A0A077Z8N4_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077Z8N4, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 66 aa.

						>A0A077Z8N4_TRITR|A0A077Z8N4
MSASAGHQLTFKFFSTWAHKIDMIMYTLILLLISSRSASANRQLIFPAGRKMLSIEPSLGFCSYSR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50.8	Low	72.9	Confident	240 Å²	240	109.4 Å²	109.4	100%	1.182	63%	0.633	S	S	*	*				0	32.4	0	-74.3	168.8	129	0	0	113.3
2	S	58.7	Low	74.3	Confident	113 Å²	113	112.7 Å²	112.7	79%	0.79	63%	0.634	S	S	*	*			trans	-110	-3.9	-173	-57.2	0	0	0	0	116.3	S4	S2-S4 VanDerWaalsContact C-N 3.3Å; S2-S4 PolarHBondContact O-N 2.56Å
3	A	59.2	Low	75.4	Confident	81 Å²	81	115.5 Å²	115.5	67%	0.669	64%	0.636	S	S	*	*	S	Bend	trans	-77.7	-13.1	177.3	0	0	0	0	0	113.9	H7	A3-H7 PolarHBondContact O-ND1 3.05Å
4	S	70.5	Confident	76.6	Confident	69 Å²	69	117.3 Å²	117.3	48%	0.483	63%	0.634	S	S	.	*	H	α-helix	trans	-82.2	-25.4	-174.8	-172	0	0	0	0	114.1	S2 Q8	S2-S4 VanDerWaalsContact C-N 3.3Å; S2-S4 PolarHBondContact O-N 2.56Å; S4-Q8 WeakPolarHBondContact O-CG 3.08Å; S4-Q8 PolarHBondContact O-N 2.87Å; S4-Q8 VanDerWaalsContact O-N 3.1Å
5	A	68	Low	77.6	Confident	59 Å²	59	113.9 Å²	113.9	49%	0.488	62%	0.623	S	S	.	*	H	α-helix	trans	-71	-41.4	-176.5	0	0	0	0	0	112	H7 Q8 L9	A5-H7 PolarHBondContact O-N 3.09Å; A5-Q8 PolarHBondContact O-N 3.34Å; A5-L9 WeakPolarHBondContact O-CG 3.1Å; A5-L9 PolarHBondContact O-N 3.26Å
6	G	76	Confident	78.6	Confident	43 Å²	43	111.1 Å²	111.1	44%	0.443	61%	0.61	S	S	.	*	H	α-helix	trans	-61.2	-44	175.7	0	0	0	0	0	112.3	L9 T10	G6-L9 PolarHBondContact O-N 2.87Å; G6-T10 WeakPolarHBondContact O-CG2 3.21Å; G6-T10 PolarHBondContact O-N 3.48Å; G6-T10 PolarHBondContact O-OG1 3.14Å
7	H	78.7	Confident	79.5	Confident	138 Å²	138	114 Å²	114	64%	0.639	61%	0.61	S	S	*	*	H	α-helix	trans	-64.6	-38.7	176.9	-76	88.4	0	0	0	113.1	A3 A5 T10 F11	A3-H7 PolarHBondContact O-ND1 3.05Å; A5-H7 PolarHBondContact O-N 3.09Å; H7-T10 WeakPolarHBondContact CA-OG1 3.41Å; H7-T10 PolarHBondContact O-OG1 2.82Å; H7-F11 WeakPolarHBondContact O-CB 3.43Å; H7-F11 PolarHBondContact O-N 3.01Å
8	Q	81.6	Confident	80.3	Confident	135 Å²	135	110.5 Å²	110.5	63%	0.631	60%	0.6	S	S	*	*	H	α-helix	trans	-67.1	-40.4	176.2	-77.7	-176.7	-2.7	0	0	112.3	S4 A5 K12	S4-Q8 WeakPolarHBondContact O-CG 3.08Å; S4-Q8 PolarHBondContact O-N 2.87Å; S4-Q8 VanDerWaalsContact O-N 3.1Å; A5-Q8 PolarHBondContact O-N 3.34Å; Q8-K12 WeakPolarHBondContact O-CB 3.19Å; Q8-K12 PolarHBondContact O-N 3.46Å
9	L	84.1	Confident	81	Confident	99 Å²	99	110.6 Å²	110.6	52%	0.518	60%	0.596	S	S	.	*	H	α-helix	trans	-63.6	-49.1	176.9	-74.6	168.8	0	0	0	111.1	A5 G6 F11 K12 F13	A5-L9 WeakPolarHBondContact O-CG 3.1Å; A5-L9 PolarHBondContact O-N 3.26Å; G6-L9 PolarHBondContact O-N 2.87Å; L9-F11 PolarHBondContact O-N 3.29Å; L9-K12 PolarHBondContact O-N 3.37Å; L9-F13 WeakPolarHBondContact O-CD2 3.28Å; L9-F13 PolarHBondContact O-N 2.88Å
10	T	86.4	Confident	81.7	Confident	72 Å²	72	111.8 Å²	111.8	44%	0.442	60%	0.595	S	S	.	*	H	α-helix	trans	-60.9	-44.8	178.6	54.3	0	0	0	0	111.4	G6 H7 K12 F13 F14	G6-T10 WeakPolarHBondContact O-CG2 3.21Å; G6-T10 PolarHBondContact O-N 3.48Å; G6-T10 PolarHBondContact O-OG1 3.14Å; H7-T10 WeakPolarHBondContact CA-OG1 3.41Å; H7-T10 PolarHBondContact O-OG1 2.82Å; T10-K12 VanDerWaalsContact C-N 3.34Å; T10-K12 PolarHBondContact O-N 2.85Å; T10-F13 PolarHBondContact O-N 2.81Å; T10-F14 VanDerWaalsContact O-CD2 3.22Å; T10-F14 WeakPolarHBondContact O-CD2 3.49Å; T10-F14 PolarHBondContact O-N 2.82Å
