A0A077Z8W4_TRITR Loading...

Actin domain containing protein

AlphaFold DB , UniProt , Accession A0A077Z8W4, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 101 aa.

						>A0A077Z8W4_TRITR|A0A077Z8W4
MITFETYFSDFRAPVEMESYDVIANQPIVIDNGSGMIKAGFAGDQTPKCHFPNYVGRPKHIRVMAGALDGDIFVAYPSPPICMYAYAGRSGVAVKGEDSVP
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	39.4	Very low	48.2	Very low	248 Å²	248	152.5 Å²	152.5	100%	1.222	74%	0.741	S	S	*	*				0	70.9	0	-142.1	177.5	-168	0	0	107.2
2	I	44.4	Very low	48.7	Very low	153 Å²	153	156.3 Å²	156.3	79%	0.785	74%	0.742	S	S	*	*			trans	-144.1	101.9	-176.7	-58.2	178.3	0	0	0	107
3	T	38.5	Very low	48.9	Very low	93 Å²	93	149.9 Å²	149.9	57%	0.571	73%	0.731	S	S	*	*			trans	44.3	83.6	151.1	65.9	0	0	0	0	119.9	E5 T6	T3-E5 VanDerWaalsContact C-N 3.3Å; T3-T6 HydrophobicContact CG2-CG2 4.37Å
4	F	51.7	Low	49.4	Very low	205 Å²	205	147.4 Å²	147.4	90%	0.899	73%	0.732	S	S	*	*	S	Bend	trans	-81.6	-10.6	152.4	-104.7	-95	0	0	0	112.4
5	E	51.7	Low	50.3	Low	170 Å²	170	145.8 Å²	145.8	79%	0.794	73%	0.733	S	S	*	*	S	Bend	trans	-81.3	-18.1	-173.4	-70.6	-168.4	149.3	0	0	114.8	T3 Y7 S9	T3-E5 VanDerWaalsContact C-N 3.3Å; E5-Y7 PolarHBondContact O-N 3.35Å; E5-S9 PolarHBondContact O-OG 2.83Å
6	T	50.3	Low	50.9	Low	72 Å²	72	148.6 Å²	148.6	44%	0.442	74%	0.743	S	S	.	*	H	α-helix	trans	-76.3	-24.7	-173.4	45.6	0	0	0	0	113.9	T3 S9	T3-T6 HydrophobicContact CG2-CG2 4.37Å; T6-S9 PolarHBondContact O-OG 3.05Å
7	Y	50	Low	51.6	Low	204 Å²	204	146.3 Å²	146.3	80%	0.8	73%	0.731	S	S	*	*	H	α-helix	trans	-82.3	-23	-178.1	-95.7	-86.3	0	0	0	114.4	E5	E5-Y7 PolarHBondContact O-N 3.35Å
8	F	45.6	Very low	52.3	Low	159 Å²	159	145 Å²	145	70%	0.697	72%	0.722	S	S	*	*	H	α-helix	trans	-84.1	-21.2	-176.8	-162.2	-100.8	0	0	0	112.6
9	S	48.8	Very low	53	Low	69 Å²	69	141.1 Å²	141.1	48%	0.483	71%	0.71	S	S	.	*	H	α-helix	trans	-75.2	-35.3	178.1	25.9	0	0	0	0	113.6	E5 T6 F11 R12	E5-S9 PolarHBondContact O-OG 2.83Å; T6-S9 PolarHBondContact O-OG 3.05Å; S9-F11 VanDerWaalsContact C-N 3.27Å; S9-F11 PolarHBondContact O-N 3.02Å; S9-R12 PolarHBondContact O-N 3.24Å
10	D	56.9	Low	53.7	Low	131 Å²	131	143.1 Å²	143.1	70%	0.701	71%	0.71	S	S	*	*	G	3₁₀ helix	trans	-70.6	-22.9	-174.7	-71.5	-13.3	0	0	0	113.2	R12	D10-R12 VanDerWaalsContact C-N 3.3Å; D10-R12 PolarHBondContact O-N 3.14Å
11	F	52.9	Low	54.2	Low	173 Å²	173	140 Å²	140	76%	0.759	70%	0.697	S	S	*	*	G	3₁₀ helix	trans	-84.2	-3.9	-179.8	-146.4	-96	0	0	0	113.7	S9	S9-F11 VanDerWaalsContact C-N 3.27Å; S9-F11 PolarHBondContact O-N 3.02Å
12	R	54.4	Low	55.3	Low	199 Å²	199	132.2 Å²	132.2	75%	0.751	66%	0.663	S	S	*	*	G	3₁₀ helix	trans	-107.9	-4.1	-170.8	-148.2	-178.8	177.9	117.5	-0.9	114	S9 D10	S9-R12 PolarHBondContact O-N 3.24Å; D10-R12 VanDerWaalsContact C-N 3.3Å; D10-R12 PolarHBondContact O-N 3.14Å
13	A	51.3	Low	56.3	Low	73 Å²	73	131.9 Å²	131.9	60%	0.603	66%	0.661	S	S	*	*	S	Bend	trans	-74.3	123.3	171.7	0	0	0	0	0	109	V15	A13-V15 PolarHBondContact O-N 2.8Å; A13-V15 VanDerWaalsContact O-N 3.16Å
14	P	55.6	Low	58	Low	114 Å²	114	131.1 Å²	131.1	74%	0.74	66%	0.664	S	S	*	*			trans	-59.4	123.2	168.6	24.6	-29.9	0	0	0	107.5	E16	P14-E16 PolarHBondContact O-N 3.07Å
15	V	63.1	Low	59.2	Low	124 Å²	124	125.7 Å²	125.7	75%	0.752	64%	0.644	S	S	*	*			trans	-61.5	106.1	165.2	-118.3	0	0	0	0	105.6	A13 M17	A13-V15 PolarHBondContact O-N 2.8Å; A13-V15 VanDerWaalsContact O-N 3.16Å; V15-M17 PolarHBondContact O-N 2.97Å
16	E	60.6	Low	60.5	Low	191 Å²	191	122.9 Å²	122.9	89%	0.893	63%	0.631	S	S	*	*			trans	-64	94.5	167.5	-70.9	-150	158.9	0	0	106.9	P14 E18	P14-E16 PolarHBondContact O-N 3.07Å; E16-E18 PolarHBondContact O-N 2.8Å
17	M	61.9	Low	62	Low	109 Å²	109	123 Å²	123	54%	0.537	63%	0.633	S	S	.	*			trans	-79.3	115.5	174.6	-167.6	175.1	-78.5	0	0	106.6	V15 S19 D21 V22	V15-M17 PolarHBondContact O-N 2.97Å; M17-S19 PolarHBondContact O-N 3.37Å; M17-D21 HydrophobicContact CG-CB 3.87Å; M17-V22 HydrophobicContact CB-CG2 4.14Å; M17-V22 HydrophobicContact CG-CG2 3.66Å; M17-V22 HydrophobicContact SD-CB 4.27Å; M17-V22 HydrophobicContact SD-CG2 3.43Å; M17-V22 WeakPolarHBondContact SD-CG2 3.43Å
