A0A077Z8Z0_TRITR Loading...

Cytochrome b-c1 complex subunit 8

Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The complex plays an important role in the uptake of multiple carbon sources present in different host niches.

AlphaFold DB , UniProt , Accession A0A077Z8Z0, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 79 aa.

						>A0A077Z8Z0_TRITR|A0A077Z8Z0
MRPWGKMAKLYGVYSFGLSPFEQKAFGEFGSDMYKLGRMFLENWWALIPVPIFYSLREYGMKQEEKRLRKNPAAFANDV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	78.7	Confident	89.5	Confident	242 Å²	242	153.2 Å²	153.2	100%	1.192	75%	0.75	S	S	*	*				0	142.4	0	-67.7	171.7	174.4	0	0	108.3
2	R	84.9	Confident	90	Very high	193 Å²	193	145.9 Å²	145.9	73%	0.728	74%	0.744	S	S	*	*	P	Polyproline II helix	trans	-72.6	137.1	176.9	-65.3	-179.3	-173.4	163	2	109.1
3	P	90.4	Very high	90.2	Very high	81 Å²	81	143.2 Å²	143.2	53%	0.526	74%	0.738	S	S	.	*	P	Polyproline II helix	trans	-66.9	156	179.8	28.5	-34.4	0	0	0	111.2	G5 K6	P3-G5 PolarHBondContact O-N 3.09Å; P3-K6 HydrophobicContact CG-CB 4.23Å; P3-K6 HydrophobicContact CG-CD 4.11Å; P3-K6 HydrophobicContact CG-CG 4.32Å; P3-K6 PolarHBondContact O-N 3.47Å
4	W	90.5	Very high	90.5	Very high	236 Å²	236	147.2 Å²	147.2	89%	0.894	74%	0.741	S	S	*	*	T	Hydrogen-bonded Turn	trans	-52.8	140	170	-70.6	-31.2	0	0	0	110.6	K6 M7	W4-K6 VanDerWaalsContact C-N 3.34Å; W4-K6 PolarHBondContact O-N 3.47Å; W4-M7 HydrophobicContact CB-CE 4.47Å; W4-M7 HydrophobicContact CG-CE 4.35Å
5	G	88.9	Confident	90.8	Very high	77 Å²	77	144.8 Å²	144.8	79%	0.794	74%	0.744	S	S	*	*	T	Hydrogen-bonded Turn	trans	86.7	-15.8	-172.6	0	0	0	0	0	115.6	P3	P3-G5 PolarHBondContact O-N 3.09Å
6	K	92	Very high	91.2	Very high	165 Å²	165	148.3 Å²	148.3	72%	0.717	75%	0.752	S	S	*	*	S	Bend	trans	-115.4	24.3	174	-60.9	-172.1	-178.4	-179.8	0	113.3	P3 W4	P3-K6 HydrophobicContact CG-CB 4.23Å; P3-K6 HydrophobicContact CG-CD 4.11Å; P3-K6 HydrophobicContact CG-CG 4.32Å; P3-K6 PolarHBondContact O-N 3.47Å; W4-K6 VanDerWaalsContact C-N 3.34Å; W4-K6 PolarHBondContact O-N 3.47Å
7	M	92.5	Very high	91.3	Very high	108 Å²	108	144.3 Å²	144.3	53%	0.532	76%	0.757	S	S	.	*	S	Bend	trans	-80.6	-57.1	-174.9	-65.1	-176.5	-76.5	0	0	112	W4	W4-M7 HydrophobicContact CB-CE 4.47Å; W4-M7 HydrophobicContact CG-CE 4.35Å
8	A	90.1	Very high	91.5	Very high	74 Å²	74	142.6 Å²	142.6	61%	0.612	75%	0.748	S	S	*	*			trans	-154.9	158.8	-177.1	0	0	0	0	0	110.5	L10	A8-L10 HydrophobicContact CB-CG 4.29Å
9	K	92.1	Very high	91.6	Very high	181 Å²	181	137.7 Å²	137.7	79%	0.787	73%	0.727	S	S	*	*			trans	-93.3	110.3	167	-67.3	-178.1	-180	179.9	0	107.8	Y11	K9-Y11 HydrophobicContact CB-CE2 3.99Å
10	L	91.4	Very high	91.7	Very high	135 Å²	135	136.1 Å²	136.1	71%	0.707	72%	0.724	S	S	*	*			trans	-118.2	132.9	177.9	-63	170.5	0	0	0	108	A8	A8-L10 HydrophobicContact CB-CG 4.29Å
11	Y	93.2	Very high	91.8	Very high	193 Å²	193	139 Å²	139	76%	0.757	73%	0.731	S	S	*	*			trans	-130.1	139.7	177.5	-60.6	-81.7	0	0	0	108.8	K9 V13	K9-Y11 HydrophobicContact CB-CE2 3.99Å; Y11-V13 PolarHBondContact O-N 3.45Å
12	G	94.6	Very high	92.6	Very high	66 Å²	66	134.3 Å²	134.3	68%	0.68	71%	0.706	S	S	*	*	S	Bend	trans	74.6	17.7	173.4	0	0	0	0	0	116.3
13	V	93.2	Very high	92.9	Very high	111 Å²	111	130.1 Å²	130.1	67%	0.673	70%	0.695	S	S	*	*			trans	-99.6	119.8	175.9	-176.8	0	0	0	0	109.8	Y11	Y11-V13 PolarHBondContact O-N 3.45Å
14	Y	94.8	Very high	93	Very high	199 Å²	199	134.7 Å²	134.7	78%	0.78	71%	0.707	S	S	*	*			trans	-111	136	172.3	-59.1	-86.2	0	0	0	109.2
15	S	95.1	Very high	92.9	Very high	111 Å²	111	128 Å²	128	78%	0.776	70%	0.701	S	S	*	*			trans	-127	146.9	175.1	59	0	0	0	0	110.2