11	F	87.5	Confident	82.3	Confident	154 Å²	154	110.3 Å²	110.3	68%	0.675	59%	0.587	S	S	*	*	H	α-helix	trans	-59.5	-42.8	175.9	-172.9	-95.6	0	0	0	112.3	H7 L9 F13 F14 S15	H7-F11 WeakPolarHBondContact O-CB 3.43Å; H7-F11 PolarHBondContact O-N 3.01Å; L9-F11 PolarHBondContact O-N 3.29Å; F11-F13 PolarHBondContact O-N 2.94Å; F11-F14 PolarHBondContact O-N 3.15Å; F11-S15 VanDerWaalsContact O-CB 3.32Å; F11-S15 WeakPolarHBondContact O-CB 3.47Å; F11-S15 PolarHBondContact O-N 3.4Å
12	K	89.7	Confident	84.4	Confident	149 Å²	149	101.7 Å²	101.7	65%	0.648	55%	0.545	S	S	*	.	H	α-helix	trans	-63.6	-40.9	176.8	-172.1	175.3	-178.6	177.5	0	112.1	Q8 L9 T10 T16	Q8-K12 WeakPolarHBondContact O-CB 3.19Å; Q8-K12 PolarHBondContact O-N 3.46Å; L9-K12 PolarHBondContact O-N 3.37Å; T10-K12 VanDerWaalsContact C-N 3.34Å; T10-K12 PolarHBondContact O-N 2.85Å; K12-T16 WeakPolarHBondContact O-CB 3.25Å; K12-T16 PolarHBondContact O-N 3.21Å; K12-T16 PolarHBondContact O-OG1 3.35Å
13	F	89.6	Confident	86	Confident	149 Å²	149	100.6 Å²	100.6	65%	0.654	53%	0.529	S	S	*	.	H	α-helix	trans	-63.7	-48.1	174.2	-80.2	-65.8	0	0	0	111.7	L9 T10 F11 S15 T16 W17	L9-F13 WeakPolarHBondContact O-CD2 3.28Å; L9-F13 PolarHBondContact O-N 2.88Å; T10-F13 PolarHBondContact O-N 2.81Å; F11-F13 PolarHBondContact O-N 2.94Å; F13-S15 PolarHBondContact O-N 2.93Å; F13-T16 PolarHBondContact O-N 3.41Å; F13-W17 VanDerWaalsContact O-CB 3.28Å; F13-W17 WeakPolarHBondContact O-CB 3.34Å; F13-W17 PolarHBondContact O-N 3.25Å
14	F	91.3	Very high	87.7	Confident	141 Å²	141	101.5 Å²	101.5	62%	0.618	52%	0.521	S	S	*	.	H	α-helix	trans	-61.5	-43.8	177.7	-86.7	-71.7	0	0	0	112.3	T10 F11 W17 A18	T10-F14 VanDerWaalsContact O-CD2 3.22Å; T10-F14 WeakPolarHBondContact O-CD2 3.49Å; T10-F14 PolarHBondContact O-N 2.82Å; F11-F14 PolarHBondContact O-N 3.15Å; F14-W17 PolarHBondContact O-N 3.44Å; F14-A18 VanDerWaalsContact O-CB 3.29Å; F14-A18 WeakPolarHBondContact O-CB 3.32Å; F14-A18 PolarHBondContact O-N 2.8Å
15	S	92.4	Very high	88.9	Confident	67 Å²	67	102.7 Å²	102.7	47%	0.469	52%	0.52	S	S	.	.	H	α-helix	trans	-62.6	-44.8	176.9	172.4	0	0	0	0	111.7	F11 F13 W17 A18 H19	F11-S15 VanDerWaalsContact O-CB 3.32Å; F11-S15 WeakPolarHBondContact O-CB 3.47Å; F11-S15 PolarHBondContact O-N 3.4Å; F13-S15 PolarHBondContact O-N 2.93Å; S15-W17 VanDerWaalsContact C-N 3.34Å; S15-W17 PolarHBondContact O-N 2.93Å; S15-A18 PolarHBondContact O-N 2.74Å; S15-H19 WeakPolarHBondContact O-CB 3.2Å; S15-H19 PolarHBondContact O-N 3.35Å
16	T	92.8	Very high	90.2	Very high	68 Å²	68	106 Å²	106	42%	0.417	52%	0.521	S	S	.	.	H	α-helix	trans	-64.2	-40.8	176.7	-54.6	0	0	0	0	111.4	K12 F13 K20	K12-T16 WeakPolarHBondContact O-CB 3.25Å; K12-T16 PolarHBondContact O-N 3.21Å; K12-T16 PolarHBondContact O-OG1 3.35Å; F13-T16 PolarHBondContact O-N 3.41Å; T16-K20 WeakPolarHBondContact O-CG 3.18Å; T16-K20 PolarHBondContact O-N 2.92Å; T16-K20 VanDerWaalsContact O-N 3.09Å