18	E	64.1	Low	63.6	Low	123 Å²	123	116.4 Å²	116.4	58%	0.575	61%	0.611	S	S	*	*			trans	-53	134.3	172	-94.1	-71.3	177.6	0	0	108.7	E16 Y20 D21 V22	E16-E18 PolarHBondContact O-N 2.8Å; E18-Y20 PolarHBondContact O-N 3.39Å; E18-D21 WeakPolarHBondContact O-CB 2.73Å; E18-D21 PolarHBondContact O-N 2.81Å; E18-V22 PolarHBondContact O-N 3.25Å
19	S	66.6	Low	65.4	Low	70 Å²	70	112.9 Å²	112.9	49%	0.49	60%	0.603	S	S	.	*	H	α-helix	trans	-55.7	-27.2	-173.9	61.1	0	0	0	0	112.8	M17 I23	M17-S19 PolarHBondContact O-N 3.37Å; S19-I23 WeakPolarHBondContact O-CD1 3.34Å; S19-I23 VanDerWaalsContact O-CG1 3.29Å; S19-I23 WeakPolarHBondContact O-CG1 3.33Å; S19-I23 PolarHBondContact O-N 2.86Å
20	Y	65.5	Low	67.2	Low	181 Å²	181	113.8 Å²	113.8	71%	0.71	60%	0.601	S	S	*	*	H	α-helix	trans	-66	-35.8	173.4	-72.2	-79.6	0	0	0	113.4	E18 I23 A24	E18-Y20 PolarHBondContact O-N 3.39Å; Y20-I23 PolarHBondContact O-N 2.86Å; Y20-A24 VanDerWaalsContact O-CB 3.23Å; Y20-A24 WeakPolarHBondContact O-CB 3.17Å; Y20-A24 PolarHBondContact O-N 2.94Å
21	D	65.5	Low	68.7	Low	80 Å²	80	111.6 Å²	111.6	43%	0.428	59%	0.589	S	S	.	*	H	α-helix	trans	-72.3	-32.1	179.4	-69.4	-38.6	0	0	0	112.2	M17 E18 I23 N25	M17-D21 HydrophobicContact CG-CB 3.87Å; E18-D21 WeakPolarHBondContact O-CB 2.73Å; E18-D21 PolarHBondContact O-N 2.81Å; D21-I23 VanDerWaalsContact C-N 3.32Å; D21-N25 WeakPolarHBondContact O-CB 3.49Å; D21-N25 PolarHBondContact O-N 2.95Å; D21-N25 PolarHBondContact O-ND2 2.83Å
22	V	62.6	Low	70.4	Confident	84 Å²	84	108.5 Å²	108.5	51%	0.509	58%	0.581	S	S	.	*	H	α-helix	trans	-66.5	-36.1	174.4	-174.6	0	0	0	0	111.1	M17 E18	M17-V22 HydrophobicContact CB-CG2 4.14Å; M17-V22 HydrophobicContact CG-CG2 3.66Å; M17-V22 HydrophobicContact SD-CB 4.27Å; M17-V22 HydrophobicContact SD-CG2 3.43Å; M17-V22 WeakPolarHBondContact SD-CG2 3.43Å; E18-V22 PolarHBondContact O-N 3.25Å
23	I	65.9	Low	71.9	Confident	145 Å²	145	100.1 Å²	100.1	74%	0.744	56%	0.556	S	S	*	*	H	α-helix	trans	-85.7	-34.5	-175.8	-60.3	164	0	0	0	111.2	S19 Y20 D21	S19-I23 WeakPolarHBondContact O-CD1 3.34Å; S19-I23 VanDerWaalsContact O-CG1 3.29Å; S19-I23 WeakPolarHBondContact O-CG1 3.33Å; S19-I23 PolarHBondContact O-N 2.86Å; Y20-I23 PolarHBondContact O-N 2.86Å; D21-I23 VanDerWaalsContact C-N 3.32Å
24	A	73.3	Confident	73.4	Confident	77 Å²	77	102.2 Å²	102.2	64%	0.636	57%	0.566	S	S	*	*	H	α-helix	trans	-77.9	-31.7	-178.1	0	0	0	0	0	113.2	Y20	Y20-A24 VanDerWaalsContact O-CB 3.23Å; Y20-A24 WeakPolarHBondContact O-CB 3.17Å; Y20-A24 PolarHBondContact O-N 2.94Å
25	N	75.8	Confident	74.6	Confident	92 Å²	92	98.1 Å²	98.1	49%	0.492	55%	0.545	S	S	.	.	S	Bend	trans	-103.3	122.8	-174.1	-60.9	-55.7	0	0	0	111.2	D21 P27	D21-N25 WeakPolarHBondContact O-CB 3.49Å; D21-N25 PolarHBondContact O-N 2.95Å; D21-N25 PolarHBondContact O-ND2 2.83Å; N25-P27 VanDerWaalsContact O-CD 3.25Å; N25-P27 WeakPolarHBondContact O-CD 3.2Å
26	Q	80.8	Confident	75.7	Confident	110 Å²	110	95.9 Å²	95.9	51%	0.514	53%	0.527	S	S	.	.	P	Polyproline II helix	trans	-67.1	117	170.2	-177.8	66.5	52.2	0	0	109.2	F41 A42	Q26-F41 HydrophobicContact CB-CD1 4.2Å; Q26-F41 HydrophobicContact CG-CB 3.75Å; Q26-F41 HydrophobicContact CG-CD1 3.59Å; Q26-F41 HydrophobicContact CG-CE1 4.45Å; Q26-F41 HydrophobicContact CG-CG 3.9Å; Q26-A42 PolarHBondContact NE2-O 2.99Å
27	P	80.4	Confident	76.8	Confident	74 Å²	74	87.5 Å²	87.5	48%	0.481	49%	0.488	S	S	.	.	P	Polyproline II helix	trans	-67.2	142.2	-177.1	19.8	-25.5	0	0	0	111.3	N25 F41 A42	N25-P27 VanDerWaalsContact O-CD 3.25Å; N25-P27 WeakPolarHBondContact O-CD 3.2Å; P27-F41 CarbonylContact O-C 3.57Å; P27-F41 WeakPolarHBondContact O-CA 3.39Å; P27-A42 HydrophobicContact CB-CB 4.33Å; P27-A42 HydrophobicContact CG-CB 3.68Å; P27-A42 PolarHBondContact O-N 2.97Å
28	I	83.3	Confident	78	Confident	67 Å²	67	86.4 Å²	86.4	34%	0.344	48%	0.48	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.6	128.5	172.3	-60.5	174.3	0	0	0	107.9	I30 A39 G40 F41	I28-I30 HydrophobicContact CG2-CG1 4.02Å; I28-A39 HydrophobicContact CG2-CB 4.45Å; I28-G40 CarbonylContact C-O 3.56Å; I28-G40 WeakPolarHBondContact CA-O 3.25Å; I28-F41 HydrophobicContact CG1-CD1 4.06Å; I28-F41 HydrophobicContact CG1-CE1 4.1Å
