A0A077Z8B7_TRITR Loading...

U6 snRNA-associated Sm-like protein LSm3

Binds specifically to the 3'-terminal U-tract of U6 snRNA.

AlphaFold DB , UniProt , Accession A0A077Z8B7, Species TRITR (Trichuris trichiura, Whipworm), Gene LSM3, Length 105 aa.

						>A0A077Z8B7_TRITR|A0A077Z8B7|LSM3
MAEEEIVPQGPVVEEPLDLVRLSLNERIYVKLRNNRELYGVLHAYDQHLNMILSNVEEKVTIIEVDEETYEELFTERRRSVELLFVRGDGVILVSPPSHAPEAIG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	59.1	Low	65.8	Low	235 Å²	235	142.9 Å²	142.9	100%	1.158	79%	0.785	S	S	*	*				0	115.3	0	-70.8	166.6	79.5	0	0	104.7	E3	M1-E3 PolarHBondContact O-N 3.31Å
2	A	70.2	Confident	67	Low	101 Å²	101	138 Å²	138	84%	0.835	76%	0.762	S	S	*	*			trans	-64.2	125.5	174.6	0	0	0	0	0	106.8	E4	A2-E4 PolarHBondContact O-N 3.15Å; A2-E4 VanDerWaalsContact O-N 3.15Å
3	E	63.4	Low	68.6	Low	190 Å²	190	132.8 Å²	132.8	89%	0.888	74%	0.736	S	S	*	*			trans	-65.4	111.4	170.9	-67.5	177.4	171.1	0	0	105.9	M1 E5	M1-E3 PolarHBondContact O-N 3.31Å; E3-E5 PolarHBondContact O-N 3.01Å
4	E	65.3	Low	70.3	Confident	184 Å²	184	135.1 Å²	135.1	86%	0.86	74%	0.739	S	S	*	*			trans	-61.7	108.8	169.2	-84.9	-175	158.3	0	0	107	A2 I6	A2-E4 PolarHBondContact O-N 3.15Å; A2-E4 VanDerWaalsContact O-N 3.15Å; E4-I6 PolarHBondContact O-N 2.99Å
5	E	67.2	Low	71.7	Confident	175 Å²	175	133.3 Å²	133.3	82%	0.818	72%	0.723	S	S	*	*			trans	-62.3	106.8	172.2	-158.8	173.7	-159.5	0	0	106.8	E3 V7	E3-E5 PolarHBondContact O-N 3.01Å; E5-V7 PolarHBondContact O-N 2.8Å
6	I	67.9	Low	72.9	Confident	156 Å²	156	131.9 Å²	131.9	80%	0.8	72%	0.723	S	S	*	*			trans	-67.2	91.1	176.6	-55.6	174.1	0	0	0	106.1	E4 P8	E4-I6 PolarHBondContact O-N 2.99Å; I6-P8 VanDerWaalsContact O-CD 3.23Å; I6-P8 WeakPolarHBondContact O-CD 3.23Å; I6-P8 VanDerWaalsContact O-N 3.12Å
7	V	68.9	Low	74.1	Confident	108 Å²	108	127 Å²	127	66%	0.655	70%	0.696	S	S	*	*			trans	-61.6	116	170	-166.4	0	0	0	0	105.3	E5 Q9	E5-V7 PolarHBondContact O-N 2.8Å; V7-Q9 PolarHBondContact O-N 2.99Å
8	P	61.1	Low	75.1	Confident	114 Å²	114	120.3 Å²	120.3	74%	0.74	66%	0.659	S	S	*	*			trans	-60.4	110.7	177.2	22.5	-28.9	0	0	0	106.4	I6 G10	I6-P8 VanDerWaalsContact O-CD 3.23Å; I6-P8 WeakPolarHBondContact O-CD 3.23Å; I6-P8 VanDerWaalsContact O-N 3.12Å; P8-G10 PolarHBondContact O-N 2.86Å
9	Q	65.3	Low	76	Confident	171 Å²	171	118.5 Å²	118.5	80%	0.799	65%	0.648	S	S	*	*			trans	-55	115.2	170.6	-66.6	-76.5	-14.2	0	0	104.8	V7	V7-Q9 PolarHBondContact O-N 2.99Å
10	G	66.7	Low	76.9	Confident	50 Å²	50	113.3 Å²	113.3	52%	0.515	62%	0.62	S	S	.	*			trans	-51.6	159.9	172.8	0	0	0	0	0	109.4	P8 V12	P8-G10 PolarHBondContact O-N 2.86Å; G10-V12 PolarHBondContact O-N 3.15Å
11	P	68.8	Low	77.7	Confident	88 Å²	88	113.5 Å²	113.5	57%	0.571	61%	0.611	S	S	*	*			trans	-52.3	115.7	-175	20.4	-30.6	0	0	0	109.9	V13 L22	P11-V13 PolarHBondContact O-N 2.98Å; P11-L22 HydrophobicContact CB-CD1 4.43Å; P11-L22 HydrophobicContact CB-CD2 3.58Å; P11-L22 HydrophobicContact CG-CD1 4.34Å; P11-L22 HydrophobicContact CG-CD2 3.56Å
12	V	80	Confident	79.4	Confident	84 Å²	84	106 Å²	106	51%	0.509	58%	0.575	S	S	.	*			trans	-70.1	119.5	178.2	-174.7	0	0	0	0	106.2	G10 E14	G10-V12 PolarHBondContact O-N 3.15Å; V12-E14 HydrophobicContact CB-CG 4.26Å; V12-E14 HydrophobicContact CG1-CG 3.65Å; V12-E14 PolarHBondContact O-N 2.97Å
13	V	88.4	Confident	80.5	Confident	70 Å²	70	101.3 Å²	101.3	42%	0.424	54%	0.537	S	S	.	.			trans	-81.5	103.4	169.2	178	0	0	0	0	106.2	P11 D18 L19 L22	P11-V13 PolarHBondContact O-N 2.98Å; V13-D18 HydrophobicContact CG1-CB 4.22Å; V13-L19 HydrophobicContact CG1-CD2 3.93Å; V13-L19 HydrophobicContact CG1-CG 3.98Å; V13-L19 HydrophobicContact CG2-CD2 3.89Å; V13-L22 HydrophobicContact CG2-CD1 3.76Å
14	E	91.6	Very high	82.1	Confident	165 Å²	165	95 Å²	95	77%	0.771	51%	0.509	S	S	*	.			trans	-97.1	-36.3	-179.7	-63.8	-173.1	174.4	0	0	110.9	V12 D18	V12-E14 HydrophobicContact CB-CG 4.26Å; V12-E14 HydrophobicContact CG1-CG 3.65Å; V12-E14 PolarHBondContact O-N 2.97Å; E14-D18 PolarHBondContact N-OD2 3.38Å
15	E	92.3	Very high	83.6	Confident	109 Å²	109	92 Å²	92	51%	0.509	50%	0.499	S	S	.	.	S	Bend	trans	-132	158.5	179.8	63.1	176.6	-166.5	0	0	113	L17 D18	E15-L17 PolarHBondContact O-N 3.12Å; E15-L17 VanDerWaalsContact O-N 3.12Å; E15-D18 PolarHBondContact N-OD2 2.86Å; E15-D18 VanDerWaalsContact O-CB 3.28Å; E15-D18 WeakPolarHBondContact O-CB 3.28Å; E15-D18 PolarHBondContact O-N 3.25Å
16	P	90.3	Very high	85	Confident	111 Å²	111	88.4 Å²	88.4	72%	0.721	48%	0.482	S	S	*	.	H	α-helix	trans	-55.6	-33.6	-177.1	-28.5	36.1	0	0	0	114.9	D18 L19	P16-D18 PolarHBondContact O-N 3.41Å; P16-L19 PolarHBondContact O-N 2.9Å
17	L	93	Very high	86.4	Confident	48 Å²	48	84.8 Å²	84.8	25%	0.251	46%	0.458	S	S	.	.	H	α-helix	trans	-69.9	-19.5	178.8	-74.8	176.4	0	0	0	113.2	E15 L19 V20 R21 Q47 L49	E15-L17 PolarHBondContact O-N 3.12Å; E15-L17 VanDerWaalsContact O-N 3.12Å; L17-L19 PolarHBondContact O-N 3.01Å; L17-V20 PolarHBondContact O-N 2.97Å; L17-V20 VanDerWaalsContact O-N 3.11Å; L17-R21 PolarHBondContact O-N 3.26Å; L17-Q47 HydrophobicContact CD1-CG 4.37Å; L17-L49 HydrophobicContact CD2-CD2 3.68Å; L17-L49 HydrophobicContact CD2-CG 4.46Å
18	D	92.6	Very high	87.7	Confident	7 Å²	7	79.6 Å²	79.6	4%	0.037	43%	0.427	C	S	.	.	H	α-helix	trans	-61.5	-32.6	174.2	-71.1	-38.2	0	0	0	111.3	V13 E14 E15 P16 V20 R21 L22	V13-D18 HydrophobicContact CG1-CB 4.22Å; E14-D18 PolarHBondContact N-OD2 3.38Å; E15-D18 PolarHBondContact N-OD2 2.86Å; E15-D18 VanDerWaalsContact O-CB 3.28Å; E15-D18 WeakPolarHBondContact O-CB 3.28Å; E15-D18 PolarHBondContact O-N 3.25Å; P16-D18 PolarHBondContact O-N 3.41Å; D18-V20 VanDerWaalsContact C-N 3.3Å; D18-V20 PolarHBondContact O-N 3.2Å; D18-R21 VanDerWaalsContact O-CB 3.32Å; D18-R21 WeakPolarHBondContact O-CB 3.32Å; D18-R21 PolarHBondContact O-N 2.9Å; D18-R21 IonicContact OD1-CZ 3.09Å; D18-R21 IonicContact OD1-NE 3.83Å; D18-R21 IonicContact OD1-NH1 3.15Å; D18-R21 PolarHBondContact OD1-NH1 3.39Å; D18-R21 VanDerWaalsContact OD1-NH1 3.15Å; D18-R21 IonicContact OD1-NH2 2.99Å; D18-R21 PolarHBondContact OD1-NH2 3.13Å; D18-L22 VanDerWaalsContact O-CG 3.24Å; D18-L22 WeakPolarHBondContact O-CG 3.24Å; D18-L22 PolarHBondContact O-N 3.37Å
19	L	92.2	Very high	89.5	Confident	86 Å²	86	77.7 Å²	77.7	45%	0.45	41%	0.405	S	S	.	.	H	α-helix	trans	-63.7	-37.1	176.1	-65	173.1	0	0	0	112.1	V13 P16 L17 S23	V13-L19 HydrophobicContact CG1-CD2 3.93Å; V13-L19 HydrophobicContact CG1-CG 3.98Å; V13-L19 HydrophobicContact CG2-CD2 3.89Å; P16-L19 PolarHBondContact O-N 2.9Å; L17-L19 PolarHBondContact O-N 3.01Å; L19-S23 PolarHBondContact O-N 3.11Å; L19-S23 PolarHBondContact O-OG 2.89Å