16	F	96	Very high	92.9	Very high	201 Å²	201	132.5 Å²	132.5	88%	0.882	70%	0.7	S	S	*	*			trans	-118.3	141.5	178	-57	-81	0	0	0	109
17	G	93.9	Very high	92.5	Very high	80 Å²	80	127 Å²	127	83%	0.825	69%	0.69	S	S	*	*			trans	-144.4	142.3	176	0	0	0	0	0	110
18	L	94.2	Very high	92.3	Very high	114 Å²	114	127.4 Å²	127.4	60%	0.597	69%	0.69	S	S	*	*			trans	-89.2	153.7	173.3	-74.4	165.9	0	0	0	110.1	Q23	L18-Q23 HydrophobicContact CB-CG 3.67Å; L18-Q23 HydrophobicContact CD1-CG 4.21Å; L18-Q23 PolarHBondContact O-NE2 2.79Å
19	S	94.8	Very high	92.1	Very high	50 Å²	50	130.2 Å²	130.2	35%	0.35	69%	0.689	S	S	.	*			trans	-61.9	141.1	171.3	177	0	0	0	0	110.2	F21 E22 Q23	S19-F21 PolarHBondContact O-N 3.47Å; S19-F21 VanDerWaalsContact O-N 3.09Å; S19-E22 PolarHBondContact N-OE2 2.94Å; S19-E22 PolarHBondContact O-N 2.84Å; S19-Q23 PolarHBondContact O-N 3.39Å
20	P	93.1	Very high	92	Very high	104 Å²	104	124.3 Å²	124.3	68%	0.675	68%	0.679	S	S	*	*	G	3₁₀ helix	trans	-54.8	-29.3	176.3	-26.7	34.9	0	0	0	113.6	E22 Q23	P20-E22 VanDerWaalsContact C-N 3.29Å; P20-E22 PolarHBondContact O-N 3.25Å; P20-Q23 PolarHBondContact O-N 3.41Å
21	F	94.4	Very high	92	Very high	198 Å²	198	119.9 Å²	119.9	87%	0.868	66%	0.659	S	S	*	*	G	3₁₀ helix	trans	-76.1	-14.5	179	-58.8	-74.2	0	0	0	113.8	S19	S19-F21 PolarHBondContact O-N 3.47Å; S19-F21 VanDerWaalsContact O-N 3.09Å
22	E	93.6	Very high	92	Very high	144 Å²	144	113.7 Å²	113.7	67%	0.673	64%	0.64	S	S	*	*	G	3₁₀ helix	trans	-97.2	-10.9	177.4	-64	174.8	154	0	0	112.2	S19 P20	S19-E22 PolarHBondContact N-OE2 2.94Å; S19-E22 PolarHBondContact O-N 2.84Å; P20-E22 VanDerWaalsContact C-N 3.29Å; P20-E22 PolarHBondContact O-N 3.25Å
23	Q	93.2	Very high	92	Very high	105 Å²	105	115 Å²	115	49%	0.491	63%	0.629	S	S	.	*	S	Bend	trans	-97.3	151.4	-178.2	-62.2	-179	42.9	0	0	111.4	L18 S19 P20	L18-Q23 HydrophobicContact CB-CG 3.67Å; L18-Q23 HydrophobicContact CD1-CG 4.21Å; L18-Q23 PolarHBondContact O-NE2 2.79Å; S19-Q23 PolarHBondContact O-N 3.39Å; P20-Q23 PolarHBondContact O-N 3.41Å
24	K	91	Very high	92.1	Very high	177 Å²	177	117.4 Å²	117.4	77%	0.77	63%	0.627	S	S	*	*			trans	-81.7	130.1	168	-68.3	-178.9	-178.9	178.1	0	109.3	F26 G27	K24-F26 VanDerWaalsContact C-N 3.25Å; K24-F26 PolarHBondContact O-N 2.91Å; K24-G27 PolarHBondContact O-N 2.99Å
25	A	89.5	Confident	92.1	Very high	95 Å²	95	113.1 Å²	113.1	79%	0.785	61%	0.613	S	S	*	*	T	Hydrogen-bonded Turn	trans	-56.8	-37.6	177.7	0	0	0	0	0	113.3
26	F	87.5	Confident	92.1	Very high	172 Å²	172	112.1 Å²	112.1	75%	0.754	60%	0.598	S	S	*	*	T	Hydrogen-bonded Turn	trans	-127.4	58.5	175.8	-60.6	-75.1	0	0	0	110.3	K24 E28	K24-F26 VanDerWaalsContact C-N 3.25Å; K24-F26 PolarHBondContact O-N 2.91Å; F26-E28 VanDerWaalsContact C-N 3.34Å; F26-E28 PolarHBondContact O-N 3.48Å
27	G	85	Confident	92.1	Very high	50 Å²	50	104.1 Å²	104.1	52%	0.515	57%	0.572	S	S	.	*	T	Hydrogen-bonded Turn	trans	-66.5	-31.8	-175.6	0	0	0	0	0	114.6	K24	K24-G27 PolarHBondContact O-N 2.99Å
28	E	87.5	Confident	92.2	Very high	116 Å²	116	106.8 Å²	106.8	54%	0.542	56%	0.558	S	S	.	*	T	Hydrogen-bonded Turn	trans	-122.8	34.5	-170.3	-58.3	-168.2	178.4	0	0	113.8	F26 G30 S31 D32 K35	F26-E28 VanDerWaalsContact C-N 3.34Å; F26-E28 PolarHBondContact O-N 3.48Å; E28-G30 PolarHBondContact O-N 3.46Å; E28-S31 WeakPolarHBondContact CB-OG 3.39Å; E28-S31 WeakPolarHBondContact O-CA 3.39Å; E28-S31 PolarHBondContact O-N 3.3Å; E28-S31 PolarHBondContact O-OG 2.83Å; E28-S31 PolarHBondContact OE2-OG 2.89Å; E28-D32 PolarHBondContact O-N 3.39Å; E28-K35 IonicContact OE2-NZ 3.46Å