29	V	84.3	Confident	79	Confident	85 Å²	85	80.8 Å²	80.8	52%	0.515	46%	0.455	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.1	128	173.3	-176.8	0	0	0	0	108	A39 G40 A42	V29-A39 WeakPolarHBondContact O-CA 3.34Å; V29-G40 PolarHBondContact N-O 3.36Å; V29-G40 PolarHBondContact O-N 3.35Å; V29-A42 HydrophobicContact CG2-CB 3.91Å
30	I	87.2	Confident	80	Confident	88 Å²	88	77.8 Å²	77.8	45%	0.451	44%	0.435	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121	115.9	177	-54.6	175	0	0	0	108.2	I28 I37 K38 A39 A85	I28-I30 HydrophobicContact CG2-CG1 4.02Å; I30-I37 HydrophobicContact CG2-CG2 3.84Å; I30-K38 CarbonylContact C-O 3.58Å; I30-K38 WeakPolarHBondContact CA-O 3.19Å; I30-A39 HydrophobicContact CG1-CB 4.04Å; I30-A85 HydrophobicContact CD1-CB 4.21Å
31	D	88.4	Confident	81	Confident	84 Å²	84	72.9 Å²	72.9	45%	0.449	42%	0.417	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.7	109.2	172.1	176.9	31	0	0	0	108.8	G33 I37 K38	D31-G33 PolarHBondContact O-N 3.07Å; D31-I37 WeakPolarHBondContact O-CA 3.29Å; D31-K38 HydrophobicContact CB-CB 4.23Å; D31-K38 PolarHBondContact N-O 2.79Å; D31-K38 PolarHBondContact O-N 3.22Å; D31-K38 IonicContact OD2-NZ 3.84Å
32	N	87.1	Confident	81.9	Confident	109 Å²	109	70.7 Å²	70.7	58%	0.583	41%	0.41	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-90.5	73.4	-177.9	-173.8	22.5	0	0	0	111.2	N53	N32-N53 PolarHBondContact OD1-ND2 2.71Å
33	G	86.9	Confident	83	Confident	22 Å²	22	70.8 Å²	70.8	23%	0.227	43%	0.428	C	S	.	.			trans	-72.3	146.8	172.5	0	0	0	0	0	111.9	D31 G35 M36 N53	D31-G33 PolarHBondContact O-N 3.07Å; G33-G35 VanDerWaalsContact C-N 3.26Å; G33-G35 PolarHBondContact O-N 2.99Å; G33-M36 CarbonylContact C-O 3.57Å; G33-M36 WeakPolarHBondContact CA-O 3.46Å; G33-M36 PolarHBondContact N-O 3.46Å; G33-M36 VanDerWaalsContact N-O 3.14Å; G33-M36 CarbonylContact O-C 3.6Å; G33-M36 PolarHBondContact O-N 2.86Å; G33-N53 WeakPolarHBondContact O-CB 3.38Å; G33-N53 PolarHBondContact O-ND2 3.15Å
34	S	82.2	Confident	84.1	Confident	118 Å²	118	67.3 Å²	67.3	83%	0.825	41%	0.411	S	S	*	.	S	Bend	trans	-62.3	-29.6	-178.7	57.9	0	0	0	0	114.2
35	G	82	Confident	85	Confident	28 Å²	28	73 Å²	73	29%	0.289	43%	0.425	S	S	.	.	S	Bend	trans	-102.2	-22.5	175.6	0	0	0	0	0	114.2	G33 P52 N53	G33-G35 VanDerWaalsContact C-N 3.26Å; G33-G35 PolarHBondContact O-N 2.99Å; G35-P52 WeakPolarHBondContact O-CA 3.5Å; G35-N53 PolarHBondContact O-N 3.45Å
36	M	84.4	Confident	85.5	Confident	77 Å²	77	73 Å²	73	38%	0.379	43%	0.429	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-152.2	128.5	-172	-174.8	170	-75	0	0	110.4	G33 K38 H50 F51	G33-M36 CarbonylContact C-O 3.57Å; G33-M36 WeakPolarHBondContact CA-O 3.46Å; G33-M36 PolarHBondContact N-O 3.46Å; G33-M36 VanDerWaalsContact N-O 3.14Å; G33-M36 CarbonylContact O-C 3.6Å; G33-M36 PolarHBondContact O-N 2.86Å; M36-K38 HydrophobicContact CG-CG 4.45Å; M36-H50 HydrophobicContact CG-CB 4.19Å; M36-H50 HydrophobicContact SD-CB 3.9Å; M36-F51 CarbonylContact C-O 3.56Å; M36-F51 WeakPolarHBondContact CA-O 3.43Å; M36-F51 WeakPolarHBondContact CG-O 3.43Å
37	I	85.7	Confident	85.8	Confident	14 Å²	14	70.9 Å²	70.9	7%	0.072	42%	0.424	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.4	138.3	167.5	-63.1	179.8	0	0	0	107.9	I30 D31 H50 F51 N53	I30-I37 HydrophobicContact CG2-CG2 3.84Å; D31-I37 WeakPolarHBondContact O-CA 3.29Å; I37-H50 CarbonylContact O-C 3.59Å; I37-H50 WeakPolarHBondContact O-CA 3.37Å; I37-F51 HydrophobicContact CB-CD1 4.32Å; I37-F51 HydrophobicContact CB-CE1 3.75Å; I37-F51 HydrophobicContact CB-CE2 4Å; I37-F51 HydrophobicContact CB-CZ 3.6Å; I37-F51 HydrophobicContact CD1-CE2 3.81Å; I37-F51 HydrophobicContact CD1-CZ 3.75Å; I37-F51 HydrophobicContact CG1-CE2 4.3Å; I37-F51 HydrophobicContact CG1-CZ 4.2Å; I37-F51 HydrophobicContact CG2-CE1 3.62Å; I37-F51 HydrophobicContact CG2-CE2 4.49Å; I37-F51 HydrophobicContact CG2-CZ 3.61Å; I37-F51 PolarHBondContact N-O 3.44Å; I37-F51 PolarHBondContact O-N 2.97Å; I37-N53 HydrophobicContact CD1-CB 4.36Å; I37-N53 WeakPolarHBondContact CD1-OD1 3.45Å; I37-N53 HydrophobicContact CG1-CB 3.88Å
