*	H	α-helix	trans	-63.4	-43.4	174	-67.3	177.7	-177.8	178	0	111.7	P14 S15 K16 A17 K22 A23	P14-K19 HydrophobicContact CB-CG 4.21Å; P14-K19 HydrophobicContact CG-CG 3.97Å; P14-K19 VanDerWaalsContact O-CE 3.31Å; P14-K19 WeakPolarHBondContact O-CE 3.47Å; S15-K19 PolarHBondContact O-N 3.04Å; K16-K19 PolarHBondContact O-N 3.19Å; A17-K19 VanDerWaalsContact C-N 3.33Å; A17-K19 PolarHBondContact O-N 3.25Å; K19-K22 PolarHBondContact O-N 2.94Å; K19-A23 WeakPolarHBondContact O-CB 3.25Å; K19-A23 PolarHBondContact O-N 3.41Å
20	Q	93.3	Very high	86.5	Confident	122 Å²	122	102.7 Å²	102.7	57%	0.57	58%	0.575	S	S	*	*	H	α-helix	trans	-64.9	-44.5	177.1	-73	173.2	-45	0	0	112	K16 A17 K22 A23 A24	K16-Q20 WeakPolarHBondContact O-CG 3.49Å; K16-Q20 PolarHBondContact O-N 2.98Å; A17-Q20 PolarHBondContact O-N 3.24Å; Q20-K22 VanDerWaalsContact C-N 3.33Å; Q20-K22 PolarHBondContact O-N 3.29Å; Q20-A23 WeakPolarHBondContact O-CB 3.21Å; Q20-A23 PolarHBondContact O-N 2.86Å; Q20-A23 VanDerWaalsContact O-N 3.15Å; Q20-A24 PolarHBondContact O-N 3.22Å
21	A	93.6	Very high	87.7	Confident	56 Å²	56	100.2 Å²	100.2	46%	0.463	57%	0.565	S	S	.	*	H	α-helix	trans	-60.1	-43.4	175.4	0	0	0	0	0	111.6	A17 A23 A24 M25	A17-A21 WeakPolarHBondContact O-CB 3.49Å; A17-A21 PolarHBondContact O-N 2.97Å; A21-A23 VanDerWaalsContact C-N 3.34Å; A21-A23 PolarHBondContact O-N 3.4Å; A21-A24 PolarHBondContact O-N 3.42Å; A21-M25 WeakPolarHBondContact O-CB 3.39Å; A21-M25 VanDerWaalsContact O-CG 3.25Å; A21-M25 WeakPolarHBondContact O-CG 3.38Å; A21-M25 PolarHBondContact O-N 2.91Å
22	K	92.7	Very high	88.7	Confident	137 Å²	137	96.5 Å²	96.5	60%	0.596	55%	0.546	S	S	*	.	H	α-helix	trans	-62.4	-39.6	174.6	-169.2	-169.1	169.4	178.9	0	112	A18 K19 Q20 Q26	A18-K22 WeakPolarHBondContact O-CB 3.46Å; A18-K22 PolarHBondContact O-N 3.29Å; K19-K22 PolarHBondContact O-N 2.94Å; Q20-K22 VanDerWaalsContact C-N 3.33Å; Q20-K22 PolarHBondContact O-N 3.29Å; K22-Q26 WeakPolarHBondContact O-CB 3.32Å; K22-Q26 WeakPolarHBondContact O-CG 3.49Å; K22-Q26 PolarHBondContact O-N 2.97Å; K22-Q26 PolarHBondContact O-NE2 2.93Å; K22-Q26 VanDerWaalsContact O-NE2 3.15Å
23	A	93.9	Very high	89.5	Confident	53 Å²	53	89.3 Å²	89.3	44%	0.438	52%	0.515	S	S	.	.	H	α-helix	trans	-65.4	-44.3	177.4	0	0	0	0	0	111.6	K19 Q20 A21 Q26 A27	K19-A23 WeakPolarHBondContact O-CB 3.25Å; K19-A23 PolarHBondContact O-N 3.41Å; Q20-A23 WeakPolarHBondContact O-CB 3.21Å; Q20-A23 PolarHBondContact O-N 2.86Å; Q20-A23 VanDerWaalsContact O-N 3.15Å; A21-A23 VanDerWaalsContact C-N 3.34Å; A21-A23 PolarHBondContact O-N 3.4Å; A23-Q26 PolarHBondContact O-N 3Å; A23-A27 WeakPolarHBondContact O-CB 3.43Å; A23-A27 PolarHBondContact O-N 3.45Å
24	A	94	Very high	90.1	Very high	61 Å²	61	92.5 Å²	92.5	50%	0.504	52%	0.518	S	S	.	.	H	α-helix	trans	-61.6	-44	175.9	0	0	0	0	0	112.2	Q20 A21 A27 Q28	Q20-A24 PolarHBondContact O-N 3.22Å; A21-A24 PolarHBondContact O-N 3.42Å; A24-A27 PolarHBondContact O-N 3.15Å; A24-Q28 PolarHBondContact O-N 3.32Å