29	F	86.8	Confident	92.3	Very high	133 Å²	133	106.3 Å²	106.3	58%	0.583	55%	0.553	S	S	*	*	H	α-helix	trans	-48.1	-40.4	-174.5	-174.7	-98	0	0	0	114.2	D32 M33	F29-D32 PolarHBondContact O-N 2.85Å; F29-M33 HydrophobicContact CD1-CG 4.06Å; F29-M33 HydrophobicContact CE1-CG 3.69Å; F29-M33 HydrophobicContact CE1-SD 4.13Å; F29-M33 HydrophobicContact CE2-CG 4.35Å; F29-M33 HydrophobicContact CZ-CG 3.85Å; F29-M33 HydrophobicContact CZ-SD 3.85Å; F29-M33 WeakPolarHBondContact O-CB 3.16Å; F29-M33 WeakPolarHBondContact O-CG 3.45Å; F29-M33 PolarHBondContact O-N 3.29Å
30	G	89.4	Confident	92.3	Very high	56 Å²	56	109.9 Å²	109.9	58%	0.577	56%	0.563	S	S	*	*	H	α-helix	trans	-67.4	-39.8	175.9	0	0	0	0	0	114.1	E28 D32 Y34	E28-G30 PolarHBondContact O-N 3.46Å; G30-D32 VanDerWaalsContact C-N 3.34Å; G30-Y34 PolarHBondContact O-N 3.48Å
31	S	92.2	Very high	92.4	Very high	42 Å²	42	110.7 Å²	110.7	29%	0.294	56%	0.561	S	S	.	*	H	α-helix	trans	-67.9	-39.2	176.2	107.7	0	0	0	0	110.3	E28 Y34 K35	E28-S31 WeakPolarHBondContact CB-OG 3.39Å; E28-S31 WeakPolarHBondContact O-CA 3.39Å; E28-S31 PolarHBondContact O-N 3.3Å; E28-S31 PolarHBondContact O-OG 2.83Å; E28-S31 PolarHBondContact OE2-OG 2.89Å; S31-Y34 PolarHBondContact O-N 3.49Å; S31-K35 VanDerWaalsContact O-CG 3.3Å; S31-K35 WeakPolarHBondContact O-CG 3.3Å; S31-K35 PolarHBondContact O-N 3.06Å; S31-K35 PolarHBondContact OG-NZ 2.89Å
32	D	92.4	Very high	92.4	Very high	64 Å²	64	105.9 Å²	105.9	34%	0.342	54%	0.541	S	S	.	.	H	α-helix	trans	-68.5	-41.6	178.9	-65.7	-25.9	0	0	0	111.6	E28 F29 G30 Y34 K35 L36	E28-D32 PolarHBondContact O-N 3.39Å; F29-D32 PolarHBondContact O-N 2.85Å; G30-D32 VanDerWaalsContact C-N 3.34Å; D32-Y34 VanDerWaalsContact C-N 3.32Å; D32-Y34 PolarHBondContact O-N 3.07Å; D32-K35 PolarHBondContact O-N 3.3Å; D32-K35 IonicContact OD1-NZ 3.51Å; D32-K35 PolarHBondContact OD1-NZ 3.34Å; D32-L36 WeakPolarHBondContact O-CB 3.31Å; D32-L36 VanDerWaalsContact O-CG 3.31Å; D32-L36 WeakPolarHBondContact O-CG 3.41Å; D32-L36 PolarHBondContact O-N 2.89Å
33	M	93.7	Very high	92.5	Very high	93 Å²	93	103 Å²	103	46%	0.458	53%	0.531	S	S	.	.	H	α-helix	trans	-61.5	-40.8	172.5	-72.9	-87.1	80.5	0	0	111.9	F29 L36 G37	F29-M33 HydrophobicContact CD1-CG 4.06Å; F29-M33 HydrophobicContact CE1-CG 3.69Å; F29-M33 HydrophobicContact CE1-SD 4.13Å; F29-M33 HydrophobicContact CE2-CG 4.35Å; F29-M33 HydrophobicContact CZ-CG 3.85Å; F29-M33 HydrophobicContact CZ-SD 3.85Å; F29-M33 WeakPolarHBondContact O-CB 3.16Å; F29-M33 WeakPolarHBondContact O-CG 3.45Å; F29-M33 PolarHBondContact O-N 3.29Å; M33-L36 HydrophobicContact CE-CB 4.48Å; M33-L36 HydrophobicContact CE-CD1 3.48Å; M33-L36 VanDerWaalsContact CE-CD1 3.48Å; M33-L36 PolarHBondContact O-N 3.48Å; M33-G37 PolarHBondContact O-N 2.88Å
34	Y	95.4	Very high	92.6	Very high	161 Å²	161	104.7 Å²	104.7	63%	0.631	53%	0.532	S	S	*	.	H	α-helix	trans	-63.8	-45.1	174.7	178.3	-98	0	0	0	112	G30 S31 D32 L36 G37 R38	G30-Y34 PolarHBondContact O-N 3.48Å; S31-Y34 PolarHBondContact O-N 3.49Å; D32-Y34 VanDerWaalsContact C-N 3.32Å; D32-Y34 PolarHBondContact O-N 3.07Å; Y34-L36 PolarHBondContact O-N 3.43Å; Y34-G37 PolarHBondContact O-N 2.85Å; Y34-R38 WeakPolarHBondContact O-CB 3.45Å; Y34-R38 PolarHBondContact O-N 3.34Å
35	K	95.9	Very high	92.7	Very high	110 Å²	110	103.6 Å²	103.6	48%	0.478	52%	0.524	S	S	.	.	H	α-helix	trans	-60.2	-44.3	175.5	-71	166.9	-165.5	153.9	0	111.4	E28 S31 D32 R38 M39	E28-K35 IonicContact OE2-NZ 3.46Å; S31-K35 VanDerWaalsContact O-CG 3.3Å; S31-K35 WeakPolarHBondContact O-CG 3.3Å; S31-K35 PolarHBondContact O-N 3.06Å; S31-K35 PolarHBondContact OG-NZ 2.89Å; D32-K35 PolarHBondContact O-N 3.3Å; D32-K35 IonicContact OD1-NZ 3.51Å; D32-K35 PolarHBondContact OD1-NZ 3.34Å; K35-R38 PolarHBondContact O-N 3.06Å; K35-M39 VanDerWaalsContact O-CB 3.31Å; K35-M39 WeakPolarHBondContact O-CB 3.31Å; K35-M39 PolarHBondContact O-N 3.47Å