38	K	86.1	Confident	86.1	Confident	86 Å²	86	72 Å²	72	37%	0.374	42%	0.421	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.1	137.7	170.2	-53.6	168.6	-172.5	157.8	0	109	I30 D31 M36 P47 C49 H50	I30-K38 CarbonylContact C-O 3.58Å; I30-K38 WeakPolarHBondContact CA-O 3.19Å; D31-K38 HydrophobicContact CB-CB 4.23Å; D31-K38 PolarHBondContact N-O 2.79Å; D31-K38 PolarHBondContact O-N 3.22Å; D31-K38 IonicContact OD2-NZ 3.84Å; M36-K38 HydrophobicContact CG-CG 4.45Å; K38-P47 HydrophobicContact CB-CB 3.98Å; K38-P47 HydrophobicContact CB-CG 4.47Å; K38-C49 CarbonylContact C-O 3.59Å; K38-C49 WeakPolarHBondContact CA-O 3.35Å; K38-H50 HydrophobicContact CG-CB 4.11Å
39	A	85.8	Confident	86.1	Confident	5 Å²	5	68.9 Å²	68.9	4%	0.041	41%	0.406	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.6	153.5	171.5	0	0	0	0	0	112.7	I28 V29 I30 P47 K48 C49	I28-A39 HydrophobicContact CG2-CB 4.45Å; V29-A39 WeakPolarHBondContact O-CA 3.34Å; I30-A39 HydrophobicContact CG1-CB 4.04Å; A39-P47 CarbonylContact O-C 3.54Å; A39-K48 PolarHBondContact O-N 3.47Å; A39-C49 WeakPolarHBondContact CB-SG 3.23Å; A39-C49 PolarHBondContact N-O 2.84Å; A39-C49 PolarHBondContact O-N 2.93Å
40	G	86.6	Confident	86.1	Confident	7 Å²	7	70.4 Å²	70.4	7%	0.072	41%	0.407	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-170.4	173.5	177.9	0	0	0	0	0	111.5	I28 V29	I28-G40 CarbonylContact C-O 3.56Å; I28-G40 WeakPolarHBondContact CA-O 3.25Å; V29-G40 PolarHBondContact N-O 3.36Å; V29-G40 PolarHBondContact O-N 3.35Å
41	F	86.2	Confident	85.9	Confident	78 Å²	78	66.5 Å²	66.5	34%	0.342	39%	0.387	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-76.8	145.1	171.8	-62.4	-68	0	0	0	110	Q26 P27 I28 D44 K48 I81	Q26-F41 HydrophobicContact CB-CD1 4.2Å; Q26-F41 HydrophobicContact CG-CB 3.75Å; Q26-F41 HydrophobicContact CG-CD1 3.59Å; Q26-F41 HydrophobicContact CG-CE1 4.45Å; Q26-F41 HydrophobicContact CG-CG 3.9Å; P27-F41 CarbonylContact O-C 3.57Å; P27-F41 WeakPolarHBondContact O-CA 3.39Å; I28-F41 HydrophobicContact CG1-CD1 4.06Å; I28-F41 HydrophobicContact CG1-CE1 4.1Å; F41-D44 PolarHBondContact O-N 3.16Å; F41-K48 HydrophobicContact CD2-CG 4.47Å; F41-I81 HydrophobicContact CD1-CD1 4.32Å; F41-I81 HydrophobicContact CD2-CD1 3.7Å; F41-I81 HydrophobicContact CE1-CD1 3.94Å; F41-I81 HydrophobicContact CE1-CG1 4.49Å; F41-I81 HydrophobicContact CE2-CD1 3.25Å; F41-I81 HydrophobicContact CE2-CG1 4.3Å; F41-I81 HydrophobicContact CG-CD1 4.22Å; F41-I81 HydrophobicContact CZ-CD1 3.39Å; F41-I81 HydrophobicContact CZ-CG1 4.01Å
42	A	85.4	Confident	85.6	Confident	34 Å²	34	64.1 Å²	64.1	28%	0.281	38%	0.376	S	S	.	.	T	Hydrogen-bonded Turn	trans	-60	140.5	174.5	0	0	0	0	0	110.8	Q26 P27 V29 D44	Q26-A42 PolarHBondContact NE2-O 2.99Å; P27-A42 HydrophobicContact CB-CB 4.33Å; P27-A42 HydrophobicContact CG-CB 3.68Å; P27-A42 PolarHBondContact O-N 2.97Å; V29-A42 HydrophobicContact CG2-CB 3.91Å; A42-D44 VanDerWaalsContact C-N 3.33Å
43	G	86.2	Confident	85.3	Confident	86 Å²	86	61.5 Å²	61.5	89%	0.887	36%	0.362	S	S	*	.	T	Hydrogen-bonded Turn	trans	88.7	-13.5	-179	0	0	0	0	0	115.1
44	D	89	Confident	84.9	Confident	72 Å²	72	67.1 Å²	67.1	39%	0.385	38%	0.377	S	S	.	.			trans	-71	146.2	169.3	-82.5	-55	0	0	0	111.6	F41 A42 T46 K48	F41-D44 PolarHBondContact O-N 3.16Å; A42-D44 VanDerWaalsContact C-N 3.33Å; D44-T46 VanDerWaalsContact C-N 3.35Å; D44-K48 IonicContact OD1-NZ 3.02Å; D44-K48 PolarHBondContact OD1-NZ 3.29Å; D44-K48 WeakPolarHBondContact OD2-CE 3.37Å; D44-K48 IonicContact OD2-NZ 3.05Å; D44-K48 PolarHBondContact OD2-NZ 2.99Å
45	Q	90.3	Very high	84.6	Confident	198 Å²	198	65.6 Å²	65.6	93%	0.925	36%	0.363	S	S	*	.	S	Bend	trans	-76.4	-20.7	179.6	-64.9	-174.3	31	0	0	113.7
46	T	87.9	Confident	83.9	Confident	92 Å²	92	66 Å²	66	56%	0.564	37%	0.367	S	S	*	.	S	Bend	trans	-137.9	144.2	-174.3	59.2	0	0	0	0	110.7	D44	D44-T46 VanDerWaalsContact C-N 3.35Å
47	P	87.3	Confident	83.4	Confident	64 Å²	64	70.8 Å²	70.8	42%	0.416	38%	0.38	S	S	.	.			trans	-61.4	139.9	175.4	28	-35	0	0	0	110.6	K38 A39	K38-P47 HydrophobicContact CB-CB 3.98Å; K38-P47 HydrophobicContact CB-CG 4.47Å; A39-P47 CarbonylContact O-C 3.54Å
48	K	86.9	Confident	82.6	Confident	97 Å²	97	72.7 Å²	72.7	42%	0.422	39%	0.394	S	S	.	.	S	Bend	trans	-78	-27.8	176.9	-61.9	-62.1	178.4	-169.9	0	112	A39 F41 D44 I81	A39-K48 PolarHBondContact O-N 3.47Å; F41-K48 HydrophobicContact CD2-CG 4.47Å; D44-K48 IonicContact OD1-NZ 3.02Å; D44-K48 PolarHBondContact OD1-NZ 3.29Å; D44-K48 WeakPolarHBondContact OD2-CE 3.37Å; D44-K48 IonicContact OD2-NZ 3.05Å; D44-K48 PolarHBondContact OD2-NZ 2.99Å; K48-I81 HydrophobicContact CB-CD1 3.99Å; K48-I81 HydrophobicContact CB-CG2 4Å; K48-I81 HydrophobicContact CG-CD1 3.97Å