25	M	91.3	Very high	90.5	Very high	126 Å²	126	90.4 Å²	90.4	62%	0.621	51%	0.512	S	S	*	.	H	α-helix	trans	-62.7	-42.9	176	-71.4	-72.7	151.7	0	0	112.2	A21 Q28 L29	A21-M25 WeakPolarHBondContact O-CB 3.39Å; A21-M25 VanDerWaalsContact O-CG 3.25Å; A21-M25 WeakPolarHBondContact O-CG 3.38Å; A21-M25 PolarHBondContact O-N 2.91Å; M25-Q28 PolarHBondContact O-N 3.32Å; M25-L29 WeakPolarHBondContact O-CB 3.49Å; M25-L29 PolarHBondContact O-N 2.9Å
26	Q	91.4	Very high	90.7	Very high	100 Å²	100	88 Å²	88	47%	0.467	49%	0.492	S	S	.	.	H	α-helix	trans	-63.1	-44.1	175.1	-78.3	173.9	94.8	0	0	111.6	K22 A23 Q28 L29 M30	K22-Q26 WeakPolarHBondContact O-CB 3.32Å; K22-Q26 WeakPolarHBondContact O-CG 3.49Å; K22-Q26 PolarHBondContact O-N 2.97Å; K22-Q26 PolarHBondContact O-NE2 2.93Å; K22-Q26 VanDerWaalsContact O-NE2 3.15Å; A23-Q26 PolarHBondContact O-N 3Å; Q26-Q28 VanDerWaalsContact C-N 3.33Å; Q26-Q28 PolarHBondContact O-N 2.97Å; Q26-L29 PolarHBondContact O-N 3.37Å; Q26-M30 WeakPolarHBondContact O-CB 3.42Å; Q26-M30 WeakPolarHBondContact O-CG 3.41Å; Q26-M30 PolarHBondContact O-N 2.94Å
27	A	93.4	Very high	90.8	Very high	60 Å²	60	83.5 Å²	83.5	50%	0.496	47%	0.47	S	S	.	.	H	α-helix	trans	-60.2	-42.8	177.3	0	0	0	0	0	111.9	A23 A24 M30 A31	A23-A27 WeakPolarHBondContact O-CB 3.43Å; A23-A27 PolarHBondContact O-N 3.45Å; A24-A27 PolarHBondContact O-N 3.15Å; A27-M30 PolarHBondContact O-N 3.27Å; A27-A31 WeakPolarHBondContact O-CB 3.25Å; A27-A31 PolarHBondContact O-N 3.43Å
28	Q	89.5	Confident	90.8	Very high	109 Å²	109	87.7 Å²	87.7	51%	0.509	48%	0.479	S	S	.	.	H	α-helix	trans	-63	-43.3	175.4	-174.8	-178.8	70	0	0	112	A24 M25 Q26 A31 R32	A24-Q28 PolarHBondContact O-N 3.32Å; M25-Q28 PolarHBondContact O-N 3.32Å; Q26-Q28 VanDerWaalsContact C-N 3.33Å; Q26-Q28 PolarHBondContact O-N 2.97Å; Q28-A31 PolarHBondContact O-N 3.23Å; Q28-R32 WeakPolarHBondContact O-CG 3.47Å; Q28-R32 PolarHBondContact O-N 2.8Å; Q28-R32 VanDerWaalsContact O-N 3.12Å
29	L	88.1	Confident	90.8	Very high	94 Å²	94	92 Å²	92	49%	0.492	49%	0.49	S	S	.	.	H	α-helix	trans	-62.6	-46	176.9	-179.4	61.6	0	0	0	111.3	M25 Q26 A31 R32 V33 P42	M25-L29 WeakPolarHBondContact O-CB 3.49Å; M25-L29 PolarHBondContact O-N 2.9Å; Q26-L29 PolarHBondContact O-N 3.37Å; L29-A31 VanDerWaalsContact C-N 3.33Å; L29-A31 PolarHBondContact O-N 3.48Å; L29-R32 PolarHBondContact O-N 3.08Å; L29-R32 VanDerWaalsContact O-N 3.15Å; L29-V33 WeakPolarHBondContact O-CG2 3.3Å; L29-V33 PolarHBondContact O-N 3.1Å; L29-P42 HydrophobicContact CD1-CG 3.77Å
30	M	87.8	Confident	90.9	Very high	130 Å²	130	86.3 Å²	86.3	64%	0.64	47%	0.466	S	S	*	.	H	α-helix	trans	-62.6	-39.1	178.8	-67.8	-61	-84	0	0	111.9	Q26 A27 R32 V33 N34	Q26-M30 WeakPolarHBondContact O-CB 3.42Å; Q26-M30 WeakPolarHBondContact O-CG 3.41Å; Q26-M30 PolarHBondContact O-N 2.94Å; A27-M30 PolarHBondContact O-N 3.27Å; M30-R32 VanDerWaalsContact C-N 3.34Å; M30-R32 PolarHBondContact O-N 2.78Å; M30-V33 VanDerWaalsContact O-CG2 3.25Å; M30-V33 WeakPolarHBondContact O-CG2 3.35Å; M30-V33 HydrophobicContact SD-CG2 4.31Å; M30-N34 WeakPolarHBondContact O-CB 3.48Å; M30-N34 PolarHBondContact O-N 3.24Å; M30-N34 VanDerWaalsContact O-N 3.08Å
31	A	87.8	Confident	90.9	Very high	70 Å²	70	86.1 Å²	86.1	58%	0.579	46%	0.461	S	S	*	.	H	α-helix	trans	-64.5	-36.8	174.6	0	0	0	0	0	112.5	A27 Q28 L29 N34	A27-A31 WeakPolarHBondContact O-CB 3.25Å; A27-A31 PolarHBondContact O-N 3.43Å; Q28-A31 PolarHBondContact O-N 3.23Å; L29-A31 VanDerWaalsContact C-N 3.33Å; L29-A31 PolarHBondContact O-N 3.48Å; A31-N34 WeakPolarHBondContact O-CB 3.3Å; A31-N34 PolarHBondContact O-N 2.9Å