36	L	95.1	Very high	92.9	Very high	89 Å²	89	102 Å²	102	47%	0.466	51%	0.51	S	S	.	.	H	α-helix	trans	-63	-45	176.8	-75.2	170.4	0	0	0	111.8	D32 M33 Y34 M39 F40	D32-L36 WeakPolarHBondContact O-CB 3.31Å; D32-L36 VanDerWaalsContact O-CG 3.31Å; D32-L36 WeakPolarHBondContact O-CG 3.41Å; D32-L36 PolarHBondContact O-N 2.89Å; M33-L36 HydrophobicContact CE-CB 4.48Å; M33-L36 HydrophobicContact CE-CD1 3.48Å; M33-L36 VanDerWaalsContact CE-CD1 3.48Å; M33-L36 PolarHBondContact O-N 3.48Å; Y34-L36 PolarHBondContact O-N 3.43Å; L36-M39 HydrophobicContact CD2-CE 3.91Å; L36-M39 PolarHBondContact O-N 2.84Å; L36-F40 WeakPolarHBondContact O-CB 3.34Å; L36-F40 PolarHBondContact O-N 3.39Å
37	G	95.9	Very high	93.1	Very high	33 Å²	33	98.4 Å²	98.4	34%	0.34	50%	0.498	S	S	.	.	H	α-helix	trans	-62.1	-43.4	175.9	0	0	0	0	0	112.3	M33 Y34 F40 L41	M33-G37 PolarHBondContact O-N 2.88Å; Y34-G37 PolarHBondContact O-N 2.85Å; G37-F40 PolarHBondContact O-N 3.36Å; G37-L41 WeakPolarHBondContact O-CG 3.39Å; G37-L41 PolarHBondContact O-N 3.43Å
38	R	96.6	Very high	93.5	Very high	137 Å²	137	99.5 Å²	99.5	52%	0.517	49%	0.492	S	S	.	.	H	α-helix	trans	-62.3	-46.6	174.5	-178.2	179	169.6	154.5	1.2	111.7	Y34 K35 F40 L41 E42	Y34-R38 WeakPolarHBondContact O-CB 3.45Å; Y34-R38 PolarHBondContact O-N 3.34Å; K35-R38 PolarHBondContact O-N 3.06Å; R38-F40 VanDerWaalsContact C-N 3.3Å; R38-F40 PolarHBondContact O-N 2.97Å; R38-L41 CarbonylContact O-C 3.53Å; R38-L41 PolarHBondContact O-N 2.83Å; R38-L41 VanDerWaalsContact O-N 3.15Å; R38-E42 HydrophobicContact CG-CG 4.42Å; R38-E42 IonicContact CZ-OE1 3.23Å; R38-E42 IonicContact NE-OE1 3.85Å; R38-E42 PolarHBondContact NE-OE1 2.77Å; R38-E42 IonicContact NH2-OE1 2.77Å; R38-E42 PolarHBondContact NH2-OE1 2.98Å; R38-E42 WeakPolarHBondContact O-CG 3.43Å; R38-E42 PolarHBondContact O-N 3.34Å
39	M	95.7	Very high	93.8	Very high	104 Å²	104	96.9 Å²	96.9	51%	0.512	49%	0.485	S	S	.	.	H	α-helix	trans	-61	-39.2	177.1	-175.4	-177.6	72.5	0	0	111.6	K35 L36 E42 N43	K35-M39 VanDerWaalsContact O-CB 3.31Å; K35-M39 WeakPolarHBondContact O-CB 3.31Å; K35-M39 PolarHBondContact O-N 3.47Å; L36-M39 HydrophobicContact CD2-CE 3.91Å; L36-M39 PolarHBondContact O-N 2.84Å; M39-E42 PolarHBondContact O-N 3.4Å; M39-N43 WeakPolarHBondContact O-CB 3.39Å; M39-N43 PolarHBondContact O-N 2.82Å; M39-N43 VanDerWaalsContact O-N 3.11Å; M39-N43 PolarHBondContact O-ND2 3.11Å
40	F	95.1	Very high	94.2	Very high	125 Å²	125	95.1 Å²	95.1	55%	0.548	48%	0.484	S	S	.	.	H	α-helix	trans	-62.2	-46	173.2	177.7	-98	0	0	0	111.6	L36 G37 R38 E42 N43 W44 L47	L36-F40 WeakPolarHBondContact O-CB 3.34Å; L36-F40 PolarHBondContact O-N 3.39Å; G37-F40 PolarHBondContact O-N 3.36Å; R38-F40 VanDerWaalsContact C-N 3.3Å; R38-F40 PolarHBondContact O-N 2.97Å; F40-E42 VanDerWaalsContact C-N 3.31Å; F40-E42 PolarHBondContact O-N 3.15Å; F40-N43 CarbonylContact O-C 3.55Å; F40-N43 PolarHBondContact O-N 3.28Å; F40-W44 WeakPolarHBondContact O-CA 3.47Å; F40-W44 WeakPolarHBondContact O-CB 3.47Å; F40-W44 PolarHBondContact O-N 3.08Å; F40-L47 HydrophobicContact CE2-CD1 4.24Å
41	L	94.5	Very high	94.4	Very high	120 Å²	120	95.9 Å²	95.9	63%	0.628	48%	0.479	S	S	*	.	H	α-helix	trans	-70.2	-21.4	176.6	-68.4	175.7	0	0	0	114.1	G37 R38	G37-L41 WeakPolarHBondContact O-CG 3.39Å; G37-L41 PolarHBondContact O-N 3.43Å; R38-L41 CarbonylContact O-C 3.53Å; R38-L41 PolarHBondContact O-N 2.83Å; R38-L41 VanDerWaalsContact O-N 3.15Å