49	C	82.9	Confident	82.1	Confident	3 Å²	3	77.5 Å²	77.5	2%	0.02	42%	0.415	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.6	149.9	174.2	78.4	0	0	0	0	111	K38 A39 P79 I81 C82	K38-C49 CarbonylContact C-O 3.59Å; K38-C49 WeakPolarHBondContact CA-O 3.35Å; A39-C49 WeakPolarHBondContact CB-SG 3.23Å; A39-C49 PolarHBondContact N-O 2.84Å; A39-C49 PolarHBondContact O-N 2.93Å; C49-P79 HydrophobicContact CB-CG 3.25Å; C49-I81 HydrophobicContact CB-CG2 4.13Å; C49-C82 HydrophobicContact CB-CB 4.47Å
50	H	84.1	Confident	81.7	Confident	116 Å²	116	83.7 Å²	83.7	54%	0.537	44%	0.443	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-145	134.9	165.9	56.4	-86.1	0	0	0	108	M36 I37 K38	M36-H50 HydrophobicContact CG-CB 4.19Å; M36-H50 HydrophobicContact SD-CB 3.9Å; I37-H50 CarbonylContact O-C 3.59Å; I37-H50 WeakPolarHBondContact O-CA 3.37Å; K38-H50 HydrophobicContact CG-CB 4.11Å
51	F	82.8	Confident	80.9	Confident	7 Å²	7	91 Å²	91	3%	0.031	48%	0.478	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-147.3	152.7	179.6	59.3	-79.9	0	0	0	109.7	M36 I37 N53 V74 C82 Y86	M36-F51 CarbonylContact C-O 3.56Å; M36-F51 WeakPolarHBondContact CA-O 3.43Å; M36-F51 WeakPolarHBondContact CG-O 3.43Å; I37-F51 HydrophobicContact CB-CD1 4.32Å; I37-F51 HydrophobicContact CB-CE1 3.75Å; I37-F51 HydrophobicContact CB-CE2 4Å; I37-F51 HydrophobicContact CB-CZ 3.6Å; I37-F51 HydrophobicContact CD1-CE2 3.81Å; I37-F51 HydrophobicContact CD1-CZ 3.75Å; I37-F51 HydrophobicContact CG1-CE2 4.3Å; I37-F51 HydrophobicContact CG1-CZ 4.2Å; I37-F51 HydrophobicContact CG2-CE1 3.62Å; I37-F51 HydrophobicContact CG2-CE2 4.49Å; I37-F51 HydrophobicContact CG2-CZ 3.61Å; I37-F51 PolarHBondContact N-O 3.44Å; I37-F51 PolarHBondContact O-N 2.97Å; F51-N53 PolarHBondContact O-N 2.89Å; F51-V74 HydrophobicContact CD2-CG1 3.75Å; F51-V74 HydrophobicContact CE2-CG1 3.92Å; F51-C82 WeakPolarHBondContact CE1-SG 3.14Å; F51-Y86 HydrophobicContact CZ-CE2 4.22Å
52	P	81.7	Confident	79.9	Confident	33 Å²	33	92 Å²	92	21%	0.214	48%	0.48	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-59	137.4	177.3	-21.4	33	0	0	0	111.3	G35 Y54 A75	G35-P52 WeakPolarHBondContact O-CA 3.5Å; P52-Y54 HydrophobicContact CB-CD2 3.38Å; P52-Y54 HydrophobicContact CB-CE2 3.71Å; P52-Y54 HydrophobicContact CB-CG 4.37Å; P52-Y54 PolarHBondContact O-N 3.23Å; P52-A75 HydrophobicContact CB-CB 4.38Å; P52-A75 HydrophobicContact CG-CB 4.29Å
53	N	81.5	Confident	78.9	Confident	54 Å²	54	97.2 Å²	97.2	29%	0.289	51%	0.508	S	S	.	.	S	Bend	trans	-80.5	54.7	178.4	-165.5	2.4	0	0	0	111.6	N32 G33 G35 I37 F51	N32-N53 PolarHBondContact OD1-ND2 2.71Å; G33-N53 WeakPolarHBondContact O-CB 3.38Å; G33-N53 PolarHBondContact O-ND2 3.15Å; G35-N53 PolarHBondContact O-N 3.45Å; I37-N53 HydrophobicContact CD1-CB 4.36Å; I37-N53 WeakPolarHBondContact CD1-OD1 3.45Å; I37-N53 HydrophobicContact CG1-CB 3.88Å; F51-N53 PolarHBondContact O-N 2.89Å
54	Y	76.9	Confident	77.9	Confident	140 Å²	140	100.6 Å²	100.6	55%	0.549	50%	0.503	S	S	.	.			trans	-131.4	136.2	-177.2	-49.1	-56.8	0	0	0	110.8	P52	P52-Y54 HydrophobicContact CB-CD2 3.38Å; P52-Y54 HydrophobicContact CB-CE2 3.71Å; P52-Y54 HydrophobicContact CB-CG 4.37Å; P52-Y54 PolarHBondContact O-N 3.23Å
55	V	76.9	Confident	76.7	Confident	87 Å²	87	102 Å²	102	53%	0.527	52%	0.524	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.5	118.3	173.6	177	0	0	0	0	108.3	I72 F73	V55-I72 HydrophobicContact CG1-CG2 3.54Å; V55-F73 CarbonylContact C-O 3.57Å; V55-F73 WeakPolarHBondContact CA-O 3.21Å
56	G	67.1	Low	75.5	Confident	36 Å²	36	96.7 Å²	96.7	37%	0.371	52%	0.523	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.7	140.2	173.1	0	0	0	0	0	111.3	F73	G56-F73 PolarHBondContact N-O 3.44Å; G56-F73 PolarHBondContact O-N 3.21Å
57	R	73.5	Confident	74.3	Confident	177 Å²	177	94.5 Å²	94.5	67%	0.668	51%	0.513	S	S	*	.			trans	-124.3	142.5	168.9	-64.2	-174.2	178.6	179.3	-3.2	109.6	K59	R57-K59 PolarHBondContact O-N 3.01Å