32	R	85.6	Confident	90.7	Very high	107 Å²	107	84.7 Å²	84.7	40%	0.404	45%	0.447	S	S	.	.	H	α-helix	trans	-70.1	-44.7	177.6	-74.6	-174.3	173.8	-147.8	-0.6	112.8	Q28 L29 M30 N34 Y36 P42	Q28-R32 WeakPolarHBondContact O-CG 3.47Å; Q28-R32 PolarHBondContact O-N 2.8Å; Q28-R32 VanDerWaalsContact O-N 3.12Å; L29-R32 PolarHBondContact O-N 3.08Å; L29-R32 VanDerWaalsContact O-N 3.15Å; M30-R32 VanDerWaalsContact C-N 3.34Å; M30-R32 PolarHBondContact O-N 2.78Å; R32-N34 PolarHBondContact O-N 3.46Å; R32-Y36 WeakPolarHBondContact O-CD1 3.15Å; R32-Y36 WeakPolarHBondContact O-CE1 3.43Å; R32-P42 HydrophobicContact CB-CB 4.25Å; R32-P42 HydrophobicContact CB-CG 4.21Å
33	V	88.4	Confident	90.6	Very high	41 Å²	41	80.2 Å²	80.2	25%	0.248	43%	0.428	C	S	.	.	H	α-helix	trans	-72.3	-12.3	176.8	-62.3	0	0	0	0	112.7	L29 M30 G35 Y36 P42	L29-V33 WeakPolarHBondContact O-CG2 3.3Å; L29-V33 PolarHBondContact O-N 3.1Å; M30-V33 VanDerWaalsContact O-CG2 3.25Å; M30-V33 WeakPolarHBondContact O-CG2 3.35Å; M30-V33 HydrophobicContact SD-CG2 4.31Å; V33-G35 PolarHBondContact O-N 2.73Å; V33-Y36 VanDerWaalsContact O-CB 3.25Å; V33-Y36 WeakPolarHBondContact O-CB 3.49Å; V33-Y36 PolarHBondContact O-N 3.04Å; V33-P42 HydrophobicContact CG1-CG 3.76Å
34	N	88.7	Confident	90.3	Very high	123 Å²	123	84 Å²	84	66%	0.658	45%	0.448	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61	125.2	-178	-170	41.8	0	0	0	110.7	M30 A31 R32 Y36	M30-N34 WeakPolarHBondContact O-CB 3.48Å; M30-N34 PolarHBondContact O-N 3.24Å; M30-N34 VanDerWaalsContact O-N 3.08Å; A31-N34 WeakPolarHBondContact O-CB 3.3Å; A31-N34 PolarHBondContact O-N 2.9Å; R32-N34 PolarHBondContact O-N 3.46Å; N34-Y36 VanDerWaalsContact C-N 3.33Å
35	G	89.7	Confident	89.8	Confident	40 Å²	40	89.7 Å²	89.7	41%	0.412	46%	0.462	S	S	.	.	T	Hydrogen-bonded Turn	trans	81.4	1.3	-175.6	0	0	0	0	0	115.1	V33 K66 K67	V33-G35 PolarHBondContact O-N 2.73Å; G35-K66 CarbonylContact O-C 3.56Å; G35-K66 WeakPolarHBondContact O-CA 3.25Å; G35-K67 PolarHBondContact O-N 3.14Å
36	Y	92.5	Very high	89.5	Confident	21 Å²	21	89.5 Å²	89.5	8%	0.082	46%	0.463	C	S	.	.	B	Isolated β-bridge	trans	-67.6	151.9	173.8	-82.8	33.4	0	0	0	111.9	R32 V33 N34 C40 P42 C48 D62 C65 K66	R32-Y36 WeakPolarHBondContact O-CD1 3.15Å; R32-Y36 WeakPolarHBondContact O-CE1 3.43Å; V33-Y36 VanDerWaalsContact O-CB 3.25Å; V33-Y36 WeakPolarHBondContact O-CB 3.49Å; V33-Y36 PolarHBondContact O-N 3.04Å; N34-Y36 VanDerWaalsContact C-N 3.33Å; Y36-C40 HydrophobicContact CD2-CB 3.8Å; Y36-C40 HydrophobicContact CG-CB 4.4Å; Y36-P42 HydrophobicContact CE2-CB 4.19Å; Y36-C48 HydrophobicContact CD2-CB 4.37Å; Y36-C48 HydrophobicContact CE2-CB 3.42Å; Y36-C48 VanDerWaalsContact CE2-CB 3.42Å; Y36-D62 HydrophobicContact CE1-CB 4.33Å; Y36-D62 VanDerWaalsContact OH-CG 3.26Å; Y36-D62 PolarHBondContact OH-OD1 3.15Å; Y36-C65 CarbonylContact C-O 3.48Å; Y36-C65 WeakPolarHBondContact CA-O 3.34Å; Y36-C65 HydrophobicContact CD2-CB 3.98Å; Y36-C65 HydrophobicContact CE2-CB 4.05Å; Y36-C65 HydrophobicContact CG-CB 4.24Å; Y36-K66 HydrophobicContact CD1-CG 3.85Å; Y36-K66 HydrophobicContact CE1-CG 4.15Å