20	V	94.5	Very high	91	Very high	13 Å²	13	69.5 Å²	69.5	8%	0.079	37%	0.367	C	S	.	.	H	α-helix	trans	-70.5	-41	174.9	-176	0	0	0	0	109.9	L17 D18 L22 S23 L42 Y45 L49 M51	L17-V20 PolarHBondContact O-N 2.97Å; L17-V20 VanDerWaalsContact O-N 3.11Å; D18-V20 VanDerWaalsContact C-N 3.3Å; D18-V20 PolarHBondContact O-N 3.2Å; V20-L22 VanDerWaalsContact C-N 3.29Å; V20-L22 PolarHBondContact O-N 2.94Å; V20-S23 WeakPolarHBondContact O-CB 3.39Å; V20-S23 PolarHBondContact O-N 3.37Å; V20-L42 HydrophobicContact CG1-CD2 3.9Å; V20-Y45 HydrophobicContact CB-CD2 4.43Å; V20-Y45 HydrophobicContact CB-CE2 4.27Å; V20-Y45 HydrophobicContact CG1-CD1 3.95Å; V20-Y45 HydrophobicContact CG1-CD2 3.77Å; V20-Y45 HydrophobicContact CG1-CE1 4.24Å; V20-Y45 HydrophobicContact CG1-CE2 4.05Å; V20-Y45 HydrophobicContact CG1-CG 3.73Å; V20-L49 HydrophobicContact CG2-CD2 4.17Å; V20-M51 HydrophobicContact CG1-CE 4.26Å
21	R	93.9	Very high	92.5	Very high	118 Å²	118	69.3 Å²	69.3	45%	0.445	35%	0.352	S	S	.	.	H	α-helix	trans	-55.8	-44.6	174.3	-165.2	176.9	63.9	-158	-6.9	112.1	L17 D18 S23 L24 Y45	L17-R21 PolarHBondContact O-N 3.26Å; D18-R21 VanDerWaalsContact O-CB 3.32Å; D18-R21 WeakPolarHBondContact O-CB 3.32Å; D18-R21 PolarHBondContact O-N 2.9Å; D18-R21 IonicContact OD1-CZ 3.09Å; D18-R21 IonicContact OD1-NE 3.83Å; D18-R21 IonicContact OD1-NH1 3.15Å; D18-R21 PolarHBondContact OD1-NH1 3.39Å; D18-R21 VanDerWaalsContact OD1-NH1 3.15Å; D18-R21 IonicContact OD1-NH2 2.99Å; D18-R21 PolarHBondContact OD1-NH2 3.13Å; R21-S23 PolarHBondContact O-N 3.23Å; R21-L24 HydrophobicContact CG-CD1 4.39Å; R21-L24 WeakPolarHBondContact O-CB 3.19Å; R21-L24 WeakPolarHBondContact O-CG 3.43Å; R21-L24 PolarHBondContact O-N 2.98Å; R21-Y45 WeakPolarHBondContact CA-OH 3.28Å; R21-Y45 HydrophobicContact CB-CE1 4.4Å; R21-Y45 WeakPolarHBondContact CB-OH 3.48Å
22	L	93.1	Very high	94	Very high	77 Å²	77	66.1 Å²	66.1	40%	0.403	33%	0.33	S	S	.	.	T	Hydrogen-bonded Turn	trans	-67	-16.7	178.8	-69.1	173	0	0	0	113.3	P11 V13 D18 V20	P11-L22 HydrophobicContact CB-CD1 4.43Å; P11-L22 HydrophobicContact CB-CD2 3.58Å; P11-L22 HydrophobicContact CG-CD1 4.34Å; P11-L22 HydrophobicContact CG-CD2 3.56Å; V13-L22 HydrophobicContact CG2-CD1 3.76Å; D18-L22 VanDerWaalsContact O-CG 3.24Å; D18-L22 WeakPolarHBondContact O-CG 3.24Å; D18-L22 PolarHBondContact O-N 3.37Å; V20-L22 VanDerWaalsContact C-N 3.29Å; V20-L22 PolarHBondContact O-N 2.94Å
23	S	94.3	Very high	94.8	Very high	3 Å²	3	69.5 Å²	69.5	2%	0.021	33%	0.334	C	S	.	.	T	Hydrogen-bonded Turn	trans	-93.7	5.7	177.8	-51.9	0	0	0	0	113.3	L19 V20 R21 E26	L19-S23 PolarHBondContact O-N 3.11Å; L19-S23 PolarHBondContact O-OG 2.89Å; V20-S23 WeakPolarHBondContact O-CB 3.39Å; V20-S23 PolarHBondContact O-N 3.37Å; R21-S23 PolarHBondContact O-N 3.23Å; S23-E26 WeakPolarHBondContact O-CB 3.38Å; S23-E26 PolarHBondContact O-N 3.18Å
24	L	96.5	Very high	95.1	Very high	58 Å²	58	72.8 Å²	72.8	30%	0.304	35%	0.349	S	S	.	.	T	Hydrogen-bonded Turn	trans	-62.2	138.5	174.3	-78.1	171.9	0	0	0	111.2	R21 E26 L42 H43 Y45	R21-L24 HydrophobicContact CG-CD1 4.39Å; R21-L24 WeakPolarHBondContact O-CB 3.19Å; R21-L24 WeakPolarHBondContact O-CG 3.43Å; R21-L24 PolarHBondContact O-N 2.98Å; L24-E26 PolarHBondContact O-N 3.39Å; L24-L42 HydrophobicContact CD2-CD2 4.36Å; L24-L42 HydrophobicContact CD2-CG 4.25Å; L24-H43 WeakPolarHBondContact CD2-O 3.43Å; L24-Y45 HydrophobicContact CD1-CE1 4.18Å; L24-Y45 HydrophobicContact CD2-CD1 3.98Å; L24-Y45 HydrophobicContact CD2-CE1 4.22Å; L24-Y45 HydrophobicContact CG-CD1 4.39Å; L24-Y45 HydrophobicContact CG-CE1 4.16Å
25	N	96.7	Very high	95.3	Very high	121 Å²	121	68.3 Å²	68.3	65%	0.647	33%	0.33	S	S	*	.	T	Hydrogen-bonded Turn	trans	62.8	7.1	-173.4	-54	-55.8	0	0	0	115.1	L42	N25-L42 WeakPolarHBondContact CA-O 3.48Å; N25-L42 PolarHBondContact N-O 2.89Å
26	E	96.9	Very high	95.6	Very high	100 Å²	100	67.5 Å²	67.5	47%	0.467	32%	0.323	S	S	.	.	S	Bend	trans	-105.1	160.1	177.7	-68.7	-68.9	163.8	0	0	111.7	S23 L24 I28 V41 L42 P97	S23-E26 WeakPolarHBondContact O-CB 3.38Å; S23-E26 PolarHBondContact O-N 3.18Å; L24-E26 PolarHBondContact O-N 3.39Å; E26-I28 PolarHBondContact O-N 2.79Å; E26-V41 WeakPolarHBondContact O-CA 3.34Å; E26-L42 PolarHBondContact O-N 3.25Å; E26-P97 HydrophobicContact CB-CG 3.39Å; E26-P97 HydrophobicContact CG-CG 3.96Å
27	R	96.7	Very high	96	Very high	79 Å²	79	64.1 Å²	64.1	30%	0.298	30%	0.297	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.8	117.9	176.1	-156.3	167.5	-173.7	-168.4	-3.1	110.2	Y39 G40 E57 P97	R27-Y39 HydrophobicContact CB-CE2 4.42Å; R27-Y39 VanDerWaalsContact CD-CZ 3.45Å; R27-Y39 HydrophobicContact CG-CD1 4.34Å; R27-Y39 HydrophobicContact CG-CD2 4.22Å; R27-Y39 HydrophobicContact CG-CE1 3.91Å; R27-Y39 HydrophobicContact CG-CE2 3.76Å; R27-Y39 HydrophobicContact CG-CG 4.48Å; R27-Y39 VanDerWaalsContact NH2-CD1 3.31Å; R27-G40 CarbonylContact C-O 3.59Å; R27-G40 WeakPolarHBondContact CA-O 3.14Å; R27-E57 IonicContact CZ-OE1 3.4Å; R27-E57 IonicContact NH1-OE1 2.74Å; R27-E57 VanDerWaalsContact NH2-CD 3.28Å; R27-E57 IonicContact NH2-OE1 3.19Å; R27-E57 PolarHBondContact NH2-OE1 2.88Å; R27-P97 WeakPolarHBondContact O-CA 3.43Å
28	I	97.4	Very high	96.2	Very high	0 Å²	0	61.9 Å²	61.9	0%	0	29%	0.285	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.2	157.9	-177.2	61.4	164.5	0	0	0	111.6	E26 V30 Y39 G40 L42 M51 L53 V94 S95	E26-I28 PolarHBondContact O-N 2.79Å; I28-V30 HydrophobicContact CD1-CG2 3.56Å; I28-V30 HydrophobicContact CG1-CG2 4.08Å; I28-Y39 WeakPolarHBondContact O-CA 3.47Å; I28-Y39 VanDerWaalsContact O-CD2 3.28Å; I28-Y39 WeakPolarHBondContact O-CD2 3.49Å; I28-G40 PolarHBondContact N-O 2.97Å; I28-G40 PolarHBondContact O-N 3.31Å; I28-G40 VanDerWaalsContact O-N 3.14Å; I28-L42 HydrophobicContact CD1-CB 3.8Å; I28-L42 HydrophobicContact CD1-CD1 4.18Å; I28-L42 HydrophobicContact CD1-CD2 4.14Å; I28-L42 HydrophobicContact CD1-CG 4.24Å; I28-L42 HydrophobicContact CG1-CB 4.07Å; I28-L42 HydrophobicContact CG2-CB 4.45Å; I28-M51 HydrophobicContact CD1-SD 4.15Å; I28-L53 HydrophobicContact CD1-CD2 4Å; I28-L53 HydrophobicContact CG1-CD2 4.31Å; I28-V94 HydrophobicContact CD1-CG1 3.98Å; I28-S95 WeakPolarHBondContact CB-O 3.43Å