58	P	70.5	Confident	73.2	Confident	55 Å²	55	97.6 Å²	97.6	36%	0.357	53%	0.526	S	S	.	.			trans	-65.5	124.3	177.5	26.5	-31.2	0	0	0	109.9	H60 D71	P58-H60 VanDerWaalsContact C-N 3.32Å; P58-D71 WeakPolarHBondContact CD-O 3.29Å
59	K	75.1	Confident	72.2	Confident	186 Å²	186	100.1 Å²	100.1	81%	0.809	54%	0.544	S	S	*	.	S	Bend	trans	-72	-28.2	178.4	-174.9	179.7	176.8	-175.1	0	112.7	R57	R57-K59 PolarHBondContact O-N 3.01Å
60	H	76.4	Confident	71.4	Confident	136 Å²	136	101.8 Å²	101.8	63%	0.63	56%	0.562	S	S	*	*	S	Bend	trans	-126.2	150.3	-173.5	-62.4	-65.3	0	0	0	110.3	P58 R62	P58-H60 VanDerWaalsContact C-N 3.32Å; H60-R62 PolarHBondContact O-N 3.47Å
61	I	71	Confident	70.7	Confident	159 Å²	159	101 Å²	101	82%	0.815	56%	0.562	S	S	*	*			trans	-53.8	135.8	170.6	-59.6	169.2	0	0	0	107.8	V63	I61-V63 VanDerWaalsContact O-CG2 3.26Å; I61-V63 WeakPolarHBondContact O-CG2 3.34Å; I61-V63 PolarHBondContact O-N 3.43Å; I61-V63 VanDerWaalsContact O-N 3.16Å
62	R	64.3	Low	70	Confident	99 Å²	99	104.7 Å²	104.7	37%	0.374	58%	0.58	S	S	.	*			trans	-63.4	118.6	-177.7	-57.4	179.4	-158.9	171.8	7.1	109	H60 L68 D69 G70 D71	H60-R62 PolarHBondContact O-N 3.47Å; R62-L68 PolarHBondContact NH1-O 3.33Å; R62-D69 IonicContact NH1-OD1 3.81Å; R62-G70 PolarHBondContact NH2-O 2.91Å; R62-D71 IonicContact CZ-OD1 2.8Å; R62-D71 IonicContact NH2-OD1 3.51Å; R62-D71 PolarHBondContact NH2-OD1 2.97Å
63	V	65	Low	69.2	Low	144 Å²	144	106.3 Å²	106.3	87%	0.873	58%	0.584	S	S	*	*			trans	-103.8	-14.7	177.8	-166.5	0	0	0	0	111.3	I61	I61-V63 VanDerWaalsContact O-CG2 3.26Å; I61-V63 WeakPolarHBondContact O-CG2 3.34Å; I61-V63 PolarHBondContact O-N 3.43Å; I61-V63 VanDerWaalsContact O-N 3.16Å
64	M	65	Low	68.7	Low	158 Å²	158	107 Å²	107	78%	0.778	59%	0.59	S	S	*	*	S	Bend	trans	-99.7	125.9	-175.5	-161.6	166.3	-135.2	0	0	111.6	A67	M64-A67 PolarHBondContact O-N 2.78Å
65	A	63	Low	67.8	Low	102 Å²	102	102.2 Å²	102.2	84%	0.843	58%	0.58	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.8	132.7	170.8	0	0	0	0	0	110.1
66	G	65.5	Low	67.1	Low	86 Å²	86	106.4 Å²	106.4	89%	0.887	59%	0.588	S	S	*	*	T	Hydrogen-bonded Turn	trans	87.8	10	-178.3	0	0	0	0	0	115.6
67	A	62.2	Low	66.7	Low	45 Å²	45	110.1 Å²	110.1	37%	0.372	61%	0.605	S	S	.	*	P	Polyproline II helix	trans	-64.5	148.3	169.1	0	0	0	0	0	111	M64 D69	M64-A67 PolarHBondContact O-N 2.78Å; A67-D69 PolarHBondContact O-N 2.97Å
68	L	65	Low	65.8	Low	130 Å²	130	103.4 Å²	103.4	68%	0.681	59%	0.585	S	S	*	*	P	Polyproline II helix	trans	-54.4	137.2	178.5	-66.9	172.4	0	0	0	111.2	R62 F73	R62-L68 PolarHBondContact NH1-O 3.33Å; L68-F73 HydrophobicContact CB-CE1 3.63Å; L68-F73 HydrophobicContact CB-CZ 4.06Å; L68-F73 HydrophobicContact CD1-CD1 4.27Å; L68-F73 HydrophobicContact CD1-CE1 3.86Å; L68-F73 HydrophobicContact CG-CE1 4.41Å
69	D	65.1	Low	65.2	Low	150 Å²	150	103.3 Å²	103.3	80%	0.802	59%	0.585	S	S	*	*	S	Bend	trans	-71.7	146.3	171.7	-70.7	-40.8	0	0	0	111.5	R62 A67	R62-D69 IonicContact NH1-OD1 3.81Å; A67-D69 PolarHBondContact O-N 2.97Å
70	G	67.6	Low	64.1	Low	38 Å²	38	98.7 Å²	98.7	39%	0.392	57%	0.574	S	S	.	*			trans	100.2	150.6	-176.8	0	0	0	0	0	115.3	R62 F73	R62-G70 PolarHBondContact NH2-O 2.91Å; G70-F73 VanDerWaalsContact O-CE2 3.27Å; G70-F73 WeakPolarHBondContact O-CE2 3.4Å; G70-F73 WeakPolarHBondContact O-CZ 3.14Å
71	D	67.9	Low	63.1	Low	100 Å²	100	93.2 Å²	93.2	54%	0.535	55%	0.549	S	S	.	.	S	Bend	trans	-104.6	-0.8	-176.1	-64.1	-32.5	0	0	0	113.2	P58 R62	P58-D71 WeakPolarHBondContact CD-O 3.29Å; R62-D71 IonicContact CZ-OD1 2.8Å; R62-D71 IonicContact NH2-OD1 3.51Å; R62-D71 PolarHBondContact NH2-OD1 2.97Å
72	I	68.2	Low	62.2	Low	83 Å²	83	85.9 Å²	85.9	43%	0.426	51%	0.511	S	S	.	.			trans	-126.6	119	-175.4	-60.7	-179.2	0	0	0	107.5	V55	V55-I72 HydrophobicContact CG1-CG2 3.54Å
73	F	66.6	Low	61.6	Low	68 Å²	68	87.1 Å²	87.1	30%	0.298	52%	0.523	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.3	123.6	179.8	-60.6	-82	0	0	0	109.8	V55 G56 L68 G70	V55-F73 CarbonylContact C-O 3.57Å; V55-F73 WeakPolarHBondContact CA-O 3.21Å; G56-F73 PolarHBondContact N-O 3.44Å; G56-F73 PolarHBondContact O-N 3.21Å; L68-F73 HydrophobicContact CB-CE1 3.63Å; L68-F73 HydrophobicContact CB-CZ 4.06Å; L68-F73 HydrophobicContact CD1-CD1 4.27Å; L68-F73 HydrophobicContact CD1-CE1 3.86Å; L68-F73 HydrophobicContact CG-CE1 4.41Å; G70-F73 VanDerWaalsContact O-CE2 3.27Å; G70-F73 WeakPolarHBondContact O-CE2 3.4Å; G70-F73 WeakPolarHBondContact O-CZ 3.14Å
