A0A077Z8Y3_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077Z8Y3, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 67 aa.

						>A0A077Z8Y3_TRITR|A0A077Z8Y3
MAGEFYPFPLLAALKEEEDIAEQEVEVYCQHLEMLHVDFTERAGEAEMELQEERLELQSHEELKVKC
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	37.3	Very low	54.7	Low	245 Å²	245	125.6 Å²	125.6	100%	1.207	68%	0.676	S	S	*	*				0	112	0	-70	-170.4	-159	0	0	107	G3	M1-G3 VanDerWaalsContact C-N 3.26Å; M1-G3 PolarHBondContact O-N 2.85Å
2	A	48.1	Very low	55.5	Low	91 Å²	91	120.6 Å²	120.6	75%	0.752	67%	0.665	S	S	*	*			trans	-74.2	86.9	172.1	0	0	0	0	0	107.3	E4	A2-E4 HydrophobicContact CB-CG 4.35Å; A2-E4 PolarHBondContact O-N 2.98Å
3	G	53.9	Low	56.5	Low	62 Å²	62	115.4 Å²	115.4	64%	0.639	65%	0.647	S	S	*	*			trans	-73.1	79.9	157	0	0	0	0	0	106	M1 F5	M1-G3 VanDerWaalsContact C-N 3.26Å; M1-G3 PolarHBondContact O-N 2.85Å; G3-F5 PolarHBondContact O-N 3.33Å
4	E	49.4	Very low	57.2	Low	131 Å²	131	110.7 Å²	110.7	61%	0.612	62%	0.62	S	S	*	*			trans	-63	91.6	166.1	-68.1	-179.8	-167.9	0	0	105.3	A2 Y6	A2-E4 HydrophobicContact CB-CG 4.35Å; A2-E4 PolarHBondContact O-N 2.98Å; E4-Y6 HydrophobicContact CB-CD2 3.86Å; E4-Y6 HydrophobicContact CB-CE2 3.79Å; E4-Y6 PolarHBondContact O-N 2.94Å; E4-Y6 WeakPolarHBondContact OE2-CE2 3.29Å; E4-Y6 PolarHBondContact OE2-OH 3.33Å
5	F	50.2	Low	57.6	Low	193 Å²	193	115.7 Å²	115.7	85%	0.846	63%	0.632	S	S	*	*			trans	-56.2	85.8	158.3	-88.2	-97.5	0	0	0	105.2	G3 P7	G3-F5 PolarHBondContact O-N 3.33Å; F5-P7 VanDerWaalsContact C-N 3.29Å; F5-P7 WeakPolarHBondContact O-CD 3.4Å
6	Y	55.2	Low	58.3	Low	175 Å²	175	119.4 Å²	119.4	69%	0.686	64%	0.644	S	S	*	*			trans	-75.1	92.9	151.1	-78.9	-90.3	0	0	0	103.4	E4 F8	E4-Y6 HydrophobicContact CB-CD2 3.86Å; E4-Y6 HydrophobicContact CB-CE2 3.79Å; E4-Y6 PolarHBondContact O-N 2.94Å; E4-Y6 WeakPolarHBondContact OE2-CE2 3.29Å; E4-Y6 PolarHBondContact OE2-OH 3.33Å; Y6-F8 PolarHBondContact O-N 3.45Å
7	P	54.9	Low	58.9	Low	81 Å²	81	120 Å²	120	53%	0.526	64%	0.641	S	S	.	*			trans	-74.4	96.9	178.2	5.2	17.7	0	0	0	103.4	F5	F5-P7 VanDerWaalsContact C-N 3.29Å; F5-P7 WeakPolarHBondContact O-CD 3.4Å
8	F	57.5	Low	59.3	Low	95 Å²	95	124.1 Å²	124.1	42%	0.417	66%	0.656	S	S	.	*			trans	67.8	94.5	159.7	-46	-83.3	0	0	0	115	Y6 L10 L11 A12	Y6-F8 PolarHBondContact O-N 3.45Å; F8-L10 HydrophobicContact CB-CB 4.36Å; F8-L10 PolarHBondContact O-N 3.02Å; F8-L11 HydrophobicContact CB-CB 3.86Å; F8-L11 HydrophobicContact CB-CD1 3.88Å; F8-L11 HydrophobicContact CB-CG 3.56Å; F8-L11 HydrophobicContact CD2-CD1 3.53Å; F8-L11 HydrophobicContact CD2-CG 4.08Å; F8-L11 HydrophobicContact CE2-CD1 4.46Å; F8-L11 HydrophobicContact CG-CD1 4.01Å; F8-L11 HydrophobicContact CG-CG 4.04Å; F8-L11 PolarHBondContact O-N 3.23Å; F8-A12 PolarHBondContact O-N 3.41Å
9	P	64.1	Low	60	Low	106 Å²	106	125.8 Å²	125.8	69%	0.688	67%	0.666	S	S	*	*	H	α-helix	trans	-47.8	-29.2	155.7	-24.7	33.9	0	0	0	112	A12 A13	P9-A12 WeakPolarHBondContact O-CB 3.44Å; P9-A12 PolarHBondContact O-N 3.23Å; P9-A13 PolarHBondContact O-N 3.24Å
10	L	65.8	Low	60.5	Low	119 Å²	119	122.5 Å²	122.5	62%	0.623	65%	0.647	S	S	*	*	H	α-helix	trans	-62.5	-42	172.9	-160.3	75.9	0	0	0	112.8	F8 A12 A13 L14	F8-L10 HydrophobicContact CB-CB 4.36Å; F8-L10 PolarHBondContact O-N 3.02Å; L10-A12 VanDerWaalsContact C-N 3.29Å; L10-A12 PolarHBondContact O-N 2.97Å; L10-A13 PolarHBondContact O-N 3.39Å; L10-L14 HydrophobicContact CG-CD1 4.39Å; L10-L14 VanDerWaalsContact O-CB 3.28Å; L10-L14 WeakPolarHBondContact O-CB 3.46Å; L10-L14 WeakPolarHBondContact O-CG 3.49Å; L10-L14 PolarHBondContact O-N 2.83Å
11	L	65.6	Low	61.3	Low	84 Å²	84	118.9 Å²	118.9	44%	0.44	64%	0.635	S	S	.	*	H	α-helix	trans	-65.4	-35.1	175.2	-72.9	177.6	0	0	0	111.6	F8 L14 K15	F8-L11 HydrophobicContact CB-CB 3.86Å; F8-L11 HydrophobicContact CB-CD1 3.88Å; F8-L11 HydrophobicContact CB-CG 3.56Å; F8-L11 HydrophobicContact CD2-CD1 3.53Å; F8-L11 HydrophobicContact CD2-CG 4.08Å; F8-L11 HydrophobicContact CE2-CD1 4.46Å; F8-L11 HydrophobicContact CG-CD1 4.01Å; F8-L11 HydrophobicContact CG-CG 4.04Å; F8-L11 PolarHBondContact O-N 3.23Å; L11-L14 HydrophobicContact CD2-CD1 4.1Å; L11-L14 PolarHBondContact O-N 3.46Å; L11-K15 PolarHBondContact O-N 3.23Å