37	R	91.3	Very high	89.5	Confident	69 Å²	69	84.7 Å²	84.7	26%	0.26	44%	0.441	S	S	.	.	P	Polyproline II helix	trans	-60.4	156.9	167.4	-78.1	-170.2	-61.9	-87.7	9.6	110.4	K39 C40 E52 E64 C65 K66 K67	R37-K39 PolarHBondContact O-N 3.4Å; R37-C40 HydrophobicContact CB-CB 4.41Å; R37-C40 VanDerWaalsContact CB-SG 3.51Å; R37-C40 VanDerWaalsContact O-CB 3.3Å; R37-C40 WeakPolarHBondContact O-CB 3.03Å; R37-C40 PolarHBondContact O-N 2.94Å; R37-C40 VanDerWaalsContact O-N 3.1Å; R37-E52 IonicContact NE-OE1 3.81Å; R37-E64 PolarHBondContact NH1-O 3.3Å; R37-E64 PolarHBondContact NH2-O 3.17Å; R37-C65 PolarHBondContact N-O 3.46Å; R37-K66 PolarHBondContact NH1-O 3.37Å; R37-K67 HydrophobicContact CB-CG 4.22Å; R37-K67 HydrophobicContact CG-CB 4.49Å; R37-K67 HydrophobicContact CG-CD 4.22Å; R37-K67 HydrophobicContact CG-CG 3.34Å
38	E	90.7	Very high	89.5	Confident	153 Å²	153	81.9 Å²	81.9	72%	0.715	42%	0.417	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.8	140.3	175.1	-71.4	174.5	91.7	0	0	110.2	C40 K67	E38-C40 PolarHBondContact O-N 2.97Å; E38-K67 IonicContact OE2-NZ 3.29Å; E38-K67 PolarHBondContact OE2-NZ 3.14Å
39	K	92.1	Very high	89.7	Confident	133 Å²	133	80.5 Å²	80.5	58%	0.578	41%	0.408	S	S	*	.	T	Hydrogen-bonded Turn	trans	59.3	23.2	-175.1	-48	-179.1	178.7	-179.5	0	114.4	R37 Y41 C50 E51	R37-K39 PolarHBondContact O-N 3.4Å; K39-Y41 WeakPolarHBondContact O-CE2 3.49Å; K39-C50 CarbonylContact O-C 3.51Å; K39-C50 WeakPolarHBondContact O-CA 3.44Å; K39-E51 HydrophobicContact CB-CB 3.99Å; K39-E51 HydrophobicContact CD-CB 4.37Å; K39-E51 PolarHBondContact O-N 2.86Å
40	C	93.7	Very high	90	Very high	7 Å²	7	76 Å²	76	5%	0.047	38%	0.384	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.7	138.3	166.9	-62.3	0	0	0	0	110.9	Y36 R37 E38 R49 C50 C65	Y36-C40 HydrophobicContact CD2-CB 3.8Å; Y36-C40 HydrophobicContact CG-CB 4.4Å; R37-C40 HydrophobicContact CB-CB 4.41Å; R37-C40 VanDerWaalsContact CB-SG 3.51Å; R37-C40 VanDerWaalsContact O-CB 3.3Å; R37-C40 WeakPolarHBondContact O-CB 3.03Å; R37-C40 PolarHBondContact O-N 2.94Å; R37-C40 VanDerWaalsContact O-N 3.1Å; E38-C40 PolarHBondContact O-N 2.97Å; C40-R49 CarbonylContact C-O 3.49Å; C40-R49 VanDerWaalsContact CA-O 3.3Å; C40-R49 WeakPolarHBondContact CA-O 3.42Å; C40-C50 HydrophobicContact CB-CB 4.12Å; C40-C50 WeakPolarHBondContact CB-SG 3.07Å; C40-C50 WeakPolarHBondContact SG-CB 3.01Å; C40-C50 CovalentContact SG-SG 2.02Å; C40-C50 PolarHBondContact SG-SG 2.88Å; C40-C65 HydrophobicContact CB-CB 3.99Å
41	Y	91.9	Very high	90.3	Very high	119 Å²	119	73.7 Å²	73.7	47%	0.467	37%	0.372	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.6	138.4	-175.3	-53.9	-83.6	0	0	0	110.5	K39 C48 R49	K39-Y41 WeakPolarHBondContact O-CE2 3.49Å; Y41-C48 CarbonylContact O-C 3.52Å; Y41-C48 VanDerWaalsContact O-CA 3.27Å; Y41-C48 WeakPolarHBondContact O-CA 3.48Å; Y41-C48 WeakPolarHBondContact O-CB 3.47Å; Y41-R49 PolarHBondContact N-O 3.2Å; Y41-R49 PolarHBondContact O-N 3.18Å