29	Y	97.7	Very high	96.5	Very high	73 Å²	73	65.2 Å²	65.2	29%	0.286	30%	0.298	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.7	133.1	166.6	168.5	-90.6	0	0	0	110	K31 E37 L38 L93 S95	Y29-K31 HydrophobicContact CE1-CB 4.01Å; Y29-E37 HydrophobicContact CE2-CB 3.9Å; Y29-E37 HydrophobicContact CE2-CG 4.01Å; Y29-E37 VanDerWaalsContact CE2-OE2 3.28Å; Y29-E37 WeakPolarHBondContact CE2-OE2 3.45Å; Y29-E37 VanDerWaalsContact OH-CG 3.27Å; Y29-E37 WeakPolarHBondContact OH-CG 3.47Å; Y29-E37 PolarHBondContact OH-OE2 2.74Å; Y29-L38 CarbonylContact C-O 3.57Å; Y29-L38 WeakPolarHBondContact CA-O 3.47Å; Y29-L93 HydrophobicContact CD1-CD2 4.03Å; Y29-L93 HydrophobicContact CE1-CD2 4.09Å; Y29-S95 PolarHBondContact N-O 3.37Å; Y29-S95 PolarHBondContact O-N 2.9Å
30	V	98.3	Very high	96.8	Very high	0 Å²	0	61.1 Å²	61.1	0%	0	28%	0.277	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.8	119.4	177.3	-172.6	0	0	0	0	109.7	I28 L32 E37 L38 M51 L53 V91 L93	I28-V30 HydrophobicContact CD1-CG2 3.56Å; I28-V30 HydrophobicContact CG1-CG2 4.08Å; V30-L32 HydrophobicContact CG1-CD2 3.85Å; V30-L32 HydrophobicContact CG1-CG 4.38Å; V30-E37 WeakPolarHBondContact O-CA 3.28Å; V30-L38 HydrophobicContact CB-CB 4.27Å; V30-L38 PolarHBondContact N-O 3.31Å; V30-L38 PolarHBondContact O-N 2.91Å; V30-M51 HydrophobicContact CG2-SD 4.24Å; V30-L53 HydrophobicContact CG2-CD1 4.3Å; V30-V91 HydrophobicContact CG1-CG1 4.1Å; V30-V91 HydrophobicContact CG1-CG2 4.23Å; V30-L93 WeakPolarHBondContact CA-O 3.39Å
31	K	98.3	Very high	96.9	Very high	46 Å²	46	62 Å²	62	20%	0.2	28%	0.281	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-88	124.7	168.7	-174.2	65.9	172.8	-177.7	0	108.9	Y29 E37 I92 L93	Y29-K31 HydrophobicContact CE1-CB 4.01Å; K31-E37 HydrophobicContact CD-CG 3.46Å; K31-E37 VanDerWaalsContact CD-CG 3.46Å; K31-E37 IonicContact NZ-OE1 3.89Å; K31-E37 PolarHBondContact NZ-OE1 3Å; K31-I92 HydrophobicContact CG-CB 4.38Å; K31-I92 HydrophobicContact CG-CD1 4.5Å; K31-I92 PolarHBondContact O-N 2.91Å; K31-L93 HydrophobicContact CB-CB 4.18Å; K31-L93 PolarHBondContact N-O 2.73Å; K31-L93 PolarHBondContact O-N 2.86Å
32	L	98.4	Very high	97.1	Very high	20 Å²	20	56.3 Å²	56.3	11%	0.105	26%	0.26	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107	163.8	173.6	-60.2	-179.2	0	0	0	110.8	V30 R36 L38 V86 G90 V91	V30-L32 HydrophobicContact CG1-CD2 3.85Å; V30-L32 HydrophobicContact CG1-CG 4.38Å; L32-R36 WeakPolarHBondContact CA-O 3.32Å; L32-R36 HydrophobicContact CB-CB 4.06Å; L32-R36 HydrophobicContact CB-CG 4.26Å; L32-R36 HydrophobicContact CD1-CG 4.06Å; L32-R36 PolarHBondContact N-O 3.37Å; L32-L38 HydrophobicContact CD1-CD1 3.62Å; L32-L38 HydrophobicContact CD1-CG 3.97Å; L32-L38 HydrophobicContact CG-CD1 4.33Å; L32-L38 HydrophobicContact CG-CG 4.49Å; L32-V86 HydrophobicContact CD1-CG1 4.24Å; L32-V86 HydrophobicContact CD2-CG1 3.87Å; L32-G90 CarbonylContact C-O 3.6Å; L32-G90 VanDerWaalsContact CA-O 3.22Å; L32-G90 WeakPolarHBondContact CA-O 3.16Å; L32-V91 HydrophobicContact CD2-CB 4.3Å; L32-V91 HydrophobicContact CD2-CG2 3.71Å
33	R	97.2	Very high	97.4	Very high	155 Å²	155	56.6 Å²	56.6	59%	0.585	26%	0.259	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.1	162.4	166.5	-67.4	-179.3	-177.2	176.2	2.8	111.6	G90 I92	R33-G90 PolarHBondContact N-O 2.86Å; R33-I92 HydrophobicContact CB-CD1 4.48Å; R33-I92 HydrophobicContact CG-CD1 3.93Å; R33-I92 HydrophobicContact CG-CG1 4Å
34	N	95.6	Very high	97.6	Very high	139 Å²	139	58.6 Å²	58.6	74%	0.743	28%	0.276	S	S	*	.	T	Hydrogen-bonded Turn	trans	61.2	45.6	176.7	-50.8	-34.3	0	0	0	113.1	R36	N34-R36 PolarHBondContact O-N 3.25Å; N34-R36 VanDerWaalsContact O-N 3.13Å
35	N	95.8	Very high	97.7	Very high	71 Å²	71	58.9 Å²	58.9	38%	0.38	27%	0.273	S	S	.	.	T	Hydrogen-bonded Turn	trans	53	36.9	174.5	-61.4	-34.3	0	0	0	114	V60 T61	N35-V60 WeakPolarHBondContact O-CA 3.43Å; N35-T61 WeakPolarHBondContact CB-O 3.46Å; N35-T61 PolarHBondContact O-N 3.07Å
36	R	97.8	Very high	97.7	Very high	93 Å²	93	56 Å²	56	35%	0.351	26%	0.258	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111	138.2	-177.9	178.9	179.3	-61.9	-154	13.9	111	L32 N34 E58 K59 V60	L32-R36 WeakPolarHBondContact CA-O 3.32Å; L32-R36 HydrophobicContact CB-CB 4.06Å; L32-R36 HydrophobicContact CB-CG 4.26Å; L32-R36 HydrophobicContact CD1-CG 4.06Å; L32-R36 PolarHBondContact N-O 3.37Å; N34-R36 PolarHBondContact O-N 3.25Å; N34-R36 VanDerWaalsContact O-N 3.13Å; R36-E58 WeakPolarHBondContact CD-OE1 3.3Å; R36-E58 HydrophobicContact CG-CG 4.18Å; R36-E58 IonicContact CZ-OE1 3.08Å; R36-E58 IonicContact NE-OE1 2.75Å; R36-E58 PolarHBondContact NE-OE1 2.78Å; R36-E58 IonicContact NH1-OE1 3.75Å; R36-E58 PolarHBondContact NH1-OE1 3.22Å; R36-K59 CarbonylContact C-O 3.49Å; R36-K59 WeakPolarHBondContact CA-O 3.16Å; R36-V60 HydrophobicContact CB-CG2 4.28Å; R36-V60 HydrophobicContact CG-CG2 4.02Å
37	E	98.3	Very high	97.7	Very high	39 Å²	39	59.1 Å²	59.1	18%	0.182	27%	0.272	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.6	136.4	-175.4	-67.6	173.6	-132.3	0	0	108.7	Y29 V30 K31 E58 K59	Y29-E37 HydrophobicContact CE2-CB 3.9Å; Y29-E37 HydrophobicContact CE2-CG 4.01Å; Y29-E37 VanDerWaalsContact CE2-OE2 3.28Å; Y29-E37 WeakPolarHBondContact CE2-OE2 3.45Å; Y29-E37 VanDerWaalsContact OH-CG 3.27Å; Y29-E37 WeakPolarHBondContact OH-CG 3.47Å; Y29-E37 PolarHBondContact OH-OE2 2.74Å; V30-E37 WeakPolarHBondContact O-CA 3.28Å; K31-E37 HydrophobicContact CD-CG 3.46Å; K31-E37 VanDerWaalsContact CD-CG 3.46Å; K31-E37 IonicContact NZ-OE1 3.89Å; K31-E37 PolarHBondContact NZ-OE1 3Å; E37-E58 WeakPolarHBondContact O-CA 3.43Å; E37-K59 HydrophobicContact CB-CB 4.29Å; E37-K59 PolarHBondContact N-O 3.21Å; E37-K59 PolarHBondContact O-N 3.19Å
38	L	98.5	Very high	97.7	Very high	1 Å²	1	62 Å²	62	1%	0.005	29%	0.289	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.7	138.1	178.2	-53.5	178.4	0	0	0	109.4	Y29 V30 L32 L53 V56 E57 E58 L84 V86	Y29-L38 CarbonylContact C-O 3.57Å; Y29-L38 WeakPolarHBondContact CA-O 3.47Å; V30-L38 HydrophobicContact CB-CB 4.27Å; V30-L38 PolarHBondContact N-O 3.31Å; V30-L38 PolarHBondContact O-N 2.91Å; L32-L38 HydrophobicContact CD1-CD1 3.62Å; L32-L38 HydrophobicContact CD1-CG 3.97Å; L32-L38 HydrophobicContact CG-CD1 4.33Å; L32-L38 HydrophobicContact CG-CG 4.49Å; L38-L53 HydrophobicContact CB-CD1 4.23Å; L38-L53 HydrophobicContact CD1-CD1 3.99Å; L38-V56 HydrophobicContact CB-CG1 3.99Å; L38-V56 HydrophobicContact CD2-CG1 3.93Å; L38-V56 HydrophobicContact CG-CG1 4.44Å; L38-E57 WeakPolarHBondContact CA-O 3.09Å; L38-E58 HydrophobicContact CD2-CB 3.67Å; L38-E58 HydrophobicContact CD2-CG 3.56Å; L38-L84 HydrophobicContact CD1-CD2 3.79Å; L38-L84 HydrophobicContact CD2-CD2 3.96Å; L38-V86 HydrophobicContact CD1-CG1 4.35Å; L38-V86 HydrophobicContact CD1-CG2 3.49Å; L38-V86 VanDerWaalsContact CD1-CG2 3.49Å