12	A	64.3	Low	63.2	Low	65 Å²	65	115.5 Å²	115.5	54%	0.537	62%	0.617	S	S	.	*	H	α-helix	trans	-65.1	-41.5	173.6	0	0	0	0	0	111.7	F8 P9 L10 K15	F8-A12 PolarHBondContact O-N 3.41Å; P9-A12 WeakPolarHBondContact O-CB 3.44Å; P9-A12 PolarHBondContact O-N 3.23Å; L10-A12 VanDerWaalsContact C-N 3.29Å; L10-A12 PolarHBondContact O-N 2.97Å; A12-K15 WeakPolarHBondContact O-CB 3.45Å; A12-K15 PolarHBondContact O-N 3.03Å
13	A	68.9	Low	64.8	Low	53 Å²	53	117.7 Å²	117.7	44%	0.438	61%	0.611	S	S	.	*	H	α-helix	trans	-65.8	-40.4	174.2	0	0	0	0	0	112.1	P9 L10 K15 E16 E17	P9-A13 PolarHBondContact O-N 3.24Å; L10-A13 PolarHBondContact O-N 3.39Å; A13-K15 PolarHBondContact O-N 3Å; A13-E16 WeakPolarHBondContact O-CA 3.49Å; A13-E16 WeakPolarHBondContact O-CB 3.33Å; A13-E16 PolarHBondContact O-N 3.45Å; A13-E17 PolarHBondContact O-N 3.42Å
14	L	66.3	Low	66	Low	50 Å²	50	120.8 Å²	120.8	26%	0.262	61%	0.609	S	S	.	*	H	α-helix	trans	-63	-29.4	175.4	-79.1	175.3	0	0	0	112.5	L10 L11 E16 E17 I20	L10-L14 HydrophobicContact CG-CD1 4.39Å; L10-L14 VanDerWaalsContact O-CB 3.28Å; L10-L14 WeakPolarHBondContact O-CB 3.46Å; L10-L14 WeakPolarHBondContact O-CG 3.49Å; L10-L14 PolarHBondContact O-N 2.83Å; L11-L14 HydrophobicContact CD2-CD1 4.1Å; L11-L14 PolarHBondContact O-N 3.46Å; L14-E16 VanDerWaalsContact C-N 3.26Å; L14-E16 PolarHBondContact O-N 3.34Å; L14-E17 WeakPolarHBondContact CD2-OE2 3.43Å; L14-E17 CarbonylContact O-C 3.57Å; L14-E17 PolarHBondContact O-N 2.94Å; L14-I20 HydrophobicContact CB-CD1 3.41Å; L14-I20 VanDerWaalsContact CB-CD1 3.41Å; L14-I20 HydrophobicContact CD1-CD1 4.09Å; L14-I20 HydrophobicContact CD2-CD1 3.48Å; L14-I20 VanDerWaalsContact CD2-CD1 3.48Å; L14-I20 HydrophobicContact CD2-CG1 4.44Å; L14-I20 HydrophobicContact CG-CD1 3.79Å
15	K	63.2	Low	67.7	Low	186 Å²	186	117.9 Å²	117.9	81%	0.809	60%	0.6	S	S	*	*	H	α-helix	trans	-67.6	-26.8	171.5	-173.1	179.6	177.1	-179.2	0	112.7	L11 A12 A13	L11-K15 PolarHBondContact O-N 3.23Å; A12-K15 WeakPolarHBondContact O-CB 3.45Å; A12-K15 PolarHBondContact O-N 3.03Å; A13-K15 PolarHBondContact O-N 3Å
16	E	67.9	Low	69.4	Low	175 Å²	175	113.6 Å²	113.6	82%	0.818	58%	0.583	S	S	*	*	H	α-helix	trans	-79.1	-25.1	172.8	-60.6	-163.4	158.1	0	0	112.1	A13 L14 E18	A13-E16 WeakPolarHBondContact O-CA 3.49Å; A13-E16 WeakPolarHBondContact O-CB 3.33Å; A13-E16 PolarHBondContact O-N 3.45Å; L14-E16 VanDerWaalsContact C-N 3.26Å; L14-E16 PolarHBondContact O-N 3.34Å; E16-E18 PolarHBondContact O-N 3.27Å
17	E	69.7	Low	71	Confident	129 Å²	129	109.3 Å²	109.3	60%	0.603	57%	0.574	S	S	*	*	S	Bend	trans	-76.1	101.2	167.5	-74.8	-178.5	163	0	0	109.1	A13 L14 D19	A13-E17 PolarHBondContact O-N 3.42Å; L14-E17 WeakPolarHBondContact CD2-OE2 3.43Å; L14-E17 CarbonylContact O-C 3.57Å; L14-E17 PolarHBondContact O-N 2.94Å; E17-D19 PolarHBondContact O-N 3.26Å
18	E	65.8	Low	72.5	Confident	193 Å²	193	110.8 Å²	110.8	90%	0.902	57%	0.57	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.1	3.1	-164.1	-151.2	176.4	-176.8	0	0	116	E16	E16-E18 PolarHBondContact O-N 3.27Å
19	D	71.4	Confident	74	Confident	158 Å²	158	109 Å²	109	85%	0.845	57%	0.569	S	S	*	*	T	Hydrogen-bonded Turn	trans	-147.2	50	-165.9	-138.1	-0.7	0	0	0	114.4	E17	E17-D19 PolarHBondContact O-N 3.26Å
20	I	70.4	Confident	75.4	Confident	58 Å²	58	108.9 Å²	108.9	30%	0.297	56%	0.559	S	S	.	*			trans	-82.8	117.2	163.8	-54.9	172.8	0	0	0	107.6	L14 E22 E24 V25	L14-I20 HydrophobicContact CB-CD1 3.41Å; L14-I20 VanDerWaalsContact CB-CD1 3.41Å; L14-I20 HydrophobicContact CD1-CD1 4.09Å; L14-I20 HydrophobicContact CD2-CD1 3.48Å; L14-I20 VanDerWaalsContact CD2-CD1 3.48Å; L14-I20 HydrophobicContact CD2-CG1 4.44Å; L14-I20 HydrophobicContact CG-CD1 3.79Å; I20-E22 PolarHBondContact O-N 2.88Å; I20-E24 HydrophobicContact CG2-CB 4.16Å; I20-V25 HydrophobicContact CG2-CG2 3.67Å