42	P	91.2	Very high	90.3	Very high	25 Å²	25	72.6 Å²	72.6	16%	0.162	35%	0.354	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-66.6	145.8	177.4	27.2	-35.9	0	0	0	110.3	L29 R32 V33 Y36	L29-P42 HydrophobicContact CD1-CG 3.77Å; R32-P42 HydrophobicContact CB-CB 4.25Å; R32-P42 HydrophobicContact CB-CG 4.21Å; V33-P42 HydrophobicContact CG1-CG 3.76Å; Y36-P42 HydrophobicContact CE2-CB 4.19Å
43	M	90.7	Very high	90.4	Very high	44 Å²	44	75.2 Å²	75.2	22%	0.217	38%	0.377	C	S	.	.			trans	-91.9	156.7	172.2	-68.2	-168.4	-71.6	0	0	111	K45 D46 G47 R49 R58 Y59	M43-K45 VanDerWaalsContact C-N 3.29Å; M43-K45 PolarHBondContact O-N 3.48Å; M43-D46 WeakPolarHBondContact CE-O 3.5Å; M43-G47 PolarHBondContact N-O 3.35Å; M43-R49 HydrophobicContact CG-CB 4.38Å; M43-R58 HydrophobicContact CE-CB 4.43Å; M43-R58 HydrophobicContact SD-CG 4.37Å; M43-Y59 VanDerWaalsContact CE-O 3.31Å; M43-Y59 WeakPolarHBondContact CE-O 3.49Å
44	P	86.2	Confident	90.5	Very high	132 Å²	132	77.4 Å²	77.4	86%	0.857	41%	0.407	S	S	*	.	S	Bend	trans	-62.6	-30.3	-178	-25.8	34.7	0	0	0	115.2
45	K	83.8	Confident	90.6	Very high	180 Å²	180	78.8 Å²	78.8	78%	0.783	41%	0.407	S	S	*	.	S	Bend	trans	-86.9	-89.7	176.8	-67.2	-173.9	177.6	-174.5	0	109.5	M43	M43-K45 VanDerWaalsContact C-N 3.29Å; M43-K45 PolarHBondContact O-N 3.48Å
46	D	85.8	Confident	90.8	Very high	122 Å²	122	80.5 Å²	80.5	65%	0.652	41%	0.41	S	S	*	.	S	Bend	trans	-143.8	151.4	-178.2	-64.3	-77.8	0	0	0	109.9	M43	M43-D46 WeakPolarHBondContact CE-O 3.5Å
47	G	90.5	Very high	90.8	Very high	0 Å²	0	83.9 Å²	83.9	0%	0	43%	0.425	C	S	.	.	S	Bend	trans	80	-161.3	179.2	0	0	0	0	0	113	M43 Y59 K60 D62	M43-G47 PolarHBondContact N-O 3.35Å; G47-Y59 WeakPolarHBondContact CA-O 3.46Å; G47-K60 WeakPolarHBondContact CA-O 3.19Å; G47-K60 PolarHBondContact N-O 3.12Å; G47-D62 PolarHBondContact N-OD2 3.43Å; G47-D62 VanDerWaalsContact N-OD2 3.14Å
48	C	93.5	Very high	91	Very high	0 Å²	0	89.5 Å²	89.5	0%	0	45%	0.446	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-155.6	152.4	-162.2	48.1	0	0	0	0	112.5	Y36 Y41 R58 Y59 C65	Y36-C48 HydrophobicContact CD2-CB 4.37Å; Y36-C48 HydrophobicContact CE2-CB 3.42Å; Y36-C48 VanDerWaalsContact CE2-CB 3.42Å; Y41-C48 CarbonylContact O-C 3.52Å; Y41-C48 VanDerWaalsContact O-CA 3.27Å; Y41-C48 WeakPolarHBondContact O-CA 3.48Å; Y41-C48 WeakPolarHBondContact O-CB 3.47Å; C48-R58 WeakPolarHBondContact O-CA 2.89Å; C48-Y59 PolarHBondContact N-O 3.34Å; C48-Y59 PolarHBondContact O-N 1.97Å; C48-C65 HydrophobicContact CB-CB 3.65Å; C48-C65 WeakPolarHBondContact CB-SG 3.35Å; C48-C65 WeakPolarHBondContact SG-CB 3.31Å; C48-C65 CovalentContact SG-SG 1.97Å; C48-C65 PolarHBondContact SG-SG 3.17Å
49	R	93.3	Very high	91.1	Very high	81 Å²	81	84.3 Å²	84.3	31%	0.306	42%	0.42	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.2	123.5	179.6	176.1	-174.3	167	-110.2	-10.9	108.8	C40 Y41 M43 E51 V56 K57 R58	C40-R49 CarbonylContact C-O 3.49Å; C40-R49 VanDerWaalsContact CA-O 3.3Å; C40-R49 WeakPolarHBondContact CA-O 3.42Å; Y41-R49 PolarHBondContact N-O 3.2Å; Y41-R49 PolarHBondContact O-N 3.18Å; M43-R49 HydrophobicContact CG-CB 4.38Å; R49-E51 IonicContact CZ-OE1 3.34Å; R49-E51 IonicContact NH1-OE1 3.24Å; R49-E51 PolarHBondContact NH1-OE1 2.71Å; R49-E51 IonicContact NH2-OE1 2.78Å; R49-E51 PolarHBondContact NH2-OE1 3.31Å; R49-V56 HydrophobicContact CG-CG1 3.59Å; R49-V56 VanDerWaalsContact NH2-CG2 3.26Å; R49-K57 CarbonylContact C-O 3.52Å; R49-K57 VanDerWaalsContact CA-O 3.32Å; R49-K57 WeakPolarHBondContact CA-O 3.22Å; R49-R58 HydrophobicContact CB-CG 4.46Å; R49-R58 HydrophobicContact CG-CG 4.41Å