42	E	95.5	Very high	94.6	Very high	98 Å²	98	98.7 Å²	98.7	46%	0.458	49%	0.49	S	S	.	.	H	α-helix	trans	-79.6	-28.1	172.6	-75.4	173.6	179.1	0	0	111.4	R38 M39 F40 W45	R38-E42 HydrophobicContact CG-CG 4.42Å; R38-E42 IonicContact CZ-OE1 3.23Å; R38-E42 IonicContact NE-OE1 3.85Å; R38-E42 PolarHBondContact NE-OE1 2.77Å; R38-E42 IonicContact NH2-OE1 2.77Å; R38-E42 PolarHBondContact NH2-OE1 2.98Å; R38-E42 WeakPolarHBondContact O-CG 3.43Å; R38-E42 PolarHBondContact O-N 3.34Å; M39-E42 PolarHBondContact O-N 3.4Å; F40-E42 VanDerWaalsContact C-N 3.31Å; F40-E42 PolarHBondContact O-N 3.15Å; E42-W45 PolarHBondContact O-NE1 3.23Å
43	N	95	Very high	94.8	Very high	84 Å²	84	102.3 Å²	102.3	45%	0.449	50%	0.503	S	S	.	.	H	α-helix	trans	-112.7	0.5	-172.8	-64.8	-71.7	0	0	0	114.7	M39 F40 W45 A46	M39-N43 WeakPolarHBondContact O-CB 3.39Å; M39-N43 PolarHBondContact O-N 2.82Å; M39-N43 VanDerWaalsContact O-N 3.11Å; M39-N43 PolarHBondContact O-ND2 3.11Å; F40-N43 CarbonylContact O-C 3.55Å; F40-N43 PolarHBondContact O-N 3.28Å; N43-W45 PolarHBondContact O-N 2.81Å; N43-W45 VanDerWaalsContact O-N 3.08Å; N43-A46 VanDerWaalsContact O-CB 3.27Å; N43-A46 WeakPolarHBondContact O-CB 3.46Å; N43-A46 PolarHBondContact O-N 2.98Å
44	W	94	Very high	94.9	Very high	140 Å²	140	104.3 Å²	104.3	53%	0.53	51%	0.506	S	S	.	.	G	3₁₀ helix	trans	-56.1	-32.5	-175.9	72.8	-94.1	0	0	0	112.8	F40 A46 L47 I48	F40-W44 WeakPolarHBondContact O-CA 3.47Å; F40-W44 WeakPolarHBondContact O-CB 3.47Å; F40-W44 PolarHBondContact O-N 3.08Å; W44-A46 PolarHBondContact O-N 3.23Å; W44-L47 VanDerWaalsContact O-CB 3.3Å; W44-L47 WeakPolarHBondContact O-CB 3.49Å; W44-L47 PolarHBondContact O-N 2.87Å; W44-I48 HydrophobicContact CE3-CG1 4.37Å; W44-I48 HydrophobicContact CH2-CD1 4.12Å; W44-I48 HydrophobicContact CZ3-CD1 3.79Å; W44-I48 HydrophobicContact CZ3-CG1 3.87Å
45	W	93.6	Very high	95	Very high	154 Å²	154	99.9 Å²	99.9	58%	0.583	50%	0.499	S	S	*	.	G	3₁₀ helix	trans	-65.3	-24.8	-179.2	62.4	-89.6	0	0	0	112.5	E42 N43 L47 I48	E42-W45 PolarHBondContact O-NE1 3.23Å; N43-W45 PolarHBondContact O-N 2.81Å; N43-W45 VanDerWaalsContact O-N 3.08Å; W45-L47 PolarHBondContact O-N 2.96Å; W45-I48 HydrophobicContact CB-CD1 3.78Å; W45-I48 VanDerWaalsContact O-CB 3.26Å; W45-I48 WeakPolarHBondContact O-CB 3.36Å; W45-I48 WeakPolarHBondContact O-CD1 3.27Å; W45-I48 VanDerWaalsContact O-CG1 3.23Å; W45-I48 WeakPolarHBondContact O-CG1 3.3Å; W45-I48 PolarHBondContact O-N 3.49Å; W45-I48 VanDerWaalsContact O-N 3.07Å
46	A	93.8	Very high	95	Very high	60 Å²	60	100 Å²	100	50%	0.496	50%	0.504	S	S	.	.	G	3₁₀ helix	trans	-64.3	-17.5	172.8	0	0	0	0	0	112.4	N43 W44 P49	N43-A46 VanDerWaalsContact O-CB 3.27Å; N43-A46 WeakPolarHBondContact O-CB 3.46Å; N43-A46 PolarHBondContact O-N 2.98Å; W44-A46 PolarHBondContact O-N 3.23Å; A46-P49 WeakPolarHBondContact O-CD 3.34Å
47	L	92.5	Very high	95.1	Very high	97 Å²	97	103.3 Å²	103.3	51%	0.508	51%	0.51	S	S	.	.	G	3₁₀ helix	trans	-89.4	-6.9	176	-57.3	173.8	0	0	0	113.3	F40 W44 W45 P49 V50 P51	F40-L47 HydrophobicContact CE2-CD1 4.24Å; W44-L47 VanDerWaalsContact O-CB 3.3Å; W44-L47 WeakPolarHBondContact O-CB 3.49Å; W44-L47 PolarHBondContact O-N 2.87Å; W45-L47 PolarHBondContact O-N 2.96Å; L47-P49 VanDerWaalsContact C-N 3.31Å; L47-V50 WeakPolarHBondContact O-CB 3.25Å; L47-V50 WeakPolarHBondContact O-CG2 3.34Å; L47-V50 PolarHBondContact O-N 2.93Å; L47-P51 VanDerWaalsContact O-CD 3.3Å; L47-P51 WeakPolarHBondContact O-CD 3.26Å