21	A	76.7	Confident	76.7	Confident	47 Å²	47	107.7 Å²	107.7	39%	0.388	55%	0.55	S	S	.	*			trans	-58.6	131.5	175	0	0	0	0	0	109.7	Q23 E24 V25	A21-Q23 PolarHBondContact O-N 2.99Å; A21-E24 HydrophobicContact CB-CG 4.26Å; A21-E24 WeakPolarHBondContact O-CB 3.41Å; A21-E24 PolarHBondContact O-N 3.44Å; A21-V25 PolarHBondContact O-N 3.22Å
22	E	79	Confident	78.1	Confident	175 Å²	175	106.8 Å²	106.8	82%	0.818	55%	0.546	S	S	*	.	H	α-helix	trans	-51.1	-31.6	177	-65.9	179.4	171.5	0	0	112.2	I20 V25 E26	I20-E22 PolarHBondContact O-N 2.88Å; E22-V25 PolarHBondContact O-N 3.43Å; E22-E26 PolarHBondContact O-N 3.27Å
23	Q	79.9	Confident	79.6	Confident	136 Å²	136	110 Å²	110	64%	0.636	55%	0.55	S	S	*	.	H	α-helix	trans	-62.4	-38.9	175.1	-165.3	110.6	70.5	0	0	113.1	A21 E26 V27	A21-Q23 PolarHBondContact O-N 2.99Å; Q23-E26 PolarHBondContact O-N 2.98Å; Q23-V27 VanDerWaalsContact O-CG2 3.29Å; Q23-V27 WeakPolarHBondContact O-CG2 3.18Å; Q23-V27 PolarHBondContact O-N 3.34Å
24	E	80.8	Confident	80.9	Confident	127 Å²	127	113 Å²	113	59%	0.593	56%	0.556	S	S	*	*	H	α-helix	trans	-68.3	-39.2	177.2	-68.6	-176.3	-177.7	0	0	111.1	I20 A21 V27 Y28	I20-E24 HydrophobicContact CG2-CB 4.16Å; A21-E24 HydrophobicContact CB-CG 4.26Å; A21-E24 WeakPolarHBondContact O-CB 3.41Å; A21-E24 PolarHBondContact O-N 3.44Å; E24-V27 PolarHBondContact O-N 3.33Å; E24-Y28 WeakPolarHBondContact O-CB 3.47Å; E24-Y28 PolarHBondContact O-N 2.81Å
25	V	84	Confident	82.3	Confident	71 Å²	71	114.5 Å²	114.5	43%	0.43	56%	0.564	S	S	.	*	H	α-helix	trans	-62.5	-45.2	174.3	-178.1	0	0	0	0	110.4	I20 A21 E22 Y28 C29	I20-V25 HydrophobicContact CG2-CG2 3.67Å; A21-V25 PolarHBondContact O-N 3.22Å; E22-V25 PolarHBondContact O-N 3.43Å; V25-Y28 PolarHBondContact O-N 2.99Å; V25-C29 WeakPolarHBondContact O-CB 3.4Å; V25-C29 PolarHBondContact O-N 3.33Å; V25-C29 PolarHBondContact O-SG 2.97Å
26	E	85.9	Confident	83.9	Confident	102 Å²	102	111.6 Å²	111.6	48%	0.477	55%	0.553	S	S	.	*	H	α-helix	trans	-60.9	-46.2	178.4	-172.9	178.7	-161.3	0	0	111.9	E22 Q23 Y28 C29 Q30	E22-E26 PolarHBondContact O-N 3.27Å; Q23-E26 PolarHBondContact O-N 2.98Å; E26-Y28 VanDerWaalsContact C-N 3.32Å; E26-Y28 PolarHBondContact O-N 3.43Å; E26-C29 PolarHBondContact O-N 3.22Å; E26-Q30 WeakPolarHBondContact O-CG 3.47Å; E26-Q30 PolarHBondContact O-N 2.91Å
27	V	88.1	Confident	85.3	Confident	85 Å²	85	107.7 Å²	107.7	52%	0.515	54%	0.54	S	S	.	.	H	α-helix	trans	-61.8	-41.2	176.9	171.5	0	0	0	0	111.2	Q23 E24 Q30 H31	Q23-V27 VanDerWaalsContact O-CG2 3.29Å; Q23-V27 WeakPolarHBondContact O-CG2 3.18Å; Q23-V27 PolarHBondContact O-N 3.34Å; E24-V27 PolarHBondContact O-N 3.33Å; V27-Q30 PolarHBondContact O-N 3.12Å; V27-H31 PolarHBondContact O-N 3.48Å
28	Y	86.9	Confident	86.6	Confident	112 Å²	112	104.2 Å²	104.2	44%	0.439	53%	0.526	S	S	.	.	H	α-helix	trans	-65.1	-42.3	176.7	-175.8	-107.8	0	0	0	112	E24 V25 E26 H31 L32	E24-Y28 WeakPolarHBondContact O-CB 3.47Å; E24-Y28 PolarHBondContact O-N 2.81Å; V25-Y28 PolarHBondContact O-N 2.99Å; E26-Y28 VanDerWaalsContact C-N 3.32Å; E26-Y28 PolarHBondContact O-N 3.43Å; Y28-H31 WeakPolarHBondContact O-CB 3.48Å; Y28-H31 PolarHBondContact O-N 3.4Å; Y28-L32 HydrophobicContact CD1-CD1 3.89Å; Y28-L32 HydrophobicContact CD1-CG 4.4Å; Y28-L32 HydrophobicContact CE1-CD1 3.45Å; Y28-L32 VanDerWaalsContact CE1-CD1 3.45Å; Y28-L32 HydrophobicContact CE1-CG 4.05Å; Y28-L32 WeakPolarHBondContact O-CG 3.28Å; Y28-L32 PolarHBondContact O-N 2.97Å
29	C	90	Very high	88.1	Confident	57 Å²	57	102 Å²	102	39%	0.385	51%	0.514	S	S	.	.	H	α-helix	trans	-60.3	-45.8	174.4	-72.2	0	0	0	0	111.9	V25 E26 H31 L32 E33	V25-C29 WeakPolarHBondContact O-CB 3.4Å; V25-C29 PolarHBondContact O-N 3.33Å; V25-C29 PolarHBondContact O-SG 2.97Å; E26-C29 PolarHBondContact O-N 3.22Å; C29-H31 VanDerWaalsContact C-N 3.27Å; C29-H31 PolarHBondContact O-N 2.96Å; C29-L32 PolarHBondContact O-N 3.48Å; C29-L32 VanDerWaalsContact O-N 3.12Å; C29-E33 WeakPolarHBondContact O-CG 3.5Å; C29-E33 PolarHBondContact O-N 2.86Å