50	C	94.4	Very high	91.1	Very high	0 Å²	0	86.5 Å²	86.5	0%	0	43%	0.43	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.1	142.1	176.3	-62.4	0	0	0	0	111.8	K39 C40 E52 V56 K57 Y59 C65	K39-C50 CarbonylContact O-C 3.51Å; K39-C50 WeakPolarHBondContact O-CA 3.44Å; C40-C50 HydrophobicContact CB-CB 4.12Å; C40-C50 WeakPolarHBondContact CB-SG 3.07Å; C40-C50 WeakPolarHBondContact SG-CB 3.01Å; C40-C50 CovalentContact SG-SG 2.02Å; C40-C50 PolarHBondContact SG-SG 2.88Å; C50-E52 HydrophobicContact CB-CG 4Å; C50-V56 WeakPolarHBondContact O-CA 3.37Å; C50-K57 PolarHBondContact N-O 2.91Å; C50-K57 PolarHBondContact O-N 2.8Å; C50-Y59 HydrophobicContact CB-CE2 4.02Å; C50-C65 PolarHBondContact SG-SG 3.26Å
51	E	93.7	Very high	90.9	Very high	80 Å²	80	93.9 Å²	93.9	37%	0.374	46%	0.456	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.6	100.2	169.8	-54.9	-170.6	-165.5	0	0	109.7	K39 R49 K55 V56	K39-E51 HydrophobicContact CB-CB 3.99Å; K39-E51 HydrophobicContact CD-CB 4.37Å; K39-E51 PolarHBondContact O-N 2.86Å; R49-E51 IonicContact CZ-OE1 3.34Å; R49-E51 IonicContact NH1-OE1 3.24Å; R49-E51 PolarHBondContact NH1-OE1 2.71Å; R49-E51 IonicContact NH2-OE1 2.78Å; R49-E51 PolarHBondContact NH2-OE1 3.31Å; E51-K55 WeakPolarHBondContact CA-O 2.9Å; E51-V56 HydrophobicContact CG-CG2 4.49Å
52	E	89.1	Confident	90.7	Very high	47 Å²	47	90.4 Å²	90.4	22%	0.22	45%	0.446	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119	122.8	-176.2	-60.3	-175.7	138	0	0	109.5	R37 C50 G54 K55 K57 Y59	R37-E52 IonicContact NE-OE1 3.81Å; C50-E52 HydrophobicContact CB-CG 4Å; E52-G54 VanDerWaalsContact C-N 3.28Å; E52-G54 PolarHBondContact O-N 3.31Å; E52-K55 PolarHBondContact N-O 2.65Å; E52-K55 WeakPolarHBondContact O-CA 3.32Å; E52-K55 WeakPolarHBondContact O-CB 3.39Å; E52-K55 PolarHBondContact O-N 2.02Å; E52-K55 VanDerWaalsContact O-O 3.11Å; E52-K57 WeakPolarHBondContact OE2-CD 3.49Å; E52-K57 VanDerWaalsContact OE2-CE 3.22Å; E52-K57 WeakPolarHBondContact OE2-CE 3.27Å; E52-K57 IonicContact OE2-NZ 2.71Å; E52-K57 PolarHBondContact OE2-NZ 2.82Å; E52-Y59 PolarHBondContact OE2-OH 2.8Å
53	N	87.6	Confident	90.6	Very high	163 Å²	163	94.9 Å²	94.9	87%	0.872	47%	0.468	S	S	*	.	T	Hydrogen-bonded Turn	trans	53.5	40.3	178.4	-57.9	-26.5	0	0	0	114.1	K55	N53-K55 PolarHBondContact O-N 2.93Å
54	G	89.3	Confident	90.6	Very high	86 Å²	86	95.9 Å²	95.9	89%	0.887	47%	0.471	S	S	*	.	T	Hydrogen-bonded Turn	trans	71.2	3.8	-176.6	0	0	0	0	0	114.4	E52	E52-G54 VanDerWaalsContact C-N 3.28Å; E52-G54 PolarHBondContact O-N 3.31Å
55	K	92	Very high	90.8	Very high	152 Å²	152	89.6 Å²	89.6	66%	0.661	43%	0.431	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-107.4	141.9	176	-63	-177.6	-178.3	179.9	0	110.4	E51 E52 N53	E51-K55 WeakPolarHBondContact CA-O 2.9Å; E52-K55 PolarHBondContact N-O 2.65Å; E52-K55 WeakPolarHBondContact O-CA 3.32Å; E52-K55 WeakPolarHBondContact O-CB 3.39Å; E52-K55 PolarHBondContact O-N 2.02Å; E52-K55 VanDerWaalsContact O-O 3.11Å; N53-K55 PolarHBondContact O-N 2.93Å