48	I	93	Very high	95.1	Very high	74 Å²	74	105.2 Å²	105.2	38%	0.379	51%	0.51	S	S	.	.	T	Hydrogen-bonded Turn	trans	-54.6	-35.7	177.9	-68.9	168.7	0	0	0	113.8	W44 W45 V50 P51 I52	W44-I48 HydrophobicContact CE3-CG1 4.37Å; W44-I48 HydrophobicContact CH2-CD1 4.12Å; W44-I48 HydrophobicContact CZ3-CD1 3.79Å; W44-I48 HydrophobicContact CZ3-CG1 3.87Å; W45-I48 HydrophobicContact CB-CD1 3.78Å; W45-I48 VanDerWaalsContact O-CB 3.26Å; W45-I48 WeakPolarHBondContact O-CB 3.36Å; W45-I48 WeakPolarHBondContact O-CD1 3.27Å; W45-I48 VanDerWaalsContact O-CG1 3.23Å; W45-I48 WeakPolarHBondContact O-CG1 3.3Å; W45-I48 PolarHBondContact O-N 3.49Å; W45-I48 VanDerWaalsContact O-N 3.07Å; I48-V50 PolarHBondContact O-N 2.71Å; I48-P51 WeakPolarHBondContact O-CD 3.43Å; I48-P51 VanDerWaalsContact O-CG 3.25Å; I48-P51 WeakPolarHBondContact O-CG 3.46Å; I48-I52 HydrophobicContact CG2-CD1 3.8Å; I48-I52 WeakPolarHBondContact O-CG1 3.15Å
49	P	94	Very high	95.1	Very high	61 Å²	61	105.4 Å²	105.4	40%	0.396	51%	0.512	S	S	.	.	H	α-helix	trans	-60.1	-27.5	176.5	-26.5	36.6	0	0	0	113.9	A46 L47 I52 F53	A46-P49 WeakPolarHBondContact O-CD 3.34Å; L47-P49 VanDerWaalsContact C-N 3.31Å; P49-I52 WeakPolarHBondContact O-CB 3.3Å; P49-I52 PolarHBondContact O-N 3Å; P49-F53 HydrophobicContact CB-CD2 4.08Å; P49-F53 HydrophobicContact CB-CE2 3.83Å; P49-F53 WeakPolarHBondContact O-CD2 3.23Å; P49-F53 PolarHBondContact O-N 3.43Å
50	V	94	Very high	95.2	Very high	95 Å²	95	102.2 Å²	102.2	58%	0.576	51%	0.506	S	S	*	.	H	α-helix	trans	-60.4	-56.5	-177	-179.3	0	0	0	0	112.6	L47 I48 I52 F53 Y54	L47-V50 WeakPolarHBondContact O-CB 3.25Å; L47-V50 WeakPolarHBondContact O-CG2 3.34Å; L47-V50 PolarHBondContact O-N 2.93Å; I48-V50 PolarHBondContact O-N 2.71Å; V50-I52 PolarHBondContact O-N 3.34Å; V50-F53 PolarHBondContact O-N 3.33Å; V50-Y54 WeakPolarHBondContact O-CB 3.37Å; V50-Y54 PolarHBondContact O-N 2.94Å
51	P	95.5	Very high	95.2	Very high	73 Å²	73	100.8 Å²	100.8	47%	0.474	50%	0.502	S	S	.	.	H	α-helix	trans	-64.1	-28.7	176.7	24.3	-35.1	0	0	0	113.1	L47 I48 S55	L47-P51 VanDerWaalsContact O-CD 3.3Å; L47-P51 WeakPolarHBondContact O-CD 3.26Å; I48-P51 WeakPolarHBondContact O-CD 3.43Å; I48-P51 VanDerWaalsContact O-CG 3.25Å; I48-P51 WeakPolarHBondContact O-CG 3.46Å; P51-S55 WeakPolarHBondContact O-CB 3.49Å; P51-S55 PolarHBondContact O-N 3.2Å; P51-S55 PolarHBondContact O-OG 3.05Å
52	I	95.6	Very high	95.2	Very high	101 Å²	101	100.1 Å²	100.1	52%	0.518	49%	0.494	S	S	.	.	H	α-helix	trans	-64.7	-51.5	175.8	-64.5	172.4	0	0	0	110.1	I48 P49 V50 Y54 S55 L56	I48-I52 HydrophobicContact CG2-CD1 3.8Å; I48-I52 WeakPolarHBondContact O-CG1 3.15Å; P49-I52 WeakPolarHBondContact O-CB 3.3Å; P49-I52 PolarHBondContact O-N 3Å; V50-I52 PolarHBondContact O-N 3.34Å; I52-Y54 VanDerWaalsContact C-N 3.31Å; I52-Y54 PolarHBondContact O-N 3.07Å; I52-S55 PolarHBondContact O-N 3.46Å; I52-L56 PolarHBondContact O-N 2.98Å
53	F	96.5	Very high	95.1	Very high	139 Å²	139	99 Å²	99	61%	0.61	49%	0.489	S	S	*	.	H	α-helix	trans	-64.2	-37.6	178.2	-74.2	-60.3	0	0	0	112.3	P49 V50 L56 R57	P49-F53 HydrophobicContact CB-CD2 4.08Å; P49-F53 HydrophobicContact CB-CE2 3.83Å; P49-F53 WeakPolarHBondContact O-CD2 3.23Å; P49-F53 PolarHBondContact O-N 3.43Å; V50-F53 PolarHBondContact O-N 3.33Å; F53-L56 PolarHBondContact O-N 3.28Å; F53-R57 WeakPolarHBondContact O-CB 3.47Å; F53-R57 PolarHBondContact O-N 3.3Å
54	Y	96.6	Very high	95.1	Very high	136 Å²	136	99.7 Å²	99.7	53%	0.533	49%	0.489	S	S	.	.	H	α-helix	trans	-59.7	-46.4	173.4	-178.9	-91.4	0	0	0	111.6	V50 I52 L56 R57 E58	V50-Y54 WeakPolarHBondContact O-CB 3.37Å; V50-Y54 PolarHBondContact O-N 2.94Å; I52-Y54 VanDerWaalsContact C-N 3.31Å; I52-Y54 PolarHBondContact O-N 3.07Å; Y54-L56 PolarHBondContact O-N 3.17Å; Y54-R57 WeakPolarHBondContact O-CB 3.03Å; Y54-R57 PolarHBondContact O-N 2.95Å; Y54-E58 PolarHBondContact O-N 3.47Å