74	V	70	Confident	60.6	Low	68 Å²	68	88.3 Å²	88.3	41%	0.412	51%	0.513	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.9	133.7	166	-179	0	0	0	0	107.7	F51 Y76	F51-V74 HydrophobicContact CD2-CG1 3.75Å; F51-V74 HydrophobicContact CE2-CG1 3.92Å; V74-Y76 PolarHBondContact O-N 3.03Å
75	A	57.7	Low	59.8	Low	40 Å²	40	82.3 Å²	82.3	33%	0.331	49%	0.489	S	S	.	.	S	Bend	trans	-66.7	133.1	176.5	0	0	0	0	0	110	P52	P52-A75 HydrophobicContact CB-CB 4.38Å; P52-A75 HydrophobicContact CG-CB 4.29Å
76	Y	63.5	Low	58.8	Low	175 Å²	175	84 Å²	84	69%	0.686	47%	0.474	S	S	*	.	S	Bend	trans	90.4	147.8	173.9	-114.4	-104	0	0	0	118.3	V74 S78	V74-Y76 PolarHBondContact O-N 3.03Å; Y76-S78 PolarHBondContact O-N 3.16Å
77	P	58.2	Low	57.7	Low	114 Å²	114	84 Å²	84	74%	0.74	47%	0.466	S	S	*	.			trans	-63.8	99.4	162	26.9	-34.9	0	0	0	109.3
78	S	54.4	Low	56.5	Low	36 Å²	36	83.8 Å²	83.8	25%	0.252	47%	0.469	S	S	.	.			trans	-73.1	132.6	174.9	67.1	0	0	0	0	110	Y76	Y76-S78 PolarHBondContact O-N 3.16Å
79	P	56.8	Low	54.9	Low	53 Å²	53	90 Å²	90	34%	0.344	48%	0.483	S	S	.	.			trans	-61.8	156.1	172.7	28.7	-36.4	0	0	0	110.8	C49 I81 C82	C49-P79 HydrophobicContact CB-CG 3.25Å; P79-I81 HydrophobicContact CG-CG2 4.38Å; P79-I81 PolarHBondContact O-N 3.25Å; P79-C82 WeakPolarHBondContact O-CB 3.24Å; P79-C82 PolarHBondContact O-N 3.31Å
80	P	54	Low	53.5	Low	89 Å²	89	87.4 Å²	87.4	58%	0.578	48%	0.477	S	S	*	.	H	α-helix	trans	-53.9	-32.2	-168.6	15.7	-29.8	0	0	0	114.1	C82 M83 Y84	P80-C82 PolarHBondContact O-N 3.46Å; P80-C82 VanDerWaalsContact O-N 3.16Å; P80-M83 WeakPolarHBondContact O-CB 3.17Å; P80-M83 PolarHBondContact O-N 3Å; P80-Y84 HydrophobicContact CB-CD2 4.48Å; P80-Y84 HydrophobicContact CB-CE2 4.32Å; P80-Y84 WeakPolarHBondContact O-CD2 3.42Å; P80-Y84 PolarHBondContact O-N 3.32Å
81	I	54.5	Low	52	Low	21 Å²	21	88.6 Å²	88.6	11%	0.108	49%	0.489	C	S	.	.	H	α-helix	trans	-57.4	-31.7	177.7	-156.5	171.4	0	0	0	113.1	F41 K48 C49 P79 Y84 A85	F41-I81 HydrophobicContact CD1-CD1 4.32Å; F41-I81 HydrophobicContact CD2-CD1 3.7Å; F41-I81 HydrophobicContact CE1-CD1 3.94Å; F41-I81 HydrophobicContact CE1-CG1 4.49Å; F41-I81 HydrophobicContact CE2-CD1 3.25Å; F41-I81 HydrophobicContact CE2-CG1 4.3Å; F41-I81 HydrophobicContact CG-CD1 4.22Å; F41-I81 HydrophobicContact CZ-CD1 3.39Å; F41-I81 HydrophobicContact CZ-CG1 4.01Å; K48-I81 HydrophobicContact CB-CD1 3.99Å; K48-I81 HydrophobicContact CB-CG2 4Å; K48-I81 HydrophobicContact CG-CD1 3.97Å; C49-I81 HydrophobicContact CB-CG2 4.13Å; P79-I81 HydrophobicContact CG-CG2 4.38Å; P79-I81 PolarHBondContact O-N 3.25Å; I81-Y84 PolarHBondContact O-N 2.8Å; I81-A85 PolarHBondContact O-N 2.93Å
82	C	52.6	Low	50.5	Low	4 Å²	4	90.2 Å²	90.2	3%	0.027	50%	0.502	C	S	.	.	H	α-helix	trans	-73.2	-40.1	177.6	-157	0	0	0	0	110.9	C49 F51 P79 P80 Y84 A85 Y86	C49-C82 HydrophobicContact CB-CB 4.47Å; F51-C82 WeakPolarHBondContact CE1-SG 3.14Å; P79-C82 WeakPolarHBondContact O-CB 3.24Å; P79-C82 PolarHBondContact O-N 3.31Å; P80-C82 PolarHBondContact O-N 3.46Å; P80-C82 VanDerWaalsContact O-N 3.16Å; C82-Y84 VanDerWaalsContact C-N 3.3Å; C82-Y84 PolarHBondContact O-N 2.83Å; C82-A85 PolarHBondContact O-N 3.12Å; C82-Y86 WeakPolarHBondContact O-CD2 3.26Å; C82-Y86 PolarHBondContact O-N 3.12Å; C82-Y86 VanDerWaalsContact O-N 3.15Å
83	M	50.8	Low	49.2	Very low	126 Å²	126	89.5 Å²	89.5	62%	0.621	51%	0.509	S	S	*	.	H	α-helix	trans	-60.9	-40.3	171.6	-75.3	-179.6	174	0	0	111.2	P80 Y86 A87	P80-M83 WeakPolarHBondContact O-CB 3.17Å; P80-M83 PolarHBondContact O-N 3Å; M83-Y86 PolarHBondContact O-N 2.95Å; M83-A87 VanDerWaalsContact O-CB 3.24Å; M83-A87 WeakPolarHBondContact O-CB 3.05Å; M83-A87 PolarHBondContact O-N 2.8Å
84	Y	44.5	Very low	47.9	Very low	168 Å²	168	92.1 Å²	92.1	66%	0.659	53%	0.53	S	S	*	.	H	α-helix	trans	-64.5	-36.6	174.6	-78.2	-75.6	0	0	0	112.8	P80 I81 C82 Y86 A87 G88	P80-Y84 HydrophobicContact CB-CD2 4.48Å; P80-Y84 HydrophobicContact CB-CE2 4.32Å; P80-Y84 WeakPolarHBondContact O-CD2 3.42Å; P80-Y84 PolarHBondContact O-N 3.32Å; I81-Y84 PolarHBondContact O-N 2.8Å; C82-Y84 VanDerWaalsContact C-N 3.3Å; C82-Y84 PolarHBondContact O-N 2.83Å; Y84-Y86 VanDerWaalsContact C-N 3.29Å; Y84-Y86 PolarHBondContact O-N 3.41Å; Y84-A87 PolarHBondContact O-N 3.49Å; Y84-G88 VanDerWaalsContact O-CA 3.29Å; Y84-G88 WeakPolarHBondContact O-CA 3.27Å; Y84-G88 PolarHBondContact O-N 3.29Å