17	W	94.6	Very high	91	Very high	161 Å²	161	108.3 Å²	108.3	61%	0.61	53%	0.527	S	S	*	.	H	α-helix	trans	-65.3	-47.7	177.6	179.5	80	0	0	0	111.3	F13 F14 S15 H19 K20 I21	F13-W17 VanDerWaalsContact O-CB 3.28Å; F13-W17 WeakPolarHBondContact O-CB 3.34Å; F13-W17 PolarHBondContact O-N 3.25Å; F14-W17 PolarHBondContact O-N 3.44Å; S15-W17 VanDerWaalsContact C-N 3.34Å; S15-W17 PolarHBondContact O-N 2.93Å; W17-H19 VanDerWaalsContact C-N 3.32Å; W17-H19 PolarHBondContact O-N 2.72Å; W17-K20 PolarHBondContact O-N 2.85Å; W17-K20 VanDerWaalsContact O-N 3.11Å; W17-I21 HydrophobicContact CD2-CG1 4.22Å; W17-I21 HydrophobicContact CH2-CG1 4.38Å; W17-I21 HydrophobicContact CZ2-CD1 4.26Å; W17-I21 HydrophobicContact CZ2-CG1 4.01Å; W17-I21 WeakPolarHBondContact O-CG1 3.48Å; W17-I21 PolarHBondContact O-N 3.27Å
18	A	93	Very high	91.8	Very high	51 Å²	51	106.2 Å²	106.2	42%	0.421	52%	0.52	S	S	.	.	H	α-helix	trans	-57.8	-44.5	176.1	0	0	0	0	0	111.6	F14 S15 K20 I21 D22	F14-A18 VanDerWaalsContact O-CB 3.29Å; F14-A18 WeakPolarHBondContact O-CB 3.32Å; F14-A18 PolarHBondContact O-N 2.8Å; S15-A18 PolarHBondContact O-N 2.74Å; A18-K20 VanDerWaalsContact C-N 3.32Å; A18-K20 PolarHBondContact O-N 2.91Å; A18-I21 PolarHBondContact O-N 3.44Å; A18-D22 WeakPolarHBondContact O-CB 3.37Å; A18-D22 PolarHBondContact O-N 2.88Å
19	H	93.8	Very high	92.3	Very high	113 Å²	113	103.5 Å²	103.5	52%	0.523	51%	0.509	S	S	.	.	H	α-helix	trans	-60.4	-39.8	176	-177.4	-84	0	0	0	112.5	S15 W17 D22 M23	S15-H19 WeakPolarHBondContact O-CB 3.2Å; S15-H19 PolarHBondContact O-N 3.35Å; W17-H19 VanDerWaalsContact C-N 3.32Å; W17-H19 PolarHBondContact O-N 2.72Å; H19-D22 PolarHBondContact O-N 2.88Å; H19-M23 VanDerWaalsContact O-CG 3.31Å; H19-M23 WeakPolarHBondContact O-CG 3.28Å; H19-M23 PolarHBondContact O-N 3.38Å
20	K	94.9	Very high	92.7	Very high	133 Å²	133	103.8 Å²	103.8	58%	0.578	51%	0.51	S	S	*	.	H	α-helix	trans	-65.8	-41.9	176.2	-74.1	-180	179.2	-173.7	0	112.2	T16 W17 A18 D22 M23 I24	T16-K20 WeakPolarHBondContact O-CG 3.18Å; T16-K20 PolarHBondContact O-N 2.92Å; T16-K20 VanDerWaalsContact O-N 3.09Å; W17-K20 PolarHBondContact O-N 2.85Å; W17-K20 VanDerWaalsContact O-N 3.11Å; A18-K20 VanDerWaalsContact C-N 3.32Å; A18-K20 PolarHBondContact O-N 2.91Å; K20-D22 VanDerWaalsContact C-N 3.33Å; K20-M23 PolarHBondContact O-N 3.32Å; K20-I24 WeakPolarHBondContact O-CD1 3.31Å; K20-I24 VanDerWaalsContact O-CG1 3.28Å; K20-I24 WeakPolarHBondContact O-CG1 3.4Å; K20-I24 PolarHBondContact O-N 2.94Å; K20-I24 VanDerWaalsContact O-N 3.1Å
21	I	94.3	Very high	92.9	Very high	82 Å²	82	105.5 Å²	105.5	42%	0.421	52%	0.516	S	S	.	.	H	α-helix	trans	-62.8	-43.4	176.7	-65.1	-61	0	0	0	110.7	W17 A18 I24 M25	W17-I21 HydrophobicContact CD2-CG1 4.22Å; W17-I21 HydrophobicContact CH2-CG1 4.38Å; W17-I21 HydrophobicContact CZ2-CD1 4.26Å; W17-I21 HydrophobicContact CZ2-CG1 4.01Å; W17-I21 WeakPolarHBondContact O-CG1 3.48Å; W17-I21 PolarHBondContact O-N 3.27Å; A18-I21 PolarHBondContact O-N 3.44Å; I21-I24 PolarHBondContact O-N 3.47Å; I21-M25 WeakPolarHBondContact O-CB 3.3Å; I21-M25 PolarHBondContact O-N 2.92Å