55	S	96.7	Very high	95	Very high	68 Å²	68	97.8 Å²	97.8	48%	0.476	49%	0.486	S	S	.	.	H	α-helix	trans	-65.6	-39.6	179.4	-55.6	0	0	0	0	111.9	P51 I52 E58 Y59	P51-S55 WeakPolarHBondContact O-CB 3.49Å; P51-S55 PolarHBondContact O-N 3.2Å; P51-S55 PolarHBondContact O-OG 3.05Å; I52-S55 PolarHBondContact O-N 3.46Å; S55-E58 PolarHBondContact O-N 3.4Å; S55-Y59 WeakPolarHBondContact O-CB 3.44Å; S55-Y59 PolarHBondContact O-N 2.69Å
56	L	97	Very high	94.9	Very high	111 Å²	111	96.9 Å²	96.9	58%	0.581	49%	0.486	S	S	*	.	H	α-helix	trans	-62.7	-43.2	175.3	-175.9	66.8	0	0	0	111.6	I52 F53 Y54 Y59 G60	I52-L56 PolarHBondContact O-N 2.98Å; F53-L56 PolarHBondContact O-N 3.28Å; Y54-L56 PolarHBondContact O-N 3.17Å; L56-Y59 PolarHBondContact O-N 3.18Å; L56-G60 PolarHBondContact O-N 3.42Å
57	R	95.8	Very high	94.7	Very high	160 Å²	160	103.6 Å²	103.6	60%	0.604	50%	0.499	S	S	*	.	H	α-helix	trans	-59	-49.5	173.7	178.3	-165.2	174.4	-105.7	-1.9	110.7	F53 Y54 Y59 G60 M61	F53-R57 WeakPolarHBondContact O-CB 3.47Å; F53-R57 PolarHBondContact O-N 3.3Å; Y54-R57 WeakPolarHBondContact O-CB 3.03Å; Y54-R57 PolarHBondContact O-N 2.95Å; R57-Y59 VanDerWaalsContact C-N 3.3Å; R57-Y59 PolarHBondContact O-N 2.96Å; R57-G60 PolarHBondContact O-N 3.4Å; R57-M61 WeakPolarHBondContact O-CG 3.49Å; R57-M61 PolarHBondContact O-N 3.28Å
58	E	96.8	Very high	94.5	Very high	73 Å²	73	105.1 Å²	105.1	34%	0.341	51%	0.507	S	S	.	.	H	α-helix	trans	-61.4	-40.4	-179.2	-165.1	-173.3	148.8	0	0	111.8	Y54 S55 M61 K62	Y54-E58 PolarHBondContact O-N 3.47Å; S55-E58 PolarHBondContact O-N 3.4Å; E58-M61 PolarHBondContact O-N 2.9Å; E58-K62 HydrophobicContact CG-CD 4.41Å; E58-K62 WeakPolarHBondContact O-CB 3.39Å; E58-K62 WeakPolarHBondContact O-CG 3.47Å; E58-K62 PolarHBondContact O-N 3.21Å; E58-K62 WeakPolarHBondContact OE1-CE 3.44Å; E58-K62 IonicContact OE1-NZ 3.3Å; E58-K62 PolarHBondContact OE1-NZ 3.35Å
59	Y	96.6	Very high	94.2	Very high	140 Å²	140	109.5 Å²	109.5	55%	0.549	52%	0.519	S	S	.	.	H	α-helix	trans	-60.1	-47.2	172.9	177.3	-98.2	0	0	0	112	S55 L56 R57 M61 K62 Q63	S55-Y59 WeakPolarHBondContact O-CB 3.44Å; S55-Y59 PolarHBondContact O-N 2.69Å; L56-Y59 PolarHBondContact O-N 3.18Å; R57-Y59 VanDerWaalsContact C-N 3.3Å; R57-Y59 PolarHBondContact O-N 2.96Å; Y59-M61 PolarHBondContact O-N 3.32Å; Y59-K62 PolarHBondContact O-N 2.64Å; Y59-Q63 HydrophobicContact CD1-CG 4.23Å; Y59-Q63 HydrophobicContact CD2-CG 4.45Å; Y59-Q63 HydrophobicContact CE1-CG 3.8Å; Y59-Q63 HydrophobicContact CE2-CG 4.05Å; Y59-Q63 VanDerWaalsContact CE2-NE2 3.3Å; Y59-Q63 VanDerWaalsContact CZ-NE2 3.31Å; Y59-Q63 WeakPolarHBondContact O-CG 3.4Å; Y59-Q63 PolarHBondContact O-N 3Å; Y59-Q63 PolarHBondContact OH-NE2 3.4Å; Y59-Q63 VanDerWaalsContact OH-NE2 3.09Å
60	G	96.4	Very high	93.6	Very high	37 Å²	37	115 Å²	115	38%	0.381	54%	0.536	S	S	.	.	H	α-helix	trans	-57.5	-47.8	177	0	0	0	0	0	112.8	L56 R57 K62 Q63 E64	L56-G60 PolarHBondContact O-N 3.42Å; R57-G60 PolarHBondContact O-N 3.4Å; G60-K62 PolarHBondContact O-N 3.46Å; G60-Q63 PolarHBondContact O-N 3Å; G60-E64 PolarHBondContact O-N 3.36Å
61	M	95.8	Very high	93.1	Very high	96 Å²	96	115.4 Å²	115.4	47%	0.473	54%	0.535	S	S	.	.	H	α-helix	trans	-60.8	-43.4	177.1	-67	-63.8	-54.7	0	0	112.1	R57 E58 Y59 Q63 E64 E65	R57-M61 WeakPolarHBondContact O-CG 3.49Å; R57-M61 PolarHBondContact O-N 3.28Å; E58-M61 PolarHBondContact O-N 2.9Å; Y59-M61 PolarHBondContact O-N 3.32Å; M61-Q63 VanDerWaalsContact C-N 3.34Å; M61-Q63 PolarHBondContact O-N 2.92Å; M61-E64 PolarHBondContact O-N 2.96Å; M61-E65 WeakPolarHBondContact O-CB 3.47Å; M61-E65 PolarHBondContact O-N 3.24Å