30	Q	92.9	Very high	89.3	Confident	104 Å²	104	98 Å²	98	49%	0.486	50%	0.495	S	S	.	.	H	α-helix	trans	-59.8	-38.5	176.1	-71.3	171.2	1.9	0	0	112	E26 V27 E33 M34	E26-Q30 WeakPolarHBondContact O-CG 3.47Å; E26-Q30 PolarHBondContact O-N 2.91Å; V27-Q30 PolarHBondContact O-N 3.12Å; Q30-E33 PolarHBondContact O-N 3.06Å; Q30-M34 WeakPolarHBondContact O-CB 3.49Å; Q30-M34 PolarHBondContact O-N 3.38Å
31	H	93.6	Very high	90.6	Very high	94 Å²	94	100.9 Å²	100.9	44%	0.435	51%	0.507	S	S	.	.	H	α-helix	trans	-63.7	-44.9	174.8	-170.1	119.8	0	0	0	111.5	V27 Y28 C29 E33 M34 L35	V27-H31 PolarHBondContact O-N 3.48Å; Y28-H31 WeakPolarHBondContact O-CB 3.48Å; Y28-H31 PolarHBondContact O-N 3.4Å; C29-H31 VanDerWaalsContact C-N 3.27Å; C29-H31 PolarHBondContact O-N 2.96Å; H31-E33 VanDerWaalsContact C-N 3.34Å; H31-M34 PolarHBondContact O-N 2.83Å; H31-L35 VanDerWaalsContact CD2-CD1 3.45Å; H31-L35 WeakPolarHBondContact CD2-CD1 3.35Å; H31-L35 WeakPolarHBondContact O-CG 3.38Å; H31-L35 PolarHBondContact O-N 3.38Å
32	L	94.2	Very high	91.6	Very high	66 Å²	66	105.7 Å²	105.7	35%	0.346	52%	0.516	S	S	.	.	H	α-helix	trans	-63.3	-40.1	177.6	-71.1	176	0	0	0	112.1	Y28 C29 L35 H36	Y28-L32 HydrophobicContact CD1-CD1 3.89Å; Y28-L32 HydrophobicContact CD1-CG 4.4Å; Y28-L32 HydrophobicContact CE1-CD1 3.45Å; Y28-L32 VanDerWaalsContact CE1-CD1 3.45Å; Y28-L32 HydrophobicContact CE1-CG 4.05Å; Y28-L32 WeakPolarHBondContact O-CG 3.28Å; Y28-L32 PolarHBondContact O-N 2.97Å; C29-L32 PolarHBondContact O-N 3.48Å; C29-L32 VanDerWaalsContact O-N 3.12Å; L32-L35 PolarHBondContact O-N 3.36Å; L32-H36 WeakPolarHBondContact O-CB 3.49Å; L32-H36 PolarHBondContact O-N 2.88Å
33	E	95.8	Very high	92.4	Very high	133 Å²	133	99 Å²	99	62%	0.621	49%	0.49	S	S	*	.	H	α-helix	trans	-62.1	-45.3	174.8	-73.9	176.5	-176.5	0	0	111.4	C29 Q30 H31 L35 H36 V37	C29-E33 WeakPolarHBondContact O-CG 3.5Å; C29-E33 PolarHBondContact O-N 2.86Å; Q30-E33 PolarHBondContact O-N 3.06Å; H31-E33 VanDerWaalsContact C-N 3.34Å; E33-L35 PolarHBondContact O-N 3.03Å; E33-H36 WeakPolarHBondContact O-CB 3.47Å; E33-H36 PolarHBondContact O-N 3.3Å; E33-V37 WeakPolarHBondContact O-CG2 3.43Å; E33-V37 PolarHBondContact O-N 3.31Å
34	M	96.9	Very high	93.2	Very high	115 Å²	115	94.1 Å²	94.1	57%	0.567	48%	0.477	S	S	*	.	H	α-helix	trans	-59.9	-45.7	175.8	179.4	-172.7	62.7	0	0	111.9	Q30 H31 H36 V37 D38	Q30-M34 WeakPolarHBondContact O-CB 3.49Å; Q30-M34 PolarHBondContact O-N 3.38Å; H31-M34 PolarHBondContact O-N 2.83Å; M34-H36 VanDerWaalsContact C-N 3.32Å; M34-H36 PolarHBondContact O-N 2.94Å; M34-V37 PolarHBondContact O-N 2.92Å; M34-D38 PolarHBondContact O-N 3.21Å
35	L	96.3	Very high	94	Very high	82 Å²	82	93.4 Å²	93.4	43%	0.429	47%	0.473	S	S	.	.	H	α-helix	trans	-63.6	-38.2	175.9	-74.5	179	0	0	0	112.2	H31 L32 E33 F39	H31-L35 VanDerWaalsContact CD2-CD1 3.45Å; H31-L35 WeakPolarHBondContact CD2-CD1 3.35Å; H31-L35 WeakPolarHBondContact O-CG 3.38Å; H31-L35 PolarHBondContact O-N 3.38Å; L32-L35 PolarHBondContact O-N 3.36Å; E33-L35 PolarHBondContact O-N 3.03Å; L35-F39 VanDerWaalsContact O-CB 3.31Å; L35-F39 WeakPolarHBondContact O-CB 3.26Å; L35-F39 PolarHBondContact O-N 2.91Å
36	H	96.5	Very high	94.6	Very high	124 Å²	124	92.2 Å²	92.2	57%	0.574	47%	0.471	S	S	*	.	H	α-helix	trans	-63	-45.6	177.5	-177.9	57.6	0	0	0	111.2	L32 E33 M34 F39 T40	L32-H36 WeakPolarHBondContact O-CB 3.49Å; L32-H36 PolarHBondContact O-N 2.88Å; E33-H36 WeakPolarHBondContact O-CB 3.47Å; E33-H36 PolarHBondContact O-N 3.3Å; M34-H36 VanDerWaalsContact C-N 3.32Å; M34-H36 PolarHBondContact O-N 2.94Å; H36-F39 PolarHBondContact O-N 3.46Å; H36-T40 WeakPolarHBondContact O-CB 3.41Å; H36-T40 PolarHBondContact O-N 2.93Å; H36-T40 PolarHBondContact O-OG1 3.11Å; H36-T40 VanDerWaalsContact O-OG1 3.1Å