22	D	94.4	Very high	93	Very high	59 Å²	59	103.7 Å²	103.7	32%	0.316	51%	0.513	S	S	.	.	H	α-helix	trans	-60	-48.5	177.7	-171.2	61.6	0	0	0	111.7	A18 H19 K20 I24 M25 Y26	A18-D22 WeakPolarHBondContact O-CB 3.37Å; A18-D22 PolarHBondContact O-N 2.88Å; H19-D22 PolarHBondContact O-N 2.88Å; K20-D22 VanDerWaalsContact C-N 3.33Å; D22-I24 VanDerWaalsContact C-N 3.33Å; D22-I24 PolarHBondContact O-N 3.22Å; D22-M25 PolarHBondContact O-N 2.97Å; D22-M25 VanDerWaalsContact O-N 3.17Å; D22-Y26 VanDerWaalsContact O-CD2 3.3Å; D22-Y26 WeakPolarHBondContact O-CD2 3.32Å; D22-Y26 PolarHBondContact O-N 3.39Å; D22-Y26 VanDerWaalsContact OD1-CE2 3.31Å; D22-Y26 WeakPolarHBondContact OD1-CE2 3.26Å; D22-Y26 WeakPolarHBondContact OD2-CD2 3.29Å; D22-Y26 VanDerWaalsContact OD2-CE2 3.24Å; D22-Y26 WeakPolarHBondContact OD2-CE2 3.29Å
23	M	93.7	Very high	93	Very high	90 Å²	90	101 Å²	101	44%	0.443	51%	0.505	S	S	.	.	H	α-helix	trans	-58.4	-41.4	175.8	-71.3	-68.7	115.4	0	0	113	H19 K20 T27	H19-M23 VanDerWaalsContact O-CG 3.31Å; H19-M23 WeakPolarHBondContact O-CG 3.28Å; H19-M23 PolarHBondContact O-N 3.38Å; K20-M23 PolarHBondContact O-N 3.32Å; M23-T27 WeakPolarHBondContact O-CB 3.24Å; M23-T27 PolarHBondContact O-N 2.99Å; M23-T27 PolarHBondContact O-OG1 3.39Å
24	I	95.2	Very high	92.6	Very high	99 Å²	99	97.3 Å²	97.3	51%	0.508	50%	0.497	S	S	.	.	H	α-helix	trans	-64.8	-45.5	177.1	-68.5	164	0	0	0	110.2	K20 I21 D22 T27 L28	K20-I24 WeakPolarHBondContact O-CD1 3.31Å; K20-I24 VanDerWaalsContact O-CG1 3.28Å; K20-I24 WeakPolarHBondContact O-CG1 3.4Å; K20-I24 PolarHBondContact O-N 2.94Å; K20-I24 VanDerWaalsContact O-N 3.1Å; I21-I24 PolarHBondContact O-N 3.47Å; D22-I24 VanDerWaalsContact C-N 3.33Å; D22-I24 PolarHBondContact O-N 3.22Å; I24-T27 PolarHBondContact O-N 3.28Å; I24-L28 HydrophobicContact CG2-CD1 3.96Å; I24-L28 HydrophobicContact CG2-CG 4.44Å; I24-L28 WeakPolarHBondContact O-CG 3.3Å; I24-L28 PolarHBondContact O-N 3.24Å
25	M	94.6	Very high	92.1	Very high	94 Å²	94	93.7 Å²	93.7	46%	0.463	49%	0.49	S	S	.	.	H	α-helix	trans	-61.8	-48	178.8	-173.3	-174.8	67.3	0	0	111.4	I21 D22 T27 L28 I29	I21-M25 WeakPolarHBondContact O-CB 3.3Å; I21-M25 PolarHBondContact O-N 2.92Å; D22-M25 PolarHBondContact O-N 2.97Å; D22-M25 VanDerWaalsContact O-N 3.17Å; M25-T27 VanDerWaalsContact C-N 3.31Å; M25-T27 PolarHBondContact O-N 2.93Å; M25-L28 PolarHBondContact O-N 2.93Å; M25-I29 HydrophobicContact CG-CD1 4Å; M25-I29 VanDerWaalsContact O-CG1 3.3Å; M25-I29 WeakPolarHBondContact O-CG1 3.43Å; M25-I29 PolarHBondContact O-N 3.05Å
26	Y	94.8	Very high	91.3	Very high	129 Å²	129	100.1 Å²	100.1	51%	0.506	50%	0.504	S	S	.	.	H	α-helix	trans	-57	-44.4	174.7	-89.3	-71.1	0	0	0	112	D22 L28 I29 L30	D22-Y26 VanDerWaalsContact O-CD2 3.3Å; D22-Y26 WeakPolarHBondContact O-CD2 3.32Å; D22-Y26 PolarHBondContact O-N 3.39Å; D22-Y26 VanDerWaalsContact OD1-CE2 3.31Å; D22-Y26 WeakPolarHBondContact OD1-CE2 3.26Å; D22-Y26 WeakPolarHBondContact OD2-CD2 3.29Å; D22-Y26 VanDerWaalsContact OD2-CE2 3.24Å; D22-Y26 WeakPolarHBondContact OD2-CE2 3.29Å; Y26-L28 PolarHBondContact O-N 3.34Å; Y26-I29 PolarHBondContact O-N 3.47Å; Y26-L30 WeakPolarHBondContact O-CG 3.47Å; Y26-L30 PolarHBondContact O-N 2.93Å
27	T	93.8	Very high	90.1	Very high	91 Å²	91	100.3 Å²	100.3	56%	0.558	51%	0.507	S	S	*	.	H	α-helix	trans	-62.2	-43.3	178.2	-56.5	0	0	0	0	111.5	M23 I24 M25 L30 L31	M23-T27 WeakPolarHBondContact O-CB 3.24Å; M23-T27 PolarHBondContact O-N 2.99Å; M23-T27 PolarHBondContact O-OG1 3.39Å; I24-T27 PolarHBondContact O-N 3.28Å; M25-T27 VanDerWaalsContact C-N 3.31Å; M25-T27 PolarHBondContact O-N 2.93Å; T27-L30 PolarHBondContact O-N 2.96Å; T27-L31 WeakPolarHBondContact O-CB 3.42Å; T27-L31 PolarHBondContact O-N 3.39Å