39	Y	97.7	Very high	97.7	Very high	78 Å²	78	64.2 Å²	64.2	31%	0.306	30%	0.301	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.5	109.5	169.8	-173.2	-122	0	0	0	109.6	R27 I28 V56 E57	R27-Y39 HydrophobicContact CB-CE2 4.42Å; R27-Y39 VanDerWaalsContact CD-CZ 3.45Å; R27-Y39 HydrophobicContact CG-CD1 4.34Å; R27-Y39 HydrophobicContact CG-CD2 4.22Å; R27-Y39 HydrophobicContact CG-CE1 3.91Å; R27-Y39 HydrophobicContact CG-CE2 3.76Å; R27-Y39 HydrophobicContact CG-CG 4.48Å; R27-Y39 VanDerWaalsContact NH2-CD1 3.31Å; I28-Y39 WeakPolarHBondContact O-CA 3.47Å; I28-Y39 VanDerWaalsContact O-CD2 3.28Å; I28-Y39 WeakPolarHBondContact O-CD2 3.49Å; Y39-V56 WeakPolarHBondContact O-CA 3.15Å; Y39-E57 PolarHBondContact N-O 2.82Å; Y39-E57 PolarHBondContact O-N 3.08Å
40	G	98.2	Very high	97.7	Very high	0 Å²	0	62.3 Å²	62.3	0%	0	30%	0.295	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-164.2	171.5	-170	0	0	0	0	0	112.9	R27 I28	R27-G40 CarbonylContact C-O 3.59Å; R27-G40 WeakPolarHBondContact CA-O 3.14Å; I28-G40 PolarHBondContact N-O 2.97Å; I28-G40 PolarHBondContact O-N 3.31Å; I28-G40 VanDerWaalsContact O-N 3.14Å
41	V	98	Very high	97.7	Very high	30 Å²	30	62.4 Å²	62.4	18%	0.182	30%	0.296	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.1	125	-178.8	-179.9	0	0	0	0	109.9	E26 H43 L53 S54	E26-V41 WeakPolarHBondContact O-CA 3.34Å; V41-H43 PolarHBondContact O-CD2 2.82Å; V41-L53 CarbonylContact O-C 3.54Å; V41-L53 WeakPolarHBondContact O-CA 3.42Å; V41-S54 PolarHBondContact N-O 3.33Å; V41-S54 PolarHBondContact O-N 3.34Å
42	L	98.5	Very high	97.7	Very high	0 Å²	0	63 Å²	63	0%	0	30%	0.3	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.4	116.3	178	179.5	65.2	0	0	0	111.4	V20 L24 N25 E26 I28 A44 Y45 M51 L53	V20-L42 HydrophobicContact CG1-CD2 3.9Å; L24-L42 HydrophobicContact CD2-CD2 4.36Å; L24-L42 HydrophobicContact CD2-CG 4.25Å; N25-L42 WeakPolarHBondContact CA-O 3.48Å; N25-L42 PolarHBondContact N-O 2.89Å; E26-L42 PolarHBondContact O-N 3.25Å; I28-L42 HydrophobicContact CD1-CB 3.8Å; I28-L42 HydrophobicContact CD1-CD1 4.18Å; I28-L42 HydrophobicContact CD1-CD2 4.14Å; I28-L42 HydrophobicContact CD1-CG 4.24Å; I28-L42 HydrophobicContact CG1-CB 4.07Å; I28-L42 HydrophobicContact CG2-CB 4.45Å; L42-A44 WeakPolarHBondContact CD1-O 3.5Å; L42-Y45 HydrophobicContact CD2-CD1 4.48Å; L42-M51 HydrophobicContact CD1-CB 3.9Å; L42-M51 HydrophobicContact CD1-CG 3.96Å; L42-M51 HydrophobicContact CD1-SD 3.97Å; L42-L53 HydrophobicContact CB-CD2 4.09Å; L42-L53 HydrophobicContact CD1-CD2 3.66Å
43	H	98.4	Very high	97.8	Very high	83 Å²	83	62 Å²	62	38%	0.384	30%	0.295	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.9	-40	177.8	-73.8	-83.6	0	0	0	113.5	L24 V41 I52 S54	L24-H43 WeakPolarHBondContact CD2-O 3.43Å; V41-H43 PolarHBondContact O-CD2 2.82Å; H43-I52 HydrophobicContact CB-CB 4.26Å; H43-I52 HydrophobicContact CB-CG2 4.1Å; H43-I52 PolarHBondContact N-O 3.5Å; H43-S54 WeakPolarHBondContact NE2-CB 3.22Å; H43-S54 PolarHBondContact NE2-OG 2.92Å
44	A	98.5	Very high	97.8	Very high	44 Å²	44	55.4 Å²	55.4	36%	0.364	27%	0.273	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-154.7	152.7	-175.8	0	0	0	0	0	110.2	L42 M51 I52	L42-A44 WeakPolarHBondContact CD1-O 3.5Å; A44-M51 WeakPolarHBondContact O-CA 3.21Å; A44-I52 HydrophobicContact CB-CB 4.29Å; A44-I52 HydrophobicContact CB-CG1 4.25Å; A44-I52 PolarHBondContact O-N 2.87Å
45	Y	98	Very high	98	Very high	65 Å²	65	53.7 Å²	53.7	26%	0.255	26%	0.264	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-148.5	168.1	171.7	73.9	-75.5	0	0	0	111.3	V20 R21 L24 L42 N50	V20-Y45 HydrophobicContact CB-CD2 4.43Å; V20-Y45 HydrophobicContact CB-CE2 4.27Å; V20-Y45 HydrophobicContact CG1-CD1 3.95Å; V20-Y45 HydrophobicContact CG1-CD2 3.77Å; V20-Y45 HydrophobicContact CG1-CE1 4.24Å; V20-Y45 HydrophobicContact CG1-CE2 4.05Å; V20-Y45 HydrophobicContact CG1-CG 3.73Å; R21-Y45 WeakPolarHBondContact CA-OH 3.28Å; R21-Y45 HydrophobicContact CB-CE1 4.4Å; R21-Y45 WeakPolarHBondContact CB-OH 3.48Å; L24-Y45 HydrophobicContact CD1-CE1 4.18Å; L24-Y45 HydrophobicContact CD2-CD1 3.98Å; L24-Y45 HydrophobicContact CD2-CE1 4.22Å; L24-Y45 HydrophobicContact CG-CD1 4.39Å; L24-Y45 HydrophobicContact CG-CE1 4.16Å; L42-Y45 HydrophobicContact CD2-CD1 4.48Å; Y45-N50 WeakPolarHBondContact CA-O 3.46Å
46	D	97.4	Very high	98.1	Very high	61 Å²	61	50.3 Å²	50.3	33%	0.326	25%	0.246	S	C	.	.			trans	-129.7	-179.6	171.9	68.6	19.1	0	0	0	112.2	H48 L49 N50	D46-H48 PolarHBondContact O-N 2.96Å; D46-H48 WeakPolarHBondContact OD1-CA 3.37Å; D46-H48 WeakPolarHBondContact OD1-CB 3.22Å; D46-H48 PolarHBondContact OD1-N 2.81Å; D46-L49 PolarHBondContact O-N 3.32Å; D46-L49 PolarHBondContact OD1-N 3.24Å; D46-L49 VanDerWaalsContact OD1-N 3.13Å; D46-N50 PolarHBondContact N-O 2.76Å; D46-N50 PolarHBondContact OD1-N 2.81Å; D46-N50 PolarHBondContact OD1-ND2 3.38Å; D46-N50 WeakPolarHBondContact OD2-CB 3.39Å; D46-N50 PolarHBondContact OD2-ND2 2.91Å
47	Q	96.5	Very high	98.1	Very high	164 Å²	164	50.7 Å²	50.7	77%	0.766	25%	0.251	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62.7	-21	179.7	-172.3	179.4	-15	0	0	113.4	L17 L49	L17-Q47 HydrophobicContact CD1-CG 4.37Å; Q47-L49 VanDerWaalsContact C-N 3.28Å
48	H	96.6	Very high	98.1	Very high	140 Å²	140	49.3 Å²	49.3	65%	0.648	25%	0.245	S	C	*	.	T	Hydrogen-bonded Turn	trans	-86.9	0.4	175.3	-61.6	-61.9	0	0	0	112.6	D46 N50 G88	D46-H48 PolarHBondContact O-N 2.96Å; D46-H48 WeakPolarHBondContact OD1-CA 3.37Å; D46-H48 WeakPolarHBondContact OD1-CB 3.22Å; D46-H48 PolarHBondContact OD1-N 2.81Å; H48-N50 PolarHBondContact O-N 2.87Å; H48-G88 VanDerWaalsContact O-CA 3.3Å; H48-G88 WeakPolarHBondContact O-CA 3.39Å
49	L	97.5	Very high	98.1	Very high	47 Å²	47	51.9 Å²	51.9	25%	0.246	26%	0.256	C	S	.	.			trans	59.9	28.5	-171.5	-59.4	173.4	0	0	0	113.1	L17 V20 D46 Q47 M51 G88 V91	L17-L49 HydrophobicContact CD2-CD2 3.68Å; L17-L49 HydrophobicContact CD2-CG 4.46Å; V20-L49 HydrophobicContact CG2-CD2 4.17Å; D46-L49 PolarHBondContact O-N 3.32Å; D46-L49 PolarHBondContact OD1-N 3.24Å; D46-L49 VanDerWaalsContact OD1-N 3.13Å; Q47-L49 VanDerWaalsContact C-N 3.28Å; L49-M51 HydrophobicContact CB-CE 4.22Å; L49-M51 HydrophobicContact CD2-CE 4.03Å; L49-G88 VanDerWaalsContact C-CA 3.47Å; L49-G88 WeakPolarHBondContact O-CA 3.41Å; L49-V91 HydrophobicContact CD1-CG1 4.5Å