37	V	96.9	Very high	95.1	Very high	93 Å²	93	93 Å²	93	56%	0.564	47%	0.474	S	S	*	.	H	α-helix	trans	-60.5	-50.2	176.7	172.5	0	0	0	0	111.3	E33 M34 F39 T40 E41	E33-V37 WeakPolarHBondContact O-CG2 3.43Å; E33-V37 PolarHBondContact O-N 3.31Å; M34-V37 PolarHBondContact O-N 2.92Å; V37-F39 VanDerWaalsContact C-N 3.31Å; V37-F39 PolarHBondContact O-N 3.08Å; V37-T40 PolarHBondContact O-N 2.91Å; V37-E41 WeakPolarHBondContact O-CB 3.48Å; V37-E41 PolarHBondContact O-N 3.25Å
38	D	97.2	Very high	95.5	Very high	56 Å²	56	95 Å²	95	30%	0.299	48%	0.48	S	S	.	.	H	α-helix	trans	-59.4	-41.6	178.2	176.4	67.9	0	0	0	111.8	M34 R42	M34-D38 PolarHBondContact O-N 3.21Å; D38-R42 VanDerWaalsContact CG-NH2 3.3Å; D38-R42 WeakPolarHBondContact O-CB 3.31Å; D38-R42 VanDerWaalsContact O-CG 3.26Å; D38-R42 WeakPolarHBondContact O-CG 3.05Å; D38-R42 PolarHBondContact O-N 3.1Å; D38-R42 VanDerWaalsContact O-N 3.11Å; D38-R42 IonicContact OD1-CZ 3.25Å; D38-R42 VanDerWaalsContact OD1-CZ 3.25Å; D38-R42 IonicContact OD1-NE 2.92Å; D38-R42 PolarHBondContact OD1-NE 2.9Å; D38-R42 IonicContact OD1-NH2 2.83Å; D38-R42 PolarHBondContact OD1-NH2 2.74Å; D38-R42 IonicContact OD2-CZ 3.11Å; D38-R42 IonicContact OD2-NE 3.21Å; D38-R42 PolarHBondContact OD2-NE 2.79Å; D38-R42 IonicContact OD2-NH1 3.86Å; D38-R42 IonicContact OD2-NH2 2.94Å; D38-R42 PolarHBondContact OD2-NH2 2.8Å
39	F	97.3	Very high	95.9	Very high	146 Å²	146	95.5 Å²	95.5	64%	0.64	49%	0.486	S	S	*	.	H	α-helix	trans	-66.6	-43.8	177.4	-175.7	-96.9	0	0	0	112.4	L35 H36 V37 R42 A43	L35-F39 VanDerWaalsContact O-CB 3.31Å; L35-F39 WeakPolarHBondContact O-CB 3.26Å; L35-F39 PolarHBondContact O-N 2.91Å; H36-F39 PolarHBondContact O-N 3.46Å; V37-F39 VanDerWaalsContact C-N 3.31Å; V37-F39 PolarHBondContact O-N 3.08Å; F39-R42 PolarHBondContact O-N 3.48Å; F39-A43 VanDerWaalsContact O-CB 3.25Å; F39-A43 WeakPolarHBondContact O-CB 3.49Å; F39-A43 PolarHBondContact O-N 2.93Å
40	T	96.7	Very high	96.3	Very high	74 Å²	74	97.9 Å²	97.9	45%	0.454	49%	0.494	S	S	.	.	H	α-helix	trans	-67.1	-37.7	179.5	-65.6	0	0	0	0	112	H36 V37 A43 G44	H36-T40 WeakPolarHBondContact O-CB 3.41Å; H36-T40 PolarHBondContact O-N 2.93Å; H36-T40 PolarHBondContact O-OG1 3.11Å; H36-T40 VanDerWaalsContact O-OG1 3.1Å; V37-T40 PolarHBondContact O-N 2.91Å; T40-A43 PolarHBondContact O-N 3.49Å; T40-G44 PolarHBondContact O-N 3.33Å
41	E	97.4	Very high	96.5	Very high	119 Å²	119	97.6 Å²	97.6	56%	0.556	49%	0.493	S	S	*	.	H	α-helix	trans	-61.7	-52.4	174.6	-176.2	170.7	-149.5	0	0	110.8	V37 A43 G44 E45	V37-E41 WeakPolarHBondContact O-CB 3.48Å; V37-E41 PolarHBondContact O-N 3.25Å; E41-A43 VanDerWaalsContact C-N 3.31Å; E41-A43 PolarHBondContact O-N 3.35Å; E41-G44 WeakPolarHBondContact O-CA 3.25Å; E41-G44 PolarHBondContact O-N 3.01Å; E41-G44 VanDerWaalsContact O-N 3.08Å; E41-E45 WeakPolarHBondContact O-CG 3.1Å; E41-E45 PolarHBondContact O-N 3.02Å
42	R	97	Very high	96.6	Very high	149 Å²	149	98.7 Å²	98.7	56%	0.562	50%	0.498	S	S	*	.	H	α-helix	trans	-62.3	-37.3	178	-68.4	174.9	-168.9	-163.2	10.4	113.1	D38 F39 G44 E45 A46	D38-R42 VanDerWaalsContact CG-NH2 3.3Å; D38-R42 WeakPolarHBondContact O-CB 3.31Å; D38-R42 VanDerWaalsContact O-CG 3.26Å; D38-R42 WeakPolarHBondContact O-CG 3.05Å; D38-R42 PolarHBondContact O-N 3.1Å; D38-R42 VanDerWaalsContact O-N 3.11Å; D38-R42 IonicContact OD1-CZ 3.25Å; D38-R42 VanDerWaalsContact OD1-CZ 3.25Å; D38-R42 IonicContact OD1-NE 2.92Å; D38-R42 PolarHBondContact OD1-NE 2.9Å; D38-R42 IonicContact OD1-NH2 2.83Å; D38-R42 PolarHBondContact OD1-NH2 2.74Å; D38-R42 IonicContact OD2-CZ 3.11Å; D38-R42 IonicContact OD2-NE 3.21Å; D38-R42 PolarHBondContact OD2-NE 2.79Å; D38-R42 IonicContact OD2-NH1 3.86Å; D38-R42 IonicContact OD2-NH2 2.94Å; D38-R42 PolarHBondContact OD2-NH2 2.8Å; F39-R42 PolarHBondContact O-N 3.48Å; R42-G44 VanDerWaalsContact C-N 3.34Å; R42-E45 PolarHBondContact O-N 3.04Å; R42-A46 WeakPolarHBondContact O-CB 3.44Å; R42-A46 PolarHBondContact O-N 2.89Å