28	L	94.4	Very high	88.6	Confident	95 Å²	95	95.1 Å²	95.1	50%	0.497	50%	0.499	S	S	.	.	H	α-helix	trans	-63.9	-42.2	177	-73.4	170.6	0	0	0	112	I24 M25 Y26 L31 L32	I24-L28 HydrophobicContact CG2-CD1 3.96Å; I24-L28 HydrophobicContact CG2-CG 4.44Å; I24-L28 WeakPolarHBondContact O-CG 3.3Å; I24-L28 PolarHBondContact O-N 3.24Å; M25-L28 PolarHBondContact O-N 2.93Å; Y26-L28 PolarHBondContact O-N 3.34Å; L28-L31 PolarHBondContact O-N 3.1Å; L28-L32 VanDerWaalsContact O-CG 3.32Å; L28-L32 WeakPolarHBondContact O-CG 3.31Å; L28-L32 PolarHBondContact O-N 3.28Å
29	I	93.3	Very high	87	Confident	77 Å²	77	96 Å²	96	40%	0.395	50%	0.502	S	S	.	.	H	α-helix	trans	-61.1	-47.2	176.3	-68.6	164.9	0	0	0	110.3	M25 Y26 L31 L32 I33	M25-I29 HydrophobicContact CG-CD1 4Å; M25-I29 VanDerWaalsContact O-CG1 3.3Å; M25-I29 WeakPolarHBondContact O-CG1 3.43Å; M25-I29 PolarHBondContact O-N 3.05Å; Y26-I29 PolarHBondContact O-N 3.47Å; I29-L31 VanDerWaalsContact C-N 3.31Å; I29-L31 PolarHBondContact O-N 3.17Å; I29-L32 PolarHBondContact O-N 3.46Å; I29-I33 HydrophobicContact CG2-CD1 3.74Å; I29-I33 HydrophobicContact CG2-CG1 4.43Å; I29-I33 VanDerWaalsContact O-CG1 3.31Å; I29-I33 WeakPolarHBondContact O-CG1 3.44Å; I29-I33 PolarHBondContact O-N 2.73Å
30	L	92.3	Very high	85.4	Confident	106 Å²	106	92.6 Å²	92.6	56%	0.555	49%	0.494	S	S	*	.	H	α-helix	trans	-61.3	-39.5	176.9	-72.4	174.4	0	0	0	112.1	Y26 T27 S34	Y26-L30 WeakPolarHBondContact O-CG 3.47Å; Y26-L30 PolarHBondContact O-N 2.93Å; T27-L30 PolarHBondContact O-N 2.96Å; L30-S34 VanDerWaalsContact O-CB 3.26Å; L30-S34 WeakPolarHBondContact O-CB 3.38Å; L30-S34 PolarHBondContact O-N 3.02Å; L30-S34 PolarHBondContact O-OG 2.85Å
31	L	91.1	Very high	83.6	Confident	108 Å²	108	90.6 Å²	90.6	57%	0.565	49%	0.489	S	S	*	.	H	α-helix	trans	-64.9	-42.6	176.6	-171	76.1	0	0	0	111.5	T27 L28 I29 S34 S35	T27-L31 WeakPolarHBondContact O-CB 3.42Å; T27-L31 PolarHBondContact O-N 3.39Å; L28-L31 PolarHBondContact O-N 3.1Å; I29-L31 VanDerWaalsContact C-N 3.31Å; I29-L31 PolarHBondContact O-N 3.17Å; L31-S34 PolarHBondContact O-N 2.85Å; L31-S35 VanDerWaalsContact O-CB 3.29Å; L31-S35 WeakPolarHBondContact O-CB 3.33Å; L31-S35 PolarHBondContact O-N 3.09Å; L31-S35 PolarHBondContact O-OG 3.44Å
32	L	90	Very high	81.7	Confident	116 Å²	116	95.8 Å²	95.8	61%	0.607	50%	0.504	S	S	*	.	H	α-helix	trans	-65.3	-45.1	177.6	-72.8	172.9	0	0	0	111.5	L28 I29 S35 R36	L28-L32 VanDerWaalsContact O-CG 3.32Å; L28-L32 WeakPolarHBondContact O-CG 3.31Å; L28-L32 PolarHBondContact O-N 3.28Å; I29-L32 PolarHBondContact O-N 3.46Å; L32-S35 PolarHBondContact O-N 3.47Å; L32-R36 WeakPolarHBondContact O-CG 3.45Å; L32-R36 PolarHBondContact O-N 3.49Å
33	I	88.2	Confident	79.8	Confident	93 Å²	93	99.7 Å²	99.7	48%	0.477	52%	0.52	S	S	.	.	H	α-helix	trans	-60.9	-48.3	175.3	-67.1	167.5	0	0	0	109.9	I29 S35 R36 S37	I29-I33 HydrophobicContact CG2-CD1 3.74Å; I29-I33 HydrophobicContact CG2-CG1 4.43Å; I29-I33 VanDerWaalsContact O-CG1 3.31Å; I29-I33 WeakPolarHBondContact O-CG1 3.44Å; I29-I33 PolarHBondContact O-N 2.73Å; I33-S35 VanDerWaalsContact C-N 3.3Å; I33-S35 PolarHBondContact O-N 3.11Å; I33-R36 PolarHBondContact O-N 2.81Å; I33-S37 WeakPolarHBondContact O-CB 3.47Å; I33-S37 PolarHBondContact O-N 3.32Å; I33-S37 PolarHBondContact O-OG 3.22Å