50	N	98.5	Very high	98.1	Very high	32 Å²	32	49.5 Å²	49.5	17%	0.171	25%	0.25	C	C	.	.			trans	-64.3	141.1	158.5	-58.7	-53.7	0	0	0	107.8	Y45 D46 H48 F85 V86 R87 G88	Y45-N50 WeakPolarHBondContact CA-O 3.46Å; D46-N50 PolarHBondContact N-O 2.76Å; D46-N50 PolarHBondContact OD1-N 2.81Å; D46-N50 PolarHBondContact OD1-ND2 3.38Å; D46-N50 WeakPolarHBondContact OD2-CB 3.39Å; D46-N50 PolarHBondContact OD2-ND2 2.91Å; H48-N50 PolarHBondContact O-N 2.87Å; N50-F85 HydrophobicContact CB-CE2 4.03Å; N50-F85 HydrophobicContact CB-CZ 4.11Å; N50-V86 CarbonylContact C-O 3.45Å; N50-V86 VanDerWaalsContact CA-O 3.28Å; N50-V86 WeakPolarHBondContact CA-O 3.28Å; N50-R87 WeakPolarHBondContact OD1-CA 3.37Å; N50-G88 PolarHBondContact OD1-N 2.9Å
51	M	98.6	Very high	98	Very high	2 Å²	2	50.6 Å²	50.6	1%	0.01	26%	0.256	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.6	148.2	-175.4	-58.3	-178.7	177.5	0	0	112.1	V20 I28 V30 L42 A44 L49 L53 F85 V86 V94	V20-M51 HydrophobicContact CG1-CE 4.26Å; I28-M51 HydrophobicContact CD1-SD 4.15Å; V30-M51 HydrophobicContact CG2-SD 4.24Å; L42-M51 HydrophobicContact CD1-CB 3.9Å; L42-M51 HydrophobicContact CD1-CG 3.96Å; L42-M51 HydrophobicContact CD1-SD 3.97Å; A44-M51 WeakPolarHBondContact O-CA 3.21Å; L49-M51 HydrophobicContact CB-CE 4.22Å; L49-M51 HydrophobicContact CD2-CE 4.03Å; M51-L53 HydrophobicContact CB-CD2 4.18Å; M51-L53 HydrophobicContact CB-CG 4.38Å; M51-F85 WeakPolarHBondContact O-CA 3.11Å; M51-V86 HydrophobicContact CB-CB 4.21Å; M51-V86 PolarHBondContact N-O 2.98Å; M51-V86 PolarHBondContact O-N 3.14Å; M51-V94 HydrophobicContact CE-CG1 4.33Å; M51-V94 HydrophobicContact CE-CG2 3.43Å; M51-V94 VanDerWaalsContact CE-CG2 3.43Å; M51-V94 HydrophobicContact SD-CG2 4.47Å
52	I	98.7	Very high	97.8	Very high	58 Å²	58	51.6 Å²	51.6	30%	0.297	26%	0.26	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.7	115.9	163.5	-58	-64.3	0	0	0	107.4	H43 A44 L83 F85	H43-I52 HydrophobicContact CB-CB 4.26Å; H43-I52 HydrophobicContact CB-CG2 4.1Å; H43-I52 PolarHBondContact N-O 3.5Å; A44-I52 HydrophobicContact CB-CB 4.29Å; A44-I52 HydrophobicContact CB-CG1 4.25Å; A44-I52 PolarHBondContact O-N 2.87Å; I52-L83 HydrophobicContact CG2-CD1 3.73Å; I52-F85 HydrophobicContact CD1-CB 4.2Å; I52-F85 HydrophobicContact CD1-CD2 3.72Å; I52-F85 HydrophobicContact CD1-CG 4.46Å
53	L	98.8	Very high	97.6	Very high	0 Å²	0	55.2 Å²	55.2	0%	0	28%	0.279	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.1	143.5	176.5	-54.9	-175.7	0	0	0	110.5	I28 V30 L38 V41 L42 M51 V56 L83 L84 V86	I28-L53 HydrophobicContact CD1-CD2 4Å; I28-L53 HydrophobicContact CG1-CD2 4.31Å; V30-L53 HydrophobicContact CG2-CD1 4.3Å; L38-L53 HydrophobicContact CB-CD1 4.23Å; L38-L53 HydrophobicContact CD1-CD1 3.99Å; V41-L53 CarbonylContact O-C 3.54Å; V41-L53 WeakPolarHBondContact O-CA 3.42Å; L42-L53 HydrophobicContact CB-CD2 4.09Å; L42-L53 HydrophobicContact CD1-CD2 3.66Å; M51-L53 HydrophobicContact CB-CD2 4.18Å; M51-L53 HydrophobicContact CB-CG 4.38Å; L53-V56 HydrophobicContact CB-CG2 3.44Å; L53-V56 VanDerWaalsContact CB-CG2 3.44Å; L53-L83 CarbonylContact O-C 3.54Å; L53-L83 WeakPolarHBondContact O-CA 3.33Å; L53-L84 PolarHBondContact N-O 2.84Å; L53-L84 PolarHBondContact O-N 3.13Å; L53-V86 HydrophobicContact CD1-CG2 3.89Å; L53-V86 HydrophobicContact CG-CG2 4.12Å
54	S	98.6	Very high	97.3	Very high	16 Å²	16	56.3 Å²	56.3	11%	0.112	28%	0.284	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.6	164.5	168.8	84.4	0	0	0	0	112.4	V41 H43 V56 E82	V41-S54 PolarHBondContact N-O 3.33Å; V41-S54 PolarHBondContact O-N 3.34Å; H43-S54 WeakPolarHBondContact NE2-CB 3.22Å; H43-S54 PolarHBondContact NE2-OG 2.92Å; S54-V56 PolarHBondContact O-N 2.99Å; S54-E82 CarbonylContact C-O 3.5Å; S54-E82 WeakPolarHBondContact CA-O 3.38Å; S54-E82 VanDerWaalsContact CB-O 3.28Å; S54-E82 WeakPolarHBondContact CB-O 3.5Å
55	N	98.3	Very high	96.9	Very high	103 Å²	103	58.2 Å²	58.2	55%	0.551	29%	0.291	S	S	*	.	E	Extended strand (participates in β ladder)	trans	49.8	46.1	-179.9	-59.5	-37	0	0	0	111.6	E82	N55-E82 PolarHBondContact N-O 2.67Å
56	V	98.5	Very high	96.6	Very high	0 Å²	0	57.7 Å²	57.7	0%	0	29%	0.293	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.7	125.3	-169.7	-173.3	0	0	0	0	109.9	L38 Y39 L53 S54 S80 V81 L84	L38-V56 HydrophobicContact CB-CG1 3.99Å; L38-V56 HydrophobicContact CD2-CG1 3.93Å; L38-V56 HydrophobicContact CG-CG1 4.44Å; Y39-V56 WeakPolarHBondContact O-CA 3.15Å; L53-V56 HydrophobicContact CB-CG2 3.44Å; L53-V56 VanDerWaalsContact CB-CG2 3.44Å; S54-V56 PolarHBondContact O-N 2.99Å; V56-S80 CarbonylContact O-C 3.58Å; V56-S80 VanDerWaalsContact O-CA 3.27Å; V56-S80 WeakPolarHBondContact O-CA 3.45Å; V56-V81 HydrophobicContact CB-CB 4.35Å; V56-V81 PolarHBondContact N-O 2.72Å; V56-V81 PolarHBondContact O-N 2.88Å; V56-L84 HydrophobicContact CG1-CD2 4.05Å; V56-L84 HydrophobicContact CG2-CB 3.99Å; V56-L84 HydrophobicContact CG2-CD2 4.45Å
57	E	98.3	Very high	96.4	Very high	101 Å²	101	63.2 Å²	63.2	47%	0.472	32%	0.316	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.7	114	160.1	-69.8	169.8	-146	0	0	107.9	R27 L38 Y39	R27-E57 IonicContact CZ-OE1 3.4Å; R27-E57 IonicContact NH1-OE1 2.74Å; R27-E57 VanDerWaalsContact NH2-CD 3.28Å; R27-E57 IonicContact NH2-OE1 3.19Å; R27-E57 PolarHBondContact NH2-OE1 2.88Å; L38-E57 WeakPolarHBondContact CA-O 3.09Å; Y39-E57 PolarHBondContact N-O 2.82Å; Y39-E57 PolarHBondContact O-N 3.08Å
58	E	98.4	Very high	96.2	Very high	11 Å²	11	64.1 Å²	64.1	5%	0.051	32%	0.32	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.3	132.7	173.4	-179.3	-178.3	-119.9	0	0	109.7	R36 E37 L38 V60 R78 R79	R36-E58 WeakPolarHBondContact CD-OE1 3.3Å; R36-E58 HydrophobicContact CG-CG 4.18Å; R36-E58 IonicContact CZ-OE1 3.08Å; R36-E58 IonicContact NE-OE1 2.75Å; R36-E58 PolarHBondContact NE-OE1 2.78Å; R36-E58 IonicContact NH1-OE1 3.75Å; R36-E58 PolarHBondContact NH1-OE1 3.22Å; E37-E58 WeakPolarHBondContact O-CA 3.43Å; L38-E58 HydrophobicContact CD2-CB 3.67Å; L38-E58 HydrophobicContact CD2-CG 3.56Å; E58-V60 HydrophobicContact CG-CG2 4.09Å; E58-R78 VanDerWaalsContact O-CA 3.27Å; E58-R78 WeakPolarHBondContact O-CA 3.27Å; E58-R79 HydrophobicContact CB-CG 4.2Å; E58-R79 PolarHBondContact N-O 2.76Å; E58-R79 PolarHBondContact O-N 2.92Å; E58-R79 IonicContact OE1-NH2 2.72Å; E58-R79 IonicContact OE2-CZ 2.73Å; E58-R79 IonicContact OE2-NE 3.64Å; E58-R79 PolarHBondContact OE2-NE 2.86Å; E58-R79 IonicContact OE2-NH2 2.63Å; E58-R79 PolarHBondContact OE2-NH2 3.25Å