43	A	96.9	Very high	96.6	Very high	33 Å²	33	100.3 Å²	100.3	27%	0.273	50%	0.504	S	S	.	.	H	α-helix	trans	-64.6	-41.7	174.7	0	0	0	0	0	111	F39 T40 E41 A46 E47	F39-A43 VanDerWaalsContact O-CB 3.25Å; F39-A43 WeakPolarHBondContact O-CB 3.49Å; F39-A43 PolarHBondContact O-N 2.93Å; T40-A43 PolarHBondContact O-N 3.49Å; E41-A43 VanDerWaalsContact C-N 3.31Å; E41-A43 PolarHBondContact O-N 3.35Å; A43-A46 PolarHBondContact O-N 3.43Å; A43-E47 WeakPolarHBondContact O-CB 3.42Å; A43-E47 WeakPolarHBondContact O-CG 3.47Å; A43-E47 PolarHBondContact O-N 3.07Å
44	G	97.1	Very high	96.7	Very high	35 Å²	35	100.1 Å²	100.1	36%	0.361	50%	0.498	S	S	.	.	H	α-helix	trans	-63.4	-41.1	175.2	0	0	0	0	0	113.1	T40 E41 R42 E47 M48	T40-G44 PolarHBondContact O-N 3.33Å; E41-G44 WeakPolarHBondContact O-CA 3.25Å; E41-G44 PolarHBondContact O-N 3.01Å; E41-G44 VanDerWaalsContact O-N 3.08Å; R42-G44 VanDerWaalsContact C-N 3.34Å; G44-E47 PolarHBondContact O-N 2.96Å; G44-M48 WeakPolarHBondContact O-CB 3.31Å; G44-M48 PolarHBondContact O-N 3.41Å
45	E	96.3	Very high	96.6	Very high	111 Å²	111	99.8 Å²	99.8	52%	0.519	50%	0.497	S	S	.	.	H	α-helix	trans	-61	-49.1	174	-70.5	177.4	168.1	0	0	111.7	E41 R42 E47 M48 E49	E41-E45 WeakPolarHBondContact O-CG 3.1Å; E41-E45 PolarHBondContact O-N 3.02Å; R42-E45 PolarHBondContact O-N 3.04Å; E45-E47 VanDerWaalsContact C-N 3.32Å; E45-E47 PolarHBondContact O-N 3.04Å; E45-M48 WeakPolarHBondContact O-CB 3.33Å; E45-M48 PolarHBondContact O-N 3.18Å; E45-E49 PolarHBondContact O-N 3.41Å
46	A	96.6	Very high	96.5	Very high	46 Å²	46	101.5 Å²	101.5	38%	0.38	50%	0.504	S	S	.	.	H	α-helix	trans	-63.3	-37.9	177.9	0	0	0	0	0	112.2	R42 A43 L50	R42-A46 WeakPolarHBondContact O-CB 3.44Å; R42-A46 PolarHBondContact O-N 2.89Å; A43-A46 PolarHBondContact O-N 3.43Å; A46-L50 VanDerWaalsContact O-CG 3.31Å; A46-L50 WeakPolarHBondContact O-CG 3.49Å; A46-L50 PolarHBondContact O-N 2.88Å; A46-L50 VanDerWaalsContact O-N 3.07Å
47	E	97	Very high	96.4	Very high	119 Å²	119	100.9 Å²	100.9	56%	0.556	50%	0.504	S	S	*	.	H	α-helix	trans	-63.2	-42.3	173.7	-79.5	-178.9	-171.8	0	0	111.6	A43 G44 E45 L50 Q51	A43-E47 WeakPolarHBondContact O-CB 3.42Å; A43-E47 WeakPolarHBondContact O-CG 3.47Å; A43-E47 PolarHBondContact O-N 3.07Å; G44-E47 PolarHBondContact O-N 2.96Å; E45-E47 VanDerWaalsContact C-N 3.32Å; E45-E47 PolarHBondContact O-N 3.04Å; E47-L50 PolarHBondContact O-N 2.99Å; E47-Q51 WeakPolarHBondContact O-CB 3.49Å; E47-Q51 WeakPolarHBondContact O-CG 3.46Å; E47-Q51 PolarHBondContact O-N 2.96Å
48	M	96	Very high	96.3	Very high	127 Å²	127	101 Å²	101	63%	0.626	50%	0.498	S	S	*	.	H	α-helix	trans	-62.5	-45	178	-176.2	177.3	63.9	0	0	111.6	G44 E45 Q51 E52	G44-M48 WeakPolarHBondContact O-CB 3.31Å; G44-M48 PolarHBondContact O-N 3.41Å; E45-M48 WeakPolarHBondContact O-CB 3.33Å; E45-M48 PolarHBondContact O-N 3.18Å; M48-Q51 WeakPolarHBondContact O-CB 3.47Å; M48-Q51 PolarHBondContact O-N 3.29Å; M48-Q51 VanDerWaalsContact O-N 3.15Å; M48-E52 PolarHBondContact O-N 2.94Å
49	E	96.2	Very high	96	Very high	123 Å²	123	101.2 Å²	101.2	58%	0.575	50%	0.504	S	S	*	.	H	α-helix	trans	-60.2	-47.7	176.9	-173.9	174.9	-165.1	0	0	111.4	E45 Q51 E52 E53	E45-E49 PolarHBondContact O-N 3.41Å; E49-Q51 VanDerWaalsContact C-N 3.25Å; E49-Q51 PolarHBondContact O-N 3.15Å; E49-E52 WeakPolarHBondContact O-CB 3.35Å; E49-E52 PolarHBondContact O-N 3.17Å; E49-E52 VanDerWaalsContact O-N 3.14Å; E49-E53 PolarHBondContact O-N 3.4Å
50	L	97.2	Very high	95.7	Very high	107 Å²	107	98.8 Å²	98.8	56%	0.56	50%	0.495	S	S	*	.	H	α-helix	trans	-63.7	-30.5	176	-70.3	173.3	0	0	0	112.9	A46 E47 R54	A46-L50 VanDerWaalsContact O-CG 3.31Å; A46-L50 WeakPolarHBondContact O-CG 3.49Å; A46-L50 PolarHBondContact O-N 2.88Å; A46-L50 VanDerWaalsContact O-N 3.07Å; E47-L50 PolarHBondContact O-N 2.99Å; L50-R54 WeakPolarHBondContact O-CB 3.17Å; L50-R54 PolarHBondContact O-N 3.14Å