85	A	47.5	Very low	46.2	Very low	33 Å²	33	97 Å²	97	27%	0.273	55%	0.546	S	S	.	.	H	α-helix	trans	-65	-32.7	174.5	0	0	0	0	0	112.4	I30 I81 C82	I30-A85 HydrophobicContact CD1-CB 4.21Å; I81-A85 PolarHBondContact O-N 2.93Å; C82-A85 PolarHBondContact O-N 3.12Å
86	Y	42.2	Very low	45.2	Very low	136 Å²	136	97.8 Å²	97.8	53%	0.533	56%	0.557	S	S	.	*	H	α-helix	trans	-81	-30	173.3	-77.1	-77.4	0	0	0	113.5	F51 C82 M83 Y84	F51-Y86 HydrophobicContact CZ-CE2 4.22Å; C82-Y86 WeakPolarHBondContact O-CD2 3.26Å; C82-Y86 PolarHBondContact O-N 3.12Å; C82-Y86 VanDerWaalsContact O-N 3.15Å; M83-Y86 PolarHBondContact O-N 2.95Å; Y84-Y86 VanDerWaalsContact C-N 3.29Å; Y84-Y86 PolarHBondContact O-N 3.41Å
87	A	42	Very low	44	Very low	86 Å²	86	95.6 Å²	95.6	71%	0.711	55%	0.553	S	S	*	*	H	α-helix	trans	-99.1	-10.6	-175.2	0	0	0	0	0	114.7	M83 Y84	M83-A87 VanDerWaalsContact O-CB 3.24Å; M83-A87 WeakPolarHBondContact O-CB 3.05Å; M83-A87 PolarHBondContact O-N 2.8Å; Y84-A87 PolarHBondContact O-N 3.49Å
88	G	36.7	Very low	42.9	Very low	42 Å²	42	97.2 Å²	97.2	43%	0.433	56%	0.556	S	S	.	*			trans	-102.7	92.5	-168.6	0	0	0	0	0	113.7	Y84 S90	Y84-G88 VanDerWaalsContact O-CA 3.29Å; Y84-G88 WeakPolarHBondContact O-CA 3.27Å; Y84-G88 PolarHBondContact O-N 3.29Å; G88-S90 PolarHBondContact O-N 2.73Å
89	R	32.7	Very low	41.7	Very low	259 Å²	259	101.1 Å²	101.1	98%	0.977	58%	0.583	S	S	*	*			trans	-1.1	17.7	149.9	-109.9	176.9	-174.5	160	1.7	124.3
90	S	34.3	Very low	40.5	Very low	97 Å²	97	103.9 Å²	103.9	68%	0.678	60%	0.599	S	S	*	*	S	Bend	trans	-150.6	91.7	176.4	47	0	0	0	0	112.9	G88	G88-S90 PolarHBondContact O-N 2.73Å
91	G	36.3	Very low	39.4	Very low	62 Å²	62	109 Å²	109	64%	0.639	63%	0.632	S	S	*	*	S	Bend		126.3	-21.6	129.9	0	0	0	0	0	119.9
92	V	37.4	Very low	38.7	Very low	134 Å²	134	113.4 Å²	113.4	81%	0.812	66%	0.658	S	S	*	*			trans	-152.3	123.7	175	-170.3	0	0	0	0	111.6
93	A	40.4	Very low	38	Very low	69 Å²	69	119.2 Å²	119.2	57%	0.57	69%	0.691	S	S	*	*			trans	-89.8	151.9	-167.2	0	0	0	0	0	115.1
94	V	39	Very low	37.3	Very low	123 Å²	123	118.8 Å²	118.8	75%	0.745	70%	0.695	S	S	*	*				-147.7	121.5	128.1	-121.2	0	0	0	0	111.7	G96	V94-G96 PolarHBondContact O-N 3.46Å
95	K	34.7	Very low	36.8	Very low	170 Å²	170	115.9 Å²	115.9	74%	0.739	70%	0.698	S	S	*	*			trans	-52.3	107.2	178.7	-177.7	-178.1	177.3	-171.4	0	112.6	E97	K95-E97 HydrophobicContact CG-CG 4.39Å; K95-E97 IonicContact NZ-OE1 3.99Å
96	G	37.7	Very low	36.2	Very low	56 Å²	56	121.1 Å²	121.1	58%	0.577	72%	0.724	S	S	*	*	P	Polyproline II helix	trans	-85.7	116.5	145.7	0	0	0	0	0	105.9	V94 D98	V94-G96 PolarHBondContact O-N 3.46Å; G96-D98 PolarHBondContact O-N 3.01Å; G96-D98 VanDerWaalsContact O-N 3.12Å
97	E	36.4	Very low	35.8	Very low	129 Å²	129	120.1 Å²	120.1	60%	0.603	74%	0.737	S	S	*	*	P	Polyproline II helix	trans	-50.3	121.6	179.5	-76	173.2	145.7	0	0	110.2	K95 S99	K95-E97 HydrophobicContact CG-CG 4.39Å; K95-E97 IonicContact NZ-OE1 3.99Å; E97-S99 PolarHBondContact O-N 3.16Å; E97-S99 VanDerWaalsContact O-N 3.12Å
98	D	35.2	Very low	35.3	Very low	149 Å²	149	122.5 Å²	122.5	80%	0.797	74%	0.739	S	S	*	*	P	Polyproline II helix	trans	-50.9	117.4	168.6	-63.1	-56.6	0	0	0	108.3	G96 V100	G96-D98 PolarHBondContact O-N 3.01Å; G96-D98 VanDerWaalsContact O-N 3.12Å; D98-V100 PolarHBondContact O-N 3.48Å
99	S	29.7	Very low	35.2	Very low	117 Å²	117	128.7 Å²	128.7	82%	0.818	76%	0.762	S	S	*	*			trans	-71.7	80.5	165.3	55.5	0	0	0	0	108.4	E97	E97-S99 PolarHBondContact O-N 3.16Å; E97-S99 VanDerWaalsContact O-N 3.12Å
100	V	31.3	Very low	35.4	Very low	112 Å²	112	117.8 Å²	117.8	68%	0.679	74%	0.744	S	S	*	*			trans	-152.4	143.6	158.2	-139.6	0	0	0	0	108.3	D98	D98-V100 PolarHBondContact O-N 3.48Å
101	P	32.7	Very low	35.5	Very low	196 Å²	196	119.7 Å²	119.7	100%	1.273	75%	0.75	S	S	*	*			trans	-58.1	0	139.8	28.8	-32.4	0	0	0	110.9

Retrieved 101 of 101 residues in 79.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).