34	S	82.4	Confident	78	Confident	71 Å²	71	101.7 Å²	101.7	50%	0.497	53%	0.532	S	S	.	.	H	α-helix	trans	-61.6	-38.8	179	-58.9	0	0	0	0	112.1	L30 L31 S37 A38	L30-S34 VanDerWaalsContact O-CB 3.26Å; L30-S34 WeakPolarHBondContact O-CB 3.38Å; L30-S34 PolarHBondContact O-N 3.02Å; L30-S34 PolarHBondContact O-OG 2.85Å; L31-S34 PolarHBondContact O-N 2.85Å; S34-S37 PolarHBondContact O-N 2.76Å; S34-A38 VanDerWaalsContact O-CB 3.29Å; S34-A38 WeakPolarHBondContact O-CB 3.38Å; S34-A38 PolarHBondContact O-N 2.97Å
35	S	81.2	Confident	76.1	Confident	65 Å²	65	102.4 Å²	102.4	46%	0.455	54%	0.535	S	S	.	.	H	α-helix	trans	-67.1	-40.9	176.4	-59.8	0	0	0	0	112	L31 L32 I33 A38 S39	L31-S35 VanDerWaalsContact O-CB 3.29Å; L31-S35 WeakPolarHBondContact O-CB 3.33Å; L31-S35 PolarHBondContact O-N 3.09Å; L31-S35 PolarHBondContact O-OG 3.44Å; L32-S35 PolarHBondContact O-N 3.47Å; I33-S35 VanDerWaalsContact C-N 3.3Å; I33-S35 PolarHBondContact O-N 3.11Å; S35-A38 PolarHBondContact O-N 3.4Å; S35-S39 VanDerWaalsContact O-CB 3.28Å; S35-S39 WeakPolarHBondContact O-CB 3.41Å; S35-S39 PolarHBondContact O-N 3.36Å
36	R	74.8	Confident	74.1	Confident	202 Å²	202	105.7 Å²	105.7	76%	0.762	55%	0.547	S	S	*	.	H	α-helix	trans	-64.9	-42.5	173.4	-71	-175.5	81.7	-179.8	5.4	111.2	L32 I33 S39 A40	L32-R36 WeakPolarHBondContact O-CG 3.45Å; L32-R36 PolarHBondContact O-N 3.49Å; I33-R36 PolarHBondContact O-N 2.81Å; R36-S39 PolarHBondContact O-N 3.49Å; R36-A40 VanDerWaalsContact O-CB 3.28Å; R36-A40 WeakPolarHBondContact O-CB 3.42Å; R36-A40 PolarHBondContact O-N 3.03Å
37	S	67.4	Low	71.9	Confident	71 Å²	71	104 Å²	104	50%	0.497	55%	0.552	S	S	.	*	H	α-helix	trans	-64	-42	175.3	-64.8	0	0	0	0	112	I33 S34 A40 N41	I33-S37 WeakPolarHBondContact O-CB 3.47Å; I33-S37 PolarHBondContact O-N 3.32Å; I33-S37 PolarHBondContact O-OG 3.22Å; S34-S37 PolarHBondContact O-N 2.76Å; S37-A40 PolarHBondContact O-N 2.99Å; S37-N41 WeakPolarHBondContact O-CB 3.28Å; S37-N41 PolarHBondContact O-N 3.01Å
38	A	63.7	Low	69.9	Low	53 Å²	53	102.7 Å²	102.7	44%	0.438	55%	0.55	S	S	.	*	H	α-helix	trans	-66.3	-38.3	175.6	0	0	0	0	0	112.2	S34 S35 R42	S34-A38 VanDerWaalsContact O-CB 3.29Å; S34-A38 WeakPolarHBondContact O-CB 3.38Å; S34-A38 PolarHBondContact O-N 2.97Å; S35-A38 PolarHBondContact O-N 3.4Å; A38-R42 WeakPolarHBondContact O-CG 3.29Å; A38-R42 PolarHBondContact O-N 3.22Å
39	S	59	Low	67.7	Low	68 Å²	68	101.7 Å²	101.7	48%	0.476	56%	0.564	S	S	.	*	H	α-helix	trans	-67.6	-44	175.1	-174.9	0	0	0	0	111.8	S35 R36 R42 Q43	S35-S39 VanDerWaalsContact O-CB 3.28Å; S35-S39 WeakPolarHBondContact O-CB 3.41Å; S35-S39 PolarHBondContact O-N 3.36Å; R36-S39 PolarHBondContact O-N 3.49Å; S39-R42 PolarHBondContact O-N 3.34Å; S39-Q43 PolarHBondContact O-N 2.93Å
40	A	59.2	Low	65.7	Low	43 Å²	43	109.9 Å²	109.9	36%	0.355	59%	0.589	S	S	.	*	H	α-helix	trans	-64.5	-39.1	174.7	0	0	0	0	0	111.7	R36 S37 Q43 L44	R36-A40 VanDerWaalsContact O-CB 3.28Å; R36-A40 WeakPolarHBondContact O-CB 3.42Å; R36-A40 PolarHBondContact O-N 3.03Å; S37-A40 PolarHBondContact O-N 2.99Å; A40-Q43 CarbonylContact O-C 3.56Å; A40-Q43 PolarHBondContact O-N 3.45Å; A40-Q43 VanDerWaalsContact O-N 3.14Å; A40-L44 WeakPolarHBondContact O-CG 3.32Å; A40-L44 PolarHBondContact O-N 3.1Å