56	V	93.6	Very high	91.1	Very high	76 Å²	76	85.4 Å²	85.4	46%	0.461	41%	0.413	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.1	116.3	173	176.1	0	0	0	0	108.9	R49 C50 E51	R49-V56 HydrophobicContact CG-CG1 3.59Å; R49-V56 VanDerWaalsContact NH2-CG2 3.26Å; C50-V56 WeakPolarHBondContact O-CA 3.37Å; E51-V56 HydrophobicContact CG-CG2 4.49Å
57	K	93.2	Very high	91.1	Very high	93 Å²	93	88.8 Å²	88.8	40%	0.404	42%	0.421	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.1	144.3	169.1	-61.4	-163.5	-162.5	149.7	0	110.5	R49 C50 E52 Y59	R49-K57 CarbonylContact C-O 3.52Å; R49-K57 VanDerWaalsContact CA-O 3.32Å; R49-K57 WeakPolarHBondContact CA-O 3.22Å; C50-K57 PolarHBondContact N-O 2.91Å; C50-K57 PolarHBondContact O-N 2.8Å; E52-K57 WeakPolarHBondContact OE2-CD 3.49Å; E52-K57 VanDerWaalsContact OE2-CE 3.22Å; E52-K57 WeakPolarHBondContact OE2-CE 3.27Å; E52-K57 IonicContact OE2-NZ 2.71Å; E52-K57 PolarHBondContact OE2-NZ 2.82Å; K57-Y59 HydrophobicContact CB-CE2 4.02Å
58	R	93.7	Very high	91.1	Very high	186 Å²	186	93.2 Å²	93.2	70%	0.702	44%	0.442	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-120.3	130.2	175.3	-65.6	-177.2	179.5	-170.2	-0.6	108.7	M43 C48 R49	M43-R58 HydrophobicContact CE-CB 4.43Å; M43-R58 HydrophobicContact SD-CG 4.37Å; C48-R58 WeakPolarHBondContact O-CA 2.89Å; R49-R58 HydrophobicContact CB-CG 4.46Å; R49-R58 HydrophobicContact CG-CG 4.41Å
59	Y	93.4	Very high	91	Very high	44 Å²	44	98.1 Å²	98.1	17%	0.173	47%	0.466	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.5	144.9	177.3	-61.3	-82	0	0	0	109.2	M43 G47 C48 C50 E52 K57 E64 C65	M43-Y59 VanDerWaalsContact CE-O 3.31Å; M43-Y59 WeakPolarHBondContact CE-O 3.49Å; G47-Y59 WeakPolarHBondContact CA-O 3.46Å; C48-Y59 PolarHBondContact N-O 3.34Å; C48-Y59 PolarHBondContact O-N 1.97Å; C50-Y59 HydrophobicContact CB-CE2 4.02Å; E52-Y59 PolarHBondContact OE2-OH 2.8Å; K57-Y59 HydrophobicContact CB-CE2 4.02Å; Y59-E64 HydrophobicContact CD1-CB 3.62Å; Y59-E64 HydrophobicContact CD1-CG 4.28Å; Y59-E64 HydrophobicContact CE1-CB 4.41Å; Y59-E64 HydrophobicContact CG-CB 3.73Å; Y59-C65 WeakPolarHBondContact CD2-SG 3.34Å
60	K	92	Very high	90.9	Very high	180 Å²	180	99.1 Å²	99.1	78%	0.783	48%	0.475	S	S	*	.	S	Bend	trans	-82	-24.3	-175.9	-69.7	-177.3	179.4	179.5	0	111.9	G47 E64	G47-K60 WeakPolarHBondContact CA-O 3.19Å; G47-K60 PolarHBondContact N-O 3.12Å; K60-E64 PolarHBondContact N-OE2 2.83Å; K60-E64 VanDerWaalsContact N-OE2 3.14Å
61	R	90.4	Very high	90.7	Very high	161 Å²	161	104.9 Å²	104.9	61%	0.608	50%	0.502	S	S	*	.	S	Bend	trans	-120.3	136.8	-178.1	-56.5	178.1	-66.5	175.3	0.6	110.2	I63 E64	R61-I63 HydrophobicContact CB-CG2 3.89Å; R61-I63 PolarHBondContact O-N 2.54Å; R61-E64 HydrophobicContact CB-CG 4.24Å; R61-E64 PolarHBondContact N-OE2 3.03Å; R61-E64 VanDerWaalsContact N-OE2 3.09Å; R61-E64 WeakPolarHBondContact O-CB 3.4Å; R61-E64 PolarHBondContact O-N 2.98Å