59	K	98.1	Very high	96.1	Very high	55 Å²	55	60.9 Å²	60.9	24%	0.239	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.5	130.2	170.6	176.3	-173.3	176.5	177.1	0	109.2	R36 E37 E76 R77	R36-K59 CarbonylContact C-O 3.49Å; R36-K59 WeakPolarHBondContact CA-O 3.16Å; E37-K59 HydrophobicContact CB-CB 4.29Å; E37-K59 PolarHBondContact N-O 3.21Å; E37-K59 PolarHBondContact O-N 3.19Å; K59-E76 WeakPolarHBondContact CE-OE1 3.44Å; K59-E76 WeakPolarHBondContact CE-OE2 3.11Å; K59-E76 IonicContact NZ-OE1 2.66Å; K59-E76 PolarHBondContact NZ-OE1 2.63Å; K59-E76 IonicContact NZ-OE2 3.61Å; K59-R77 WeakPolarHBondContact CA-O 3.43Å
60	V	97.6	Very high	95.7	Very high	28 Å²	28	67.6 Å²	67.6	17%	0.17	33%	0.334	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.1	122.4	172.3	-175.8	0	0	0	0	108.6	N35 R36 E58 I62 R77	N35-V60 WeakPolarHBondContact O-CA 3.43Å; R36-V60 HydrophobicContact CB-CG2 4.28Å; R36-V60 HydrophobicContact CG-CG2 4.02Å; E58-V60 HydrophobicContact CG-CG2 4.09Å; V60-I62 HydrophobicContact CG1-CG1 4.45Å; V60-R77 PolarHBondContact N-O 3.06Å; V60-R77 PolarHBondContact O-N 3.13Å
61	T	96.4	Very high	95.5	Very high	23 Å²	23	72 Å²	72	14%	0.141	35%	0.353	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.3	118.5	174	-57.1	0	0	0	0	109.6	N35 F74	N35-T61 WeakPolarHBondContact CB-O 3.46Å; N35-T61 PolarHBondContact O-N 3.07Å; T61-F74 HydrophobicContact CG2-CD1 4.13Å
62	I	94.3	Very high	95.2	Very high	51 Å²	51	77.6 Å²	77.6	26%	0.262	38%	0.38	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98	129.5	175.5	-54.7	173.3	0	0	0	107	V60 E64 T75 R77	V60-I62 HydrophobicContact CG1-CG1 4.45Å; I62-E64 HydrophobicContact CG2-CG 4.03Å; I62-T75 PolarHBondContact N-O 2.73Å; I62-T75 PolarHBondContact O-N 3.4Å; I62-R77 HydrophobicContact CD1-CG 4.3Å
63	I	92.8	Very high	94.9	Very high	75 Å²	75	79 Å²	79	39%	0.385	39%	0.387	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.6	116.6	176.5	-52.3	175.8	0	0	0	106.2	E72 L73 F74	I63-E72 HydrophobicContact CG2-CB 4.3Å; I63-E72 HydrophobicContact CG2-CG 4.44Å; I63-L73 WeakPolarHBondContact CA-O 3.4Å; I63-F74 HydrophobicContact CD1-CD1 4.24Å; I63-F74 HydrophobicContact CD1-CE1 3.71Å; I63-F74 HydrophobicContact CG1-CD1 3.76Å; I63-F74 HydrophobicContact CG1-CE1 3.7Å; I63-F74 HydrophobicContact CG2-CE1 4.16Å; I63-F74 HydrophobicContact CG2-CZ 4.42Å
64	E	91.9	Very high	94.6	Very high	107 Å²	107	84.9 Å²	84.9	50%	0.5	41%	0.413	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.1	140.2	174.5	-66.2	176.5	171.7	0	0	107.5	I62 E72 L73	I62-E64 HydrophobicContact CG2-CG 4.03Å; E64-E72 CarbonylContact O-C 3.6Å; E64-L73 HydrophobicContact CB-CB 4.47Å; E64-L73 PolarHBondContact N-O 2.78Å; E64-L73 PolarHBondContact O-N 2.75Å
65	V	92	Very high	94.4	Very high	83 Å²	83	87 Å²	87	50%	0.503	43%	0.426	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.5	126	175.4	-177.5	0	0	0	0	107.1	E67 E71 E72	V65-E67 PolarHBondContact O-N 2.75Å; V65-E71 WeakPolarHBondContact CA-O 3.28Å; V65-E72 HydrophobicContact CG2-CG 4.38Å
66	D	90.6	Very high	94.3	Very high	55 Å²	55	86.3 Å²	86.3	29%	0.294	42%	0.419	S	S	.	.			trans	-67.5	121.4	171.3	-172	-65.1	0	0	0	109.2	E68 T69 Y70 E71	D66-E68 VanDerWaalsContact C-N 3.26Å; D66-E68 PolarHBondContact O-N 3.03Å; D66-E68 WeakPolarHBondContact OD1-CA 3.41Å; D66-E68 WeakPolarHBondContact OD1-CB 3.42Å; D66-E68 PolarHBondContact OD1-N 2.82Å; D66-T69 WeakPolarHBondContact CB-OG1 3.47Å; D66-T69 PolarHBondContact OD1-N 2.88Å; D66-T69 PolarHBondContact OD1-OG1 2.85Å; D66-Y70 WeakPolarHBondContact O-CA 3.17Å; D66-Y70 PolarHBondContact O-N 2.84Å; D66-E71 PolarHBondContact N-O 2.84Å
67	E	92.6	Very high	94.2	Very high	176 Å²	176	94.2 Å²	94.2	82%	0.822	45%	0.449	S	S	*	.	T	Hydrogen-bonded Turn	trans	-70.6	-21.8	-175.5	-63.8	-174.3	169.9	0	0	113.1	V65	V65-E67 PolarHBondContact O-N 2.75Å
68	E	93.6	Very high	94.2	Very high	183 Å²	183	98.2 Å²	98.2	86%	0.855	46%	0.459	S	S	*	.	T	Hydrogen-bonded Turn	trans	-91.1	-42.3	-178	-60.9	-172.6	174.9	0	0	111.5	D66	D66-E68 VanDerWaalsContact C-N 3.26Å; D66-E68 PolarHBondContact O-N 3.03Å; D66-E68 WeakPolarHBondContact OD1-CA 3.41Å; D66-E68 WeakPolarHBondContact OD1-CB 3.42Å; D66-E68 PolarHBondContact OD1-N 2.82Å
69	T	93.5	Very high	94.1	Very high	72 Å²	72	104.3 Å²	104.3	44%	0.442	48%	0.482	S	S	.	.	T	Hydrogen-bonded Turn	trans	-98.9	-13.9	-176.8	70.5	0	0	0	0	114	D66 E71	D66-T69 WeakPolarHBondContact CB-OG1 3.47Å; D66-T69 PolarHBondContact OD1-N 2.88Å; D66-T69 PolarHBondContact OD1-OG1 2.85Å; T69-E71 PolarHBondContact O-N 2.82Å; T69-E71 WeakPolarHBondContact OG1-CB 3.27Å; T69-E71 WeakPolarHBondContact OG1-CG 3.27Å; T69-E71 PolarHBondContact OG1-N 2.88Å
70	Y	89.8	Confident	94.2	Very high	189 Å²	189	106.7 Å²	106.7	74%	0.741	51%	0.506	S	S	*	.			trans	58.4	20.4	-171.1	-59.9	-87.7	0	0	0	114.1	D66	D66-Y70 WeakPolarHBondContact O-CA 3.17Å; D66-Y70 PolarHBondContact O-N 2.84Å
71	E	94.1	Very high	94.2	Very high	123 Å²	123	106.9 Å²	106.9	58%	0.575	51%	0.507	S	S	*	.	P	Polyproline II helix	trans	-81.8	142.1	176.2	-66.5	179.7	157.8	0	0	111	V65 D66 T69	V65-E71 WeakPolarHBondContact CA-O 3.28Å; D66-E71 PolarHBondContact N-O 2.84Å; T69-E71 PolarHBondContact O-N 2.82Å; T69-E71 WeakPolarHBondContact OG1-CB 3.27Å; T69-E71 WeakPolarHBondContact OG1-CG 3.27Å; T69-E71 PolarHBondContact OG1-N 2.88Å
72	E	92.8	Very high	94.3	Very high	121 Å²	121	113.5 Å²	113.5	57%	0.565	54%	0.536	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-86	118.6	173.7	-66.2	-174.6	163.4	0	0	110.6	I63 E64 V65 F74	I63-E72 HydrophobicContact CG2-CB 4.3Å; I63-E72 HydrophobicContact CG2-CG 4.44Å; E64-E72 CarbonylContact O-C 3.6Å; V65-E72 HydrophobicContact CG2-CG 4.38Å; E72-F74 HydrophobicContact CB-CE2 3.7Å; E72-F74 HydrophobicContact CB-CZ 4.03Å; E72-F74 WeakPolarHBondContact OE2-CZ 3.38Å
73	L	92.2	Very high	94.5	Very high	86 Å²	86	116.6 Å²	116.6	45%	0.45	55%	0.553	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-97.5	121.4	173.8	-62.5	176.4	0	0	0	110.1	I63 E64	I63-L73 WeakPolarHBondContact CA-O 3.4Å; E64-L73 HydrophobicContact CB-CB 4.47Å; E64-L73 PolarHBondContact N-O 2.78Å; E64-L73 PolarHBondContact O-N 2.75Å