41	N	57.5	Low	63.9	Low	90 Å²	90	114.7 Å²	114.7	48%	0.481	61%	0.606	S	S	.	*	H	α-helix	trans	-69.8	-33.9	176.9	-151.4	1.3	0	0	0	111.4	S37 Q43 L44 I45	S37-N41 WeakPolarHBondContact O-CB 3.28Å; S37-N41 PolarHBondContact O-N 3.01Å; N41-Q43 VanDerWaalsContact C-N 3.32Å; N41-Q43 PolarHBondContact O-N 3.22Å; N41-L44 PolarHBondContact O-N 3.34Å; N41-I45 WeakPolarHBondContact O-CB 3.31Å; N41-I45 WeakPolarHBondContact O-CD1 3.36Å; N41-I45 WeakPolarHBondContact O-CG1 3.28Å; N41-I45 PolarHBondContact O-N 2.88Å
42	R	54.9	Low	61.7	Low	192 Å²	192	117.4 Å²	117.4	73%	0.725	62%	0.618	S	S	*	*	H	α-helix	trans	-64.4	-35.1	168.4	-77.3	-178.3	179.5	-176.9	0.9	112.5	A38 S39 F46	A38-R42 WeakPolarHBondContact O-CG 3.29Å; A38-R42 PolarHBondContact O-N 3.22Å; S39-R42 PolarHBondContact O-N 3.34Å; R42-F46 WeakPolarHBondContact O-CB 3.38Å; R42-F46 PolarHBondContact O-N 2.94Å
43	Q	55.4	Low	59.9	Low	140 Å²	140	120 Å²	120	65%	0.654	63%	0.631	S	S	*	*	H	α-helix	trans	-72.3	-30.3	173	-72.7	-174.9	-5.4	0	0	113.1	S39 A40 N41 F46 P47	S39-Q43 PolarHBondContact O-N 2.93Å; A40-Q43 CarbonylContact O-C 3.56Å; A40-Q43 PolarHBondContact O-N 3.45Å; A40-Q43 VanDerWaalsContact O-N 3.14Å; N41-Q43 VanDerWaalsContact C-N 3.32Å; N41-Q43 PolarHBondContact O-N 3.22Å; Q43-F46 CarbonylContact O-C 3.27Å; Q43-F46 VanDerWaalsContact O-C 3.27Å; Q43-P47 VanDerWaalsContact O-CB 3.25Å; Q43-P47 WeakPolarHBondContact O-CB 3.22Å; Q43-P47 WeakPolarHBondContact O-CD 3.35Å; Q43-P47 WeakPolarHBondContact O-CG 3.5Å
44	L	54	Low	57.7	Low	132 Å²	132	121.3 Å²	121.3	69%	0.691	65%	0.649	S	S	*	*	H	α-helix	trans	-83.3	-24.8	176.7	-74.9	168.1	0	0	0	114	A40 N41 P47	A40-L44 WeakPolarHBondContact O-CG 3.32Å; A40-L44 PolarHBondContact O-N 3.1Å; N41-L44 PolarHBondContact O-N 3.34Å; L44-P47 WeakPolarHBondContact O-CD 3.45Å; L44-P47 WeakPolarHBondContact O-CG 3.43Å
45	I	56.3	Low	56.2	Low	115 Å²	115	125 Å²	125	59%	0.59	66%	0.662	S	S	*	*	H	α-helix	trans	-85.2	-23.4	170	-60.6	164.3	0	0	0	110.7	N41 P47	N41-I45 WeakPolarHBondContact O-CB 3.31Å; N41-I45 WeakPolarHBondContact O-CD1 3.36Å; N41-I45 WeakPolarHBondContact O-CG1 3.28Å; N41-I45 PolarHBondContact O-N 2.88Å; I45-P47 VanDerWaalsContact C-CD 3.43Å
46	F	51.8	Low	54.7	Low	162 Å²	162	129.4 Å²	129.4	71%	0.711	68%	0.675	S	S	*	*	S	Bend	trans	-120.9	49.9	172	-67.5	-86.6	0	0	0	116.3	R42 Q43 A48	R42-F46 WeakPolarHBondContact O-CB 3.38Å; R42-F46 PolarHBondContact O-N 2.94Å; Q43-F46 CarbonylContact O-C 3.27Å; Q43-F46 VanDerWaalsContact O-C 3.27Å; F46-A48 PolarHBondContact O-N 3.49Å
47	P	49	Very low	53.3	Low	93 Å²	93	125 Å²	125	60%	0.604	67%	0.672	S	S	*	*	S	Bend	trans	-92.2	38.1	168	36.6	-29.2	0	0	0	110.1	Q43 L44 I45	Q43-P47 VanDerWaalsContact O-CB 3.25Å; Q43-P47 WeakPolarHBondContact O-CB 3.22Å; Q43-P47 WeakPolarHBondContact O-CD 3.35Å; Q43-P47 WeakPolarHBondContact O-CG 3.5Å; L44-P47 WeakPolarHBondContact O-CD 3.45Å; L44-P47 WeakPolarHBondContact O-CG 3.43Å; I45-P47 VanDerWaalsContact C-CD 3.43Å
48	A	51.3	Low	52.6	Low	64 Å²	64	125.7 Å²	125.7	53%	0.529	68%	0.677	S	S	.	*			trans	-154.2	10.8	-174	0	0	0	0	0	116.5	F46 R50	F46-A48 PolarHBondContact O-N 3.49Å; A48-R50 PolarHBondContact O-N 3.03Å