51	Q	96.6	Very high	95.3	Very high	97 Å²	97	101.3 Å²	101.3	45%	0.453	50%	0.501	S	S	.	.	H	α-helix	trans	-70.9	-39.3	174.3	-71.6	179.9	21.5	0	0	112	E47 M48 E49 R54 L55	E47-Q51 WeakPolarHBondContact O-CB 3.49Å; E47-Q51 WeakPolarHBondContact O-CG 3.46Å; E47-Q51 PolarHBondContact O-N 2.96Å; M48-Q51 WeakPolarHBondContact O-CB 3.47Å; M48-Q51 PolarHBondContact O-N 3.29Å; M48-Q51 VanDerWaalsContact O-N 3.15Å; E49-Q51 VanDerWaalsContact C-N 3.25Å; E49-Q51 PolarHBondContact O-N 3.15Å; Q51-R54 PolarHBondContact O-N 3.23Å; Q51-L55 VanDerWaalsContact O-CG 3.32Å; Q51-L55 WeakPolarHBondContact O-CG 3.32Å; Q51-L55 PolarHBondContact O-N 3.46Å; Q51-L55 VanDerWaalsContact O-N 3.1Å
52	E	96	Very high	94.8	Very high	117 Å²	117	100 Å²	100	55%	0.547	50%	0.495	S	S	.	.	H	α-helix	trans	-62.9	-51.8	175	-176.5	170	-164.7	0	0	111.1	M48 E49 R54 L55 E56	M48-E52 PolarHBondContact O-N 2.94Å; E49-E52 WeakPolarHBondContact O-CB 3.35Å; E49-E52 PolarHBondContact O-N 3.17Å; E49-E52 VanDerWaalsContact O-N 3.14Å; E52-R54 PolarHBondContact O-N 3.45Å; E52-L55 WeakPolarHBondContact O-CB 3.46Å; E52-L55 PolarHBondContact O-N 2.98Å; E52-E56 PolarHBondContact O-N 2.96Å
53	E	95.6	Very high	93.9	Very high	101 Å²	101	97.8 Å²	97.8	47%	0.472	49%	0.494	S	S	.	.	H	α-helix	trans	-55.8	-40.7	176.9	-69.9	-172.3	144.6	0	0	112	E49 L55 E56 L57	E49-E53 PolarHBondContact O-N 3.4Å; E53-L55 PolarHBondContact O-N 3.01Å; E53-E56 PolarHBondContact O-N 3.41Å; E53-L57 WeakPolarHBondContact O-CG 3.48Å; E53-L57 PolarHBondContact O-N 3Å
54	R	96.6	Very high	93	Very high	129 Å²	129	102.5 Å²	102.5	49%	0.487	51%	0.508	S	S	.	.	H	α-helix	trans	-63.4	-41.7	176.7	-175.5	-176	65	-107.4	-4.1	112	L50 Q51 E52 L57 Q58	L50-R54 WeakPolarHBondContact O-CB 3.17Å; L50-R54 PolarHBondContact O-N 3.14Å; Q51-R54 PolarHBondContact O-N 3.23Å; E52-R54 PolarHBondContact O-N 3.45Å; R54-L57 PolarHBondContact O-N 3.1Å; R54-Q58 WeakPolarHBondContact O-CB 3.44Å; R54-Q58 PolarHBondContact O-N 3.49Å
55	L	96	Very high	92.1	Very high	107 Å²	107	107 Å²	107	56%	0.56	53%	0.528	S	S	*	.	H	α-helix	trans	-65.9	-41.3	178.3	-71.7	170.9	0	0	0	111.2	Q51 E52 E53 Q58 S59	Q51-L55 VanDerWaalsContact O-CG 3.32Å; Q51-L55 WeakPolarHBondContact O-CG 3.32Å; Q51-L55 PolarHBondContact O-N 3.46Å; Q51-L55 VanDerWaalsContact O-N 3.1Å; E52-L55 WeakPolarHBondContact O-CB 3.46Å; E52-L55 PolarHBondContact O-N 2.98Å; E53-L55 PolarHBondContact O-N 3.01Å; L55-Q58 PolarHBondContact O-N 2.68Å; L55-S59 WeakPolarHBondContact O-CB 3.5Å; L55-S59 PolarHBondContact O-N 3.07Å
56	E	94.6	Very high	91	Very high	119 Å²	119	109.2 Å²	109.2	56%	0.556	54%	0.536	S	S	*	.	H	α-helix	trans	-60.8	-47.2	175.5	-68.2	-168.8	161.4	0	0	111.7	E52 E53 Q58 S59 H60	E52-E56 PolarHBondContact O-N 2.96Å; E53-E56 PolarHBondContact O-N 3.41Å; E56-Q58 PolarHBondContact O-N 3.23Å; E56-S59 PolarHBondContact O-N 3.02Å; E56-S59 PolarHBondContact O-OG 3.22Å; E56-H60 PolarHBondContact O-N 3.12Å
57	L	93.6	Very high	89.5	Confident	110 Å²	110	114.8 Å²	114.8	58%	0.576	57%	0.57	S	S	*	*	H	α-helix	trans	-61.8	-44.6	177.8	-72	173.7	0	0	0	112.1	E53 R54 S59 H60 E61	E53-L57 WeakPolarHBondContact O-CG 3.48Å; E53-L57 PolarHBondContact O-N 3Å; R54-L57 PolarHBondContact O-N 3.1Å; L57-S59 VanDerWaalsContact C-N 3.3Å; L57-S59 PolarHBondContact O-N 3.49Å; L57-H60 PolarHBondContact O-N 3Å; L57-E61 WeakPolarHBondContact O-CG 3.33Å; L57-E61 PolarHBondContact O-N 3.42Å
58	Q	94.4	Very high	89.1	Confident	95 Å²	95	114.6 Å²	114.6	44%	0.444	57%	0.571	S	S	.	*	H	α-helix	trans	-60.9	-41.2	176.4	-173.8	-177	-25	0	0	111.3	R54 L55 E56 H60 E61 E62	R54-Q58 WeakPolarHBondContact O-CB 3.44Å; R54-Q58 PolarHBondContact O-N 3.49Å; L55-Q58 PolarHBondContact O-N 2.68Å; E56-Q58 PolarHBondContact O-N 3.23Å; Q58-H60 VanDerWaalsContact C-N 3.3Å; Q58-H60 PolarHBondContact O-N 2.99Å; Q58-E61 PolarHBondContact O-N 3.48Å; Q58-E62 PolarHBondContact NE2-OE1 3.1Å; Q58-E62 VanDerWaalsContact NE2-OE1 3.12Å; Q58-E62 WeakPolarHBondContact O-CG 3.43Å; Q58-E62 PolarHBondContact O-N 3.2Å
59	S	91.4	Very high	88.8	Confident	61 Å²	61	113.9 Å²	113.9	43%	0.427	57%	0.568	S	S	.	*	H	α-helix	trans	-61.6	-39.1	177.5	82.6	0	0	0	0	112.2	L55 E56 L57 E62 L63	L55-S59 WeakPolarHBondContact O-CB 3.5Å; L55-S59 PolarHBondContact O-N 3.07Å; E56-S59 PolarHBondContact O-N 3.02Å; E56-S59 PolarHBondContact O-OG 3.22Å; L57-S59 VanDerWaalsContact C-N 3.3Å; L57-S59 PolarHBondContact O-N 3.49Å; S59-E62 PolarHBondContact O-N 3.18Å; S59-L63 WeakPolarHBondContact O-CG 3.41Å; S59-L63 PolarHBondContact O-N 3.38Å; S59-L63 VanDerWaalsContact O-N 3.09Å