74	F	92.8	Very high	94.8	Very high	124 Å²	124	114.7 Å²	114.7	54%	0.544	54%	0.543	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.9	114.6	179.1	-62.8	-94.5	0	0	0	110.4	T61 I63 E72	T61-F74 HydrophobicContact CG2-CD1 4.13Å; I63-F74 HydrophobicContact CD1-CD1 4.24Å; I63-F74 HydrophobicContact CD1-CE1 3.71Å; I63-F74 HydrophobicContact CG1-CD1 3.76Å; I63-F74 HydrophobicContact CG1-CE1 3.7Å; I63-F74 HydrophobicContact CG2-CE1 4.16Å; I63-F74 HydrophobicContact CG2-CZ 4.42Å; E72-F74 HydrophobicContact CB-CE2 3.7Å; E72-F74 HydrophobicContact CB-CZ 4.03Å; E72-F74 WeakPolarHBondContact OE2-CZ 3.38Å
75	T	94.6	Very high	95.1	Very high	61 Å²	61	115.7 Å²	115.7	37%	0.374	55%	0.546	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.5	122.6	173.5	-63.2	0	0	0	0	110.5	I62	I62-T75 PolarHBondContact N-O 2.73Å; I62-T75 PolarHBondContact O-N 3.4Å
76	E	95.3	Very high	95.4	Very high	88 Å²	88	112 Å²	112	41%	0.411	52%	0.524	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.7	129.3	172.7	-62.7	-166.7	163.2	0	0	111.2	K59 R78	K59-E76 WeakPolarHBondContact CE-OE1 3.44Å; K59-E76 WeakPolarHBondContact CE-OE2 3.11Å; K59-E76 IonicContact NZ-OE1 2.66Å; K59-E76 PolarHBondContact NZ-OE1 2.63Å; K59-E76 IonicContact NZ-OE2 3.61Å; E76-R78 IonicContact OE2-CZ 3.59Å; E76-R78 IonicContact OE2-NE 3.46Å; E76-R78 PolarHBondContact OE2-NE 2.87Å; E76-R78 IonicContact OE2-NH2 2.82Å; E76-R78 PolarHBondContact OE2-NH2 2.8Å
77	R	96.7	Very high	95.7	Very high	166 Å²	166	116.7 Å²	116.7	63%	0.626	54%	0.537	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-109.8	132	166.7	-65.5	-169.3	179.3	178.3	2.6	109.7	K59 V60 I62	K59-R77 WeakPolarHBondContact CA-O 3.43Å; V60-R77 PolarHBondContact N-O 3.06Å; V60-R77 PolarHBondContact O-N 3.13Å; I62-R77 HydrophobicContact CD1-CG 4.3Å
78	R	97.6	Very high	96	Very high	185 Å²	185	108.8 Å²	108.8	70%	0.698	50%	0.503	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-123.6	141.6	178.1	-60.3	-176.6	-172.7	-161.1	2	110.5	E58 E76	E58-R78 VanDerWaalsContact O-CA 3.27Å; E58-R78 WeakPolarHBondContact O-CA 3.27Å; E76-R78 IonicContact OE2-CZ 3.59Å; E76-R78 IonicContact OE2-NE 3.46Å; E76-R78 PolarHBondContact OE2-NE 2.87Å; E76-R78 IonicContact OE2-NH2 2.82Å; E76-R78 PolarHBondContact OE2-NH2 2.8Å
79	R	97.7	Very high	96.2	Very high	139 Å²	139	104.1 Å²	104.1	53%	0.525	48%	0.484	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.2	156	170	63.5	175.5	177.3	170.7	1.6	111.3	E58 V81	E58-R79 HydrophobicContact CB-CG 4.2Å; E58-R79 PolarHBondContact N-O 2.76Å; E58-R79 PolarHBondContact O-N 2.92Å; E58-R79 IonicContact OE1-NH2 2.72Å; E58-R79 IonicContact OE2-CZ 2.73Å; E58-R79 IonicContact OE2-NE 3.64Å; E58-R79 PolarHBondContact OE2-NE 2.86Å; E58-R79 IonicContact OE2-NH2 2.63Å; E58-R79 PolarHBondContact OE2-NH2 3.25Å; R79-V81 HydrophobicContact CG-CG2 4.34Å
80	S	98.5	Very high	96.4	Very high	105 Å²	105	101.5 Å²	101.5	73%	0.734	47%	0.471	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-99	137.8	171.2	-55	0	0	0	0	110	V56	V56-S80 CarbonylContact O-C 3.58Å; V56-S80 VanDerWaalsContact O-CA 3.27Å; V56-S80 WeakPolarHBondContact O-CA 3.45Å
81	V	98.3	Very high	96.8	Very high	32 Å²	32	93.7 Å²	93.7	19%	0.194	44%	0.443	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.2	123.3	176.9	-174.4	0	0	0	0	108.2	V56 R79 L83 L84	V56-V81 HydrophobicContact CB-CB 4.35Å; V56-V81 PolarHBondContact N-O 2.72Å; V56-V81 PolarHBondContact O-N 2.88Å; R79-V81 HydrophobicContact CG-CG2 4.34Å; V81-L83 WeakPolarHBondContact CG1-O 2.92Å; V81-L84 HydrophobicContact CG1-CB 4.14Å; V81-L84 HydrophobicContact CG1-CD1 4.44Å
82	E	98.4	Very high	97	Very high	163 Å²	163	93 Å²	93	76%	0.762	44%	0.442	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-64.5	-45.1	-175.9	-176.3	179.4	178.1	0	0	112.3	S54 N55	S54-E82 CarbonylContact C-O 3.5Å; S54-E82 WeakPolarHBondContact CA-O 3.38Å; S54-E82 VanDerWaalsContact CB-O 3.28Å; S54-E82 WeakPolarHBondContact CB-O 3.5Å; N55-E82 PolarHBondContact N-O 2.67Å
83	L	98.5	Very high	97.1	Very high	115 Å²	115	91.4 Å²	91.4	60%	0.602	44%	0.437	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-142	130.3	178.9	-172.1	70.5	0	0	0	109.5	I52 L53 V81	I52-L83 HydrophobicContact CG2-CD1 3.73Å; L53-L83 CarbonylContact O-C 3.54Å; L53-L83 WeakPolarHBondContact O-CA 3.33Å; V81-L83 WeakPolarHBondContact CG1-O 2.92Å
84	L	98.4	Very high	97.3	Very high	36 Å²	36	88.9 Å²	88.9	19%	0.188	43%	0.425	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.3	126	-174.5	-176.8	65.3	0	0	0	110.5	L38 L53 V56 V81 V86	L38-L84 HydrophobicContact CD1-CD2 3.79Å; L38-L84 HydrophobicContact CD2-CD2 3.96Å; L53-L84 PolarHBondContact N-O 2.84Å; L53-L84 PolarHBondContact O-N 3.13Å; V56-L84 HydrophobicContact CG1-CD2 4.05Å; V56-L84 HydrophobicContact CG2-CB 3.99Å; V56-L84 HydrophobicContact CG2-CD2 4.45Å; V81-L84 HydrophobicContact CG1-CB 4.14Å; V81-L84 HydrophobicContact CG1-CD1 4.44Å; L84-V86 HydrophobicContact CD2-CG2 4.03Å; L84-V86 HydrophobicContact CG-CG2 4.1Å
85	F	98.4	Very high	97.4	Very high	127 Å²	127	85.1 Å²	85.1	56%	0.557	41%	0.414	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-84.2	125.8	162.7	173.6	-97.1	0	0	0	109.3	N50 M51 I52 R87	N50-F85 HydrophobicContact CB-CE2 4.03Å; N50-F85 HydrophobicContact CB-CZ 4.11Å; M51-F85 WeakPolarHBondContact O-CA 3.11Å; I52-F85 HydrophobicContact CD1-CB 4.2Å; I52-F85 HydrophobicContact CD1-CD2 3.72Å; I52-F85 HydrophobicContact CD1-CG 4.46Å; F85-R87 HydrophobicContact CE1-CB 4.21Å
86	V	98.6	Very high	97	Very high	6 Å²	6	85.1 Å²	85.1	4%	0.036	42%	0.416	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.2	127.9	176.5	-177	0	0	0	0	108.5	L32 L38 N50 M51 L53 L84 V91	L32-V86 HydrophobicContact CD1-CG1 4.24Å; L32-V86 HydrophobicContact CD2-CG1 3.87Å; L38-V86 HydrophobicContact CD1-CG1 4.35Å; L38-V86 HydrophobicContact CD1-CG2 3.49Å; L38-V86 VanDerWaalsContact CD1-CG2 3.49Å; N50-V86 CarbonylContact C-O 3.45Å; N50-V86 VanDerWaalsContact CA-O 3.28Å; N50-V86 WeakPolarHBondContact CA-O 3.28Å; M51-V86 HydrophobicContact CB-CB 4.21Å; M51-V86 PolarHBondContact N-O 2.98Å; M51-V86 PolarHBondContact O-N 3.14Å; L53-V86 HydrophobicContact CD1-CG2 3.89Å; L53-V86 HydrophobicContact CG-CG2 4.12Å; L84-V86 HydrophobicContact CD2-CG2 4.03Å; L84-V86 HydrophobicContact CG-CG2 4.1Å; V86-V91 HydrophobicContact CG1-CG2 4.15Å
87	R	98.2	Very high	96.3	Very high	154 Å²	154	82.5 Å²	82.5	58%	0.581	41%	0.406	S	S	*	.			trans	-84.6	130.8	175	-163.9	-178.2	151.9	72.7	7.7	110	N50 F85 D89 G90	N50-R87 WeakPolarHBondContact OD1-CA 3.37Å; F85-R87 HydrophobicContact CE1-CB 4.21Å; R87-D89 VanDerWaalsContact C-N 3.32Å; R87-D89 WeakPolarHBondContact CB-OD1 3.48Å; R87-D89 WeakPolarHBondContact CD-OD1 3.34Å; R87-D89 WeakPolarHBondContact CG-OD1 3.46Å; R87-D89 IonicContact CZ-OD2 3.34Å; R87-D89 IonicContact NE-OD1 3.08Å; R87-D89 PolarHBondContact NE-OD1 2.82Å; R87-D89 VanDerWaalsContact NE-OD1 3.08Å; R87-D89 IonicContact NE-OD2 3.4Å; R87-D89 PolarHBondContact NE-OD2 2.66Å; R87-D89 IonicContact NH2-OD2 2.78Å; R87-D89 PolarHBondContact NH2-OD2 2.82Å; R87-D89 PolarHBondContact O-N 3.46Å; R87-G90 PolarHBondContact O-N 2.88Å