49	G	50.1	Low	51.9	Low	75 Å²	75	131.3 Å²	131.3	77%	0.773	70%	0.699	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.1	3	174.6	0	0	0	0	0	115.5
50	R	50.8	Low	51.4	Low	248 Å²	248	130.7 Å²	130.7	94%	0.936	70%	0.703	S	S	*	*	T	Hydrogen-bonded Turn	trans	-143.4	8.2	-175.1	-78.2	-165.2	174.4	175	-1.6	117.5	A48	A48-R50 PolarHBondContact O-N 3.03Å
51	K	53	Low	50.9	Low	207 Å²	207	138.6 Å²	138.6	90%	0.9	73%	0.73	S	S	*	*	T	Hydrogen-bonded Turn	trans	-137.8	11.7	178.8	-75.2	-168.2	177	-179.4	0	117
52	M	45.6	Very low	50.4	Low	165 Å²	165	140.2 Å²	140.2	81%	0.813	75%	0.747	S	S	*	*	S	Bend	trans	-137.7	37.5	-176.9	-156.6	165.2	159	0	0	114
53	L	52	Low	49.9	Very low	171 Å²	171	136.3 Å²	136.3	90%	0.895	75%	0.749	S	S	*	*			trans	-136.7	58	164.5	-73.6	171.3	0	0	0	109.1	I55	L53-I55 VanDerWaalsContact C-N 3.33Å
54	S	43.3	Very low	49.6	Very low	121 Å²	121	140.6 Å²	140.6	85%	0.846	76%	0.761	S	S	*	*			trans	-104.9	61.6	155.6	-175.9	0	0	0	0	107.2
55	I	50.8	Low	49.1	Very low	149 Å²	149	139.8 Å²	139.8	76%	0.764	77%	0.766	S	S	*	*			trans	-124.9	91.2	153.4	-63.2	172.4	0	0	0	101.2	L53 P57	L53-I55 VanDerWaalsContact C-N 3.33Å; I55-P57 WeakPolarHBondContact O-CD 3.07Å
56	E	48.6	Very low	48.6	Very low	156 Å²	156	149.8 Å²	149.8	73%	0.729	80%	0.797	S	S	*	*			trans	-55.8	131.9	167.2	-104.5	-170.4	103.5	0	0	108.4	S58	E56-S58 WeakPolarHBondContact OE1-CB 3.44Å; E56-S58 PolarHBondContact OE1-OG 3.05Å
57	P	45.3	Very low	48.4	Very low	109 Å²	109	149.2 Å²	149.2	71%	0.708	80%	0.801	S	S	*	*			trans	-120.4	83.5	136.4	34.4	-22.6	0	0	0	106.3	I55 L59	I55-P57 WeakPolarHBondContact O-CD 3.07Å; P57-L59 PolarHBondContact O-N 3.37Å
58	S	53.5	Low	48.4	Very low	86 Å²	86	152.1 Å²	152.1	60%	0.601	81%	0.811	S	S	*	*			trans	-72.7	69	164.5	48.4	0	0	0	0	109.3	E56 G60	E56-S58 WeakPolarHBondContact OE1-CB 3.44Å; E56-S58 PolarHBondContact OE1-OG 3.05Å; S58-G60 VanDerWaalsContact C-N 3.31Å; S58-G60 PolarHBondContact O-N 3.47Å; S58-G60 VanDerWaalsContact O-N 3.09Å
59	L	48.2	Very low	48.3	Very low	172 Å²	172	157 Å²	157	90%	0.901	83%	0.827	S	S	*	*			trans	-67.2	95.1	154.1	-84.7	161.2	0	0	0	106.8	P57	P57-L59 PolarHBondContact O-N 3.37Å
60	G	48.7	Very low	48.1	Very low	55 Å²	55	161.8 Å²	161.8	57%	0.567	83%	0.83	S	S	*	*			trans	-172.4	81.9	-175.6	0	0	0	0	0	113.8	S58	S58-G60 VanDerWaalsContact C-N 3.31Å; S58-G60 PolarHBondContact O-N 3.47Å; S58-G60 VanDerWaalsContact O-N 3.09Å
61	F	48.6	Very low	48	Very low	209 Å²	209	156.4 Å²	156.4	92%	0.917	82%	0.824	S	S	*	*			trans	33	110.7	144	-68.8	-93.1	0	0	0	118.8
62	C	47.4	Very low	47.6	Very low	124 Å²	124	153.1 Å²	153.1	84%	0.838	82%	0.818	S	S	*	*				-171.2	117	122.1	-128.7	0	0	0	0	111.4
63	S	44.9	Very low	47.8	Very low	109 Å²	109	152.2 Å²	152.2	76%	0.762	82%	0.819	S	S	*	*			trans	-51	137.9	158.6	-52.2	0	0	0	0	110.9
64	Y	47.3	Very low	47.5	Very low	230 Å²	230	150.8 Å²	150.8	90%	0.902	81%	0.813	S	S	*	*			trans	-162.4	125.7	139.1	-108.9	-76.7	0	0	0	110.6
65	S	45.1	Very low	47.8	Very low	116 Å²	116	153.3 Å²	153.3	81%	0.811	81%	0.81	S	S	*	*			trans	-64.5	143.9	-177.3	-46.7	0	0	0	0	114
66	R	45.3	Very low	47.5	Very low	324 Å²	324	153.6 Å²	153.6	100%	1.223	81%	0.814	S	S	*	*			trans	-151.5	0	136.1	-117.8	-176.3	-172.6	-172.9	2.8	109.7

Retrieved 66 of 66 residues in 32.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).