60	H	90.6	Very high	88.4	Confident	96 Å²	96	113.4 Å²	113.4	44%	0.444	57%	0.568	S	S	.	*	H	α-helix	trans	-71.4	-35.3	179.1	178.3	-118.6	0	0	0	112.4	E56 L57 Q58 K64	E56-H60 PolarHBondContact O-N 3.12Å; L57-H60 PolarHBondContact O-N 3Å; Q58-H60 VanDerWaalsContact C-N 3.3Å; Q58-H60 PolarHBondContact O-N 2.99Å; H60-K64 WeakPolarHBondContact CE1-CE 3.19Å; H60-K64 PolarHBondContact CE1-NZ 3.31Å; H60-K64 WeakPolarHBondContact NE2-CE 3.44Å; H60-K64 WeakPolarHBondContact O-CG 3.49Å; H60-K64 PolarHBondContact O-N 3.08Å; H60-K64 VanDerWaalsContact O-N 3.1Å
61	E	88.6	Confident	87.8	Confident	127 Å²	127	113.8 Å²	113.8	59%	0.593	57%	0.568	S	S	*	*	H	α-helix	trans	-65.2	-44.5	171.9	-71.4	-175.6	170	0	0	111.9	L57 Q58 L63 K64 V65	L57-E61 WeakPolarHBondContact O-CG 3.33Å; L57-E61 PolarHBondContact O-N 3.42Å; Q58-E61 PolarHBondContact O-N 3.48Å; E61-L63 VanDerWaalsContact C-N 3.31Å; E61-L63 PolarHBondContact O-N 3.09Å; E61-K64 PolarHBondContact O-N 3.48Å; E61-V65 WeakPolarHBondContact O-CG2 3.33Å; E61-V65 PolarHBondContact O-N 3.39Å; E61-V65 VanDerWaalsContact O-N 3.08Å
62	E	85.8	Confident	87.3	Confident	90 Å²	90	114.8 Å²	114.8	42%	0.421	58%	0.576	S	S	.	*	H	α-helix	trans	-62.8	-36.1	177.6	-72.8	-178.5	-160.5	0	0	112.8	Q58 S59 K66	Q58-E62 PolarHBondContact NE2-OE1 3.1Å; Q58-E62 VanDerWaalsContact NE2-OE1 3.12Å; Q58-E62 WeakPolarHBondContact O-CG 3.43Å; Q58-E62 PolarHBondContact O-N 3.2Å; S59-E62 PolarHBondContact O-N 3.18Å; E62-K66 WeakPolarHBondContact O-CD 3.31Å; E62-K66 VanDerWaalsContact O-CG 3.31Å; E62-K66 WeakPolarHBondContact O-CG 3.5Å; E62-K66 PolarHBondContact O-N 3.16Å
63	L	78.9	Confident	86.7	Confident	104 Å²	104	114.7 Å²	114.7	55%	0.545	58%	0.577	S	S	.	*	H	α-helix	trans	-68.3	-39.4	174.5	-72.4	171.7	0	0	0	111.9	S59 E61 V65 K66 C67	S59-L63 WeakPolarHBondContact O-CG 3.41Å; S59-L63 PolarHBondContact O-N 3.38Å; S59-L63 VanDerWaalsContact O-N 3.09Å; E61-L63 VanDerWaalsContact C-N 3.31Å; E61-L63 PolarHBondContact O-N 3.09Å; L63-V65 VanDerWaalsContact C-N 3.32Å; L63-V65 PolarHBondContact O-N 3.44Å; L63-K66 PolarHBondContact O-N 3.25Å; L63-C67 PolarHBondContact O-N 3.31Å; L63-C67 VanDerWaalsContact O-N 3.16Å; L63-C67 PolarHBondContact O-SG 3.44Å
64	K	77.3	Confident	86.1	Confident	132 Å²	132	115.6 Å²	115.6	57%	0.574	59%	0.585	S	S	*	*	H	α-helix	trans	-64.9	-31.9	176	-80.5	176.5	170.2	177.7	0	113.6	H60 E61	H60-K64 WeakPolarHBondContact CE1-CE 3.19Å; H60-K64 PolarHBondContact CE1-NZ 3.31Å; H60-K64 WeakPolarHBondContact NE2-CE 3.44Å; H60-K64 WeakPolarHBondContact O-CG 3.49Å; H60-K64 PolarHBondContact O-N 3.08Å; H60-K64 VanDerWaalsContact O-N 3.1Å; E61-K64 PolarHBondContact O-N 3.48Å
65	V	79.7	Confident	85.3	Confident	128 Å²	128	114.6 Å²	114.6	78%	0.776	59%	0.593	S	S	*	*	H	α-helix	trans	-76.8	-25.6	177.1	174.7	0	0	0	0	111.8	E61 L63	E61-V65 WeakPolarHBondContact O-CG2 3.33Å; E61-V65 PolarHBondContact O-N 3.39Å; E61-V65 VanDerWaalsContact O-N 3.08Å; L63-V65 VanDerWaalsContact C-N 3.32Å; L63-V65 PolarHBondContact O-N 3.44Å
66	K	72.1	Confident	84.4	Confident	158 Å²	158	115.3 Å²	115.3	69%	0.687	60%	0.595	S	S	*	*	H	α-helix	trans	-86.5	-23.3	-179.2	-73.4	171.1	-174.9	164.2	0	114	E62 L63	E62-K66 WeakPolarHBondContact O-CD 3.31Å; E62-K66 VanDerWaalsContact O-CG 3.31Å; E62-K66 WeakPolarHBondContact O-CG 3.5Å; E62-K66 PolarHBondContact O-N 3.16Å; L63-K66 PolarHBondContact O-N 3.25Å
67	C	65.7	Low	83.5	Confident	163 Å²	163	114.9 Å²	114.9	100%	1.101	60%	0.599	S	S	*	*			trans	-87.6	0	175	-69.8	0	0	0	0	111.5	L63	L63-C67 PolarHBondContact O-N 3.31Å; L63-C67 VanDerWaalsContact O-N 3.16Å; L63-C67 PolarHBondContact O-SG 3.44Å

Retrieved 67 of 67 residues in 14.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).