88	G	98.3	Very high	95.1	Very high	9 Å²	9	78.5 Å²	78.5	9%	0.093	40%	0.404	C	S	.	.	G	3₁₀ helix	trans	-69.7	-21.7	-170.7	0	0	0	0	0	115.8	H48 L49 N50 G90 V91	H48-G88 VanDerWaalsContact O-CA 3.3Å; H48-G88 WeakPolarHBondContact O-CA 3.39Å; L49-G88 VanDerWaalsContact C-CA 3.47Å; L49-G88 WeakPolarHBondContact O-CA 3.41Å; N50-G88 PolarHBondContact OD1-N 2.9Å; G88-G90 PolarHBondContact O-N 3.02Å; G88-V91 WeakPolarHBondContact O-CB 3.33Å; G88-V91 PolarHBondContact O-N 2.96Å; G88-V91 VanDerWaalsContact O-N 3.07Å
89	D	98	Very high	93.3	Very high	85 Å²	85	78.2 Å²	78.2	46%	0.455	41%	0.41	S	S	.	.	G	3₁₀ helix	trans	-65.9	-21.8	176.6	64.3	-18.9	0	0	0	114	R87	R87-D89 VanDerWaalsContact C-N 3.32Å; R87-D89 WeakPolarHBondContact CB-OD1 3.48Å; R87-D89 WeakPolarHBondContact CD-OD1 3.34Å; R87-D89 WeakPolarHBondContact CG-OD1 3.46Å; R87-D89 IonicContact CZ-OD2 3.34Å; R87-D89 IonicContact NE-OD1 3.08Å; R87-D89 PolarHBondContact NE-OD1 2.82Å; R87-D89 VanDerWaalsContact NE-OD1 3.08Å; R87-D89 IonicContact NE-OD2 3.4Å; R87-D89 PolarHBondContact NE-OD2 2.66Å; R87-D89 IonicContact NH2-OD2 2.78Å; R87-D89 PolarHBondContact NH2-OD2 2.82Å; R87-D89 PolarHBondContact O-N 3.46Å
90	G	97.4	Very high	91	Very high	18 Å²	18	75 Å²	75	19%	0.186	41%	0.413	C	S	.	.	G	3₁₀ helix	trans	-86.2	-13	173.9	0	0	0	0	0	114.3	L32 R33 R87 G88	L32-G90 CarbonylContact C-O 3.6Å; L32-G90 VanDerWaalsContact CA-O 3.22Å; L32-G90 WeakPolarHBondContact CA-O 3.16Å; R33-G90 PolarHBondContact N-O 2.86Å; R87-G90 PolarHBondContact O-N 2.88Å; G88-G90 PolarHBondContact O-N 3.02Å
91	V	98.3	Very high	88.4	Confident	24 Å²	24	75.7 Å²	75.7	15%	0.145	42%	0.415	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.8	126.1	-175.2	179.4	0	0	0	0	110.2	V30 L32 L49 V86 G88 V94	V30-V91 HydrophobicContact CG1-CG1 4.1Å; V30-V91 HydrophobicContact CG1-CG2 4.23Å; L32-V91 HydrophobicContact CD2-CB 4.3Å; L32-V91 HydrophobicContact CD2-CG2 3.71Å; L49-V91 HydrophobicContact CD1-CG1 4.5Å; V86-V91 HydrophobicContact CG1-CG2 4.15Å; G88-V91 WeakPolarHBondContact O-CB 3.33Å; G88-V91 PolarHBondContact O-N 2.96Å; G88-V91 VanDerWaalsContact O-N 3.07Å; V91-V94 HydrophobicContact CG1-CG2 3.75Å
92	I	98	Very high	85.9	Confident	108 Å²	108	82.6 Å²	82.6	55%	0.554	45%	0.445	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-102.3	-44.4	175	-61.2	177.3	0	0	0	109.8	K31 R33	K31-I92 HydrophobicContact CG-CB 4.38Å; K31-I92 HydrophobicContact CG-CD1 4.5Å; K31-I92 PolarHBondContact O-N 2.91Å; R33-I92 HydrophobicContact CB-CD1 4.48Å; R33-I92 HydrophobicContact CG-CD1 3.93Å; R33-I92 HydrophobicContact CG-CG1 4Å
93	L	95.9	Very high	83.3	Confident	88 Å²	88	79.6 Å²	79.6	46%	0.461	45%	0.448	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-149	143	-176.1	176.5	147.1	0	0	0	110.2	Y29 V30 K31	Y29-L93 HydrophobicContact CD1-CD2 4.03Å; Y29-L93 HydrophobicContact CE1-CD2 4.09Å; V30-L93 WeakPolarHBondContact CA-O 3.39Å; K31-L93 HydrophobicContact CB-CB 4.18Å; K31-L93 PolarHBondContact N-O 2.73Å; K31-L93 PolarHBondContact O-N 2.86Å
94	V	96.7	Very high	80.5	Confident	33 Å²	33	82.5 Å²	82.5	20%	0.2	46%	0.462	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.1	119.3	168.9	-178.2	0	0	0	0	106.5	I28 M51 V91	I28-V94 HydrophobicContact CD1-CG1 3.98Å; M51-V94 HydrophobicContact CE-CG1 4.33Å; M51-V94 HydrophobicContact CE-CG2 3.43Å; M51-V94 VanDerWaalsContact CE-CG2 3.43Å; M51-V94 HydrophobicContact SD-CG2 4.47Å; V91-V94 HydrophobicContact CG1-CG2 3.75Å
95	S	94.8	Very high	77.6	Confident	46 Å²	46	87.7 Å²	87.7	32%	0.322	53%	0.525	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.5	129.1	172.1	-176.8	0	0	0	0	108.7	I28 Y29	I28-S95 WeakPolarHBondContact CB-O 3.43Å; Y29-S95 PolarHBondContact N-O 3.37Å; Y29-S95 PolarHBondContact O-N 2.9Å
96	P	85.8	Confident	76.6	Confident	61 Å²	61	85.8 Å²	85.8	40%	0.396	52%	0.523	S	S	.	.	P	Polyproline II helix	trans	-53.8	167.5	165.7	-22	32.8	0	0	0	111.4	S98	P96-S98 PolarHBondContact O-N 3.27Å; P96-S98 VanDerWaalsContact O-N 3.13Å
97	P	79.9	Confident	75.4	Confident	32 Å²	32	89.9 Å²	89.9	21%	0.208	55%	0.549	C	S	.	.	P	Polyproline II helix	trans	-52.6	123.2	176.3	-23.1	34.7	0	0	0	109.7	E26 R27 H99	E26-P97 HydrophobicContact CB-CG 3.39Å; E26-P97 HydrophobicContact CG-CG 3.96Å; R27-P97 WeakPolarHBondContact O-CA 3.43Å; P97-H99 PolarHBondContact O-N 3.37Å
98	S	71.9	Confident	74.1	Confident	83 Å²	83	86.4 Å²	86.4	58%	0.58	55%	0.547	S	S	*	.			trans	-68.5	106.5	165.6	54	0	0	0	0	106.3	P96 A100	P96-S98 PolarHBondContact O-N 3.27Å; P96-S98 VanDerWaalsContact O-N 3.13Å; S98-A100 PolarHBondContact O-N 3.39Å
99	H	59.1	Low	72.7	Confident	179 Å²	179	90.9 Å²	90.9	83%	0.829	57%	0.574	S	S	*	*			trans	-64.9	72.3	154	-57.7	-66	0	0	0	106.9	P97 P101	P97-H99 PolarHBondContact O-N 3.37Å; H99-P101 WeakPolarHBondContact O-CD 3.45Å
100	A	50.3	Low	71.1	Confident	72 Å²	72	91.3 Å²	91.3	60%	0.595	58%	0.581	S	S	*	*			trans	-61.2	119.1	157	0	0	0	0	0	104	S98 E102	S98-A100 PolarHBondContact O-N 3.39Å; A100-E102 PolarHBondContact O-N 2.86Å
101	P	43.6	Very low	69.4	Low	119 Å²	119	96.2 Å²	96.2	77%	0.773	61%	0.607	S	S	*	*			trans	-53.2	125.3	171.6	21.4	-29.1	0	0	0	105.7	H99 A103	H99-P101 WeakPolarHBondContact O-CD 3.45Å; P101-A103 PolarHBondContact O-N 3.4Å
102	E	45.6	Very low	67.3	Low	177 Å²	177	101.4 Å²	101.4	83%	0.827	64%	0.64	S	S	*	*			trans	-44.1	116.9	173.7	-71.2	179	160.3	0	0	106.5	A100 I104	A100-E102 PolarHBondContact O-N 2.86Å; E102-I104 PolarHBondContact O-N 2.85Å
103	A	43.7	Very low	65	Low	99 Å²	99	100.8 Å²	100.8	82%	0.818	65%	0.647	S	S	*	*			trans	-62.8	98.4	172.1	0	0	0	0	0	105.1	P101 G105	P101-A103 PolarHBondContact O-N 3.4Å; A103-G105 PolarHBondContact O-N 2.89Å
104	I	39.2	Very low	62.4	Low	177 Å²	177	101.9 Å²	101.9	91%	0.908	66%	0.663	S	S	*	*			trans	-59.6	105.4	169	-60	174.6	0	0	0	105.1	E102	E102-I104 PolarHBondContact O-N 2.85Å
105	G	38.1	Very low	59.3	Low	145 Å²	145	108.2 Å²	108.2	100%	1.495	71%	0.705	S	S	*	*			trans	-154	0	176.6	0	0	0	0	0	110	A103	A103-G105 PolarHBondContact O-N 2.89Å

Retrieved 105 of 105 residues in 28.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).