62	D	87.4	Confident	90.5	Very high	46 Å²	46	106.4 Å²	106.4	25%	0.246	51%	0.51	C	S	.	.	G	3₁₀ helix	trans	-55.6	-34.4	178.1	-69.3	-117.6	0	0	0	113.2	Y36 G47 E64 C65 K66	Y36-D62 HydrophobicContact CE1-CB 4.33Å; Y36-D62 VanDerWaalsContact OH-CG 3.26Å; Y36-D62 PolarHBondContact OH-OD1 3.15Å; G47-D62 PolarHBondContact N-OD2 3.43Å; G47-D62 VanDerWaalsContact N-OD2 3.14Å; D62-E64 PolarHBondContact O-N 3.43Å; D62-E64 VanDerWaalsContact O-N 3.17Å; D62-C65 PolarHBondContact O-N 2.8Å; D62-K66 PolarHBondContact O-N 3.09Å
63	I	89.1	Confident	90.6	Very high	120 Å²	120	110.4 Å²	110.4	62%	0.615	53%	0.53	S	S	*	.	G	3₁₀ helix	trans	-58.1	-29.4	178.7	-165	165.6	0	0	0	112.3	R61 C65 K66	R61-I63 HydrophobicContact CB-CG2 3.89Å; R61-I63 PolarHBondContact O-N 2.54Å; I63-C65 PolarHBondContact O-N 3.02Å; I63-K66 PolarHBondContact O-N 3.01Å
64	E	90.9	Very high	90.8	Very high	64 Å²	64	106.6 Å²	106.6	30%	0.299	51%	0.505	S	S	.	.	G	3₁₀ helix	trans	-69.6	-24.6	-179.8	-62.1	-178.6	95.3	0	0	111.8	R37 Y59 K60 R61 D62	R37-E64 PolarHBondContact NH1-O 3.3Å; R37-E64 PolarHBondContact NH2-O 3.17Å; Y59-E64 HydrophobicContact CD1-CB 3.62Å; Y59-E64 HydrophobicContact CD1-CG 4.28Å; Y59-E64 HydrophobicContact CE1-CB 4.41Å; Y59-E64 HydrophobicContact CG-CB 3.73Å; K60-E64 PolarHBondContact N-OE2 2.83Å; K60-E64 VanDerWaalsContact N-OE2 3.14Å; R61-E64 HydrophobicContact CB-CG 4.24Å; R61-E64 PolarHBondContact N-OE2 3.03Å; R61-E64 VanDerWaalsContact N-OE2 3.09Å; R61-E64 WeakPolarHBondContact O-CB 3.4Å; R61-E64 PolarHBondContact O-N 2.98Å; D62-E64 PolarHBondContact O-N 3.43Å; D62-E64 VanDerWaalsContact O-N 3.17Å
65	C	91	Very high	90.9	Very high	0 Å²	0	108.2 Å²	108.2	0%	0	48%	0.476	C	S	.	.	G	3₁₀ helix	trans	-94.7	-7.1	177.6	-62.2	0	0	0	0	113.9	Y36 R37 C40 C48 C50 Y59 D62 I63	Y36-C65 CarbonylContact C-O 3.48Å; Y36-C65 WeakPolarHBondContact CA-O 3.34Å; Y36-C65 HydrophobicContact CD2-CB 3.98Å; Y36-C65 HydrophobicContact CE2-CB 4.05Å; Y36-C65 HydrophobicContact CG-CB 4.24Å; R37-C65 PolarHBondContact N-O 3.46Å; C40-C65 HydrophobicContact CB-CB 3.99Å; C48-C65 HydrophobicContact CB-CB 3.65Å; C48-C65 WeakPolarHBondContact CB-SG 3.35Å; C48-C65 WeakPolarHBondContact SG-CB 3.31Å; C48-C65 CovalentContact SG-SG 1.97Å; C48-C65 PolarHBondContact SG-SG 3.17Å; C50-C65 PolarHBondContact SG-SG 3.26Å; Y59-C65 WeakPolarHBondContact CD2-SG 3.34Å; D62-C65 PolarHBondContact O-N 2.8Å; I63-C65 PolarHBondContact O-N 3.02Å
66	K	89.7	Confident	90.8	Very high	93 Å²	93	104.6 Å²	104.6	40%	0.404	46%	0.461	S	S	.	.	B	Isolated β-bridge	trans	-76.5	149.9	178.6	-69.2	-178.6	176.5	-173.3	0	111.4	G35 Y36 R37 D62 I63	G35-K66 CarbonylContact O-C 3.56Å; G35-K66 WeakPolarHBondContact O-CA 3.25Å; Y36-K66 HydrophobicContact CD1-CG 3.85Å; Y36-K66 HydrophobicContact CE1-CG 4.15Å; R37-K66 PolarHBondContact NH1-O 3.37Å; D62-K66 PolarHBondContact O-N 3.09Å; I63-K66 PolarHBondContact O-N 3.01Å
67	K	85.3	Confident	90.6	Very high	192 Å²	192	107.2 Å²	107.2	84%	0.835	46%	0.461	S	S	*	.			trans	-84.1	0	169.2	-75.7	-173.2	178.6	-179	0	110	G35 R37 E38	G35-K67 PolarHBondContact O-N 3.14Å; R37-K67 HydrophobicContact CB-CG 4.22Å; R37-K67 HydrophobicContact CG-CB 4.49Å; R37-K67 HydrophobicContact CG-CD 4.22Å; R37-K67 HydrophobicContact CG-CG 3.34Å; E38-K67 IonicContact OE2-NZ 3.29Å; E38-K67 PolarHBondContact OE2-NZ 3.14Å

Retrieved 67 of 67 residues in 30.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).