62	K	95.5	Very high	92.5	Very high	105 Å²	105	116.9 Å²	116.9	46%	0.457	55%	0.545	S	S	.	.	H	α-helix	trans	-63.9	-37.3	177.3	-78.8	172.6	170.7	167.4	0	112.4	E58 Y59 G60 K66	E58-K62 HydrophobicContact CG-CD 4.41Å; E58-K62 WeakPolarHBondContact O-CB 3.39Å; E58-K62 WeakPolarHBondContact O-CG 3.47Å; E58-K62 PolarHBondContact O-N 3.21Å; E58-K62 WeakPolarHBondContact OE1-CE 3.44Å; E58-K62 IonicContact OE1-NZ 3.3Å; E58-K62 PolarHBondContact OE1-NZ 3.35Å; Y59-K62 PolarHBondContact O-N 2.64Å; G60-K62 PolarHBondContact O-N 3.46Å; K62-K66 WeakPolarHBondContact O-CB 3.46Å; K62-K66 VanDerWaalsContact O-CG 3.26Å; K62-K66 WeakPolarHBondContact O-CG 3.26Å; K62-K66 PolarHBondContact O-N 3.4Å; K62-K66 VanDerWaalsContact O-N 3.07Å
63	Q	93.4	Very high	91.9	Very high	75 Å²	75	115.4 Å²	115.4	35%	0.35	55%	0.548	S	S	.	.	H	α-helix	trans	-70.8	-40.2	176.9	-68.8	-64.4	-9.8	0	0	111.8	Y59 G60 M61 K66 R67	Y59-Q63 HydrophobicContact CD1-CG 4.23Å; Y59-Q63 HydrophobicContact CD2-CG 4.45Å; Y59-Q63 HydrophobicContact CE1-CG 3.8Å; Y59-Q63 HydrophobicContact CE2-CG 4.05Å; Y59-Q63 VanDerWaalsContact CE2-NE2 3.3Å; Y59-Q63 VanDerWaalsContact CZ-NE2 3.31Å; Y59-Q63 WeakPolarHBondContact O-CG 3.4Å; Y59-Q63 PolarHBondContact O-N 3Å; Y59-Q63 PolarHBondContact OH-NE2 3.4Å; Y59-Q63 VanDerWaalsContact OH-NE2 3.09Å; G60-Q63 PolarHBondContact O-N 3Å; M61-Q63 VanDerWaalsContact C-N 3.34Å; M61-Q63 PolarHBondContact O-N 2.92Å; Q63-K66 PolarHBondContact O-N 2.96Å; Q63-R67 WeakPolarHBondContact O-CB 3.34Å; Q63-R67 PolarHBondContact O-N 3.12Å
64	E	93.5	Very high	91.2	Very high	98 Å²	98	112.1 Å²	112.1	46%	0.458	55%	0.546	S	S	.	.	H	α-helix	trans	-60.8	-47.6	174.2	-177.9	173.3	-156.3	0	0	111.4	G60 M61 K66 R67 L68	G60-E64 PolarHBondContact O-N 3.36Å; M61-E64 PolarHBondContact O-N 2.96Å; E64-K66 VanDerWaalsContact C-N 3.34Å; E64-K66 PolarHBondContact O-N 2.95Å; E64-R67 PolarHBondContact O-N 3.36Å; E64-R67 VanDerWaalsContact O-N 3.12Å; E64-L68 HydrophobicContact CG-CD1 4.26Å; E64-L68 WeakPolarHBondContact O-CG 3.47Å; E64-L68 PolarHBondContact O-N 3.46Å
65	E	93.5	Very high	90.4	Very high	100 Å²	100	110.8 Å²	110.8	47%	0.467	54%	0.543	S	S	.	.	H	α-helix	trans	-60.2	-42.5	177	-168.4	-174.1	174.9	0	0	111.9	M61 R67 L68 R69	M61-E65 WeakPolarHBondContact O-CB 3.47Å; M61-E65 PolarHBondContact O-N 3.24Å; E65-R67 VanDerWaalsContact C-N 3.33Å; E65-R67 PolarHBondContact O-N 3.45Å; E65-L68 PolarHBondContact O-N 3.07Å; E65-R69 WeakPolarHBondContact O-CG 3.33Å; E65-R69 PolarHBondContact O-N 2.98Å; E65-R69 IonicContact OE1-CZ 2.69Å; E65-R69 IonicContact OE1-NE 3.62Å; E65-R69 IonicContact OE1-NH2 2.64Å; E65-R69 PolarHBondContact OE1-NH2 3.32Å
66	K	91.4	Very high	89.5	Confident	135 Å²	135	111 Å²	111	59%	0.587	55%	0.549	S	S	*	.	H	α-helix	trans	-61.5	-39.4	174.5	-77.2	175.7	-177.6	-177	0	112.4	K62 Q63 E64 R69	K62-K66 WeakPolarHBondContact O-CB 3.46Å; K62-K66 VanDerWaalsContact O-CG 3.26Å; K62-K66 WeakPolarHBondContact O-CG 3.26Å; K62-K66 PolarHBondContact O-N 3.4Å; K62-K66 VanDerWaalsContact O-N 3.07Å; Q63-K66 PolarHBondContact O-N 2.96Å; E64-K66 VanDerWaalsContact C-N 3.34Å; E64-K66 PolarHBondContact O-N 2.95Å; K66-R69 PolarHBondContact O-N 3.45Å
67	R	88	Confident	88.6	Confident	202 Å²	202	113 Å²	113	76%	0.762	56%	0.561	S	S	*	*	H	α-helix	trans	-69.2	-33.4	179.3	-166.3	-175.4	78.2	-179.7	2.1	112.5	Q63 E64 E65 R69	Q63-R67 WeakPolarHBondContact O-CB 3.34Å; Q63-R67 PolarHBondContact O-N 3.12Å; E64-R67 PolarHBondContact O-N 3.36Å; E64-R67 VanDerWaalsContact O-N 3.12Å; E65-R67 VanDerWaalsContact C-N 3.33Å; E65-R67 PolarHBondContact O-N 3.45Å; R67-R69 VanDerWaalsContact C-N 3.3Å
68	L	89.3	Confident	87.4	Confident	129 Å²	129	111.5 Å²	111.5	68%	0.675	57%	0.565	S	S	*	*	H	α-helix	trans	-72.9	-22.8	177.8	-69.9	171.9	0	0	0	112.8	E64 E65	E64-L68 HydrophobicContact CG-CD1 4.26Å; E64-L68 WeakPolarHBondContact O-CG 3.47Å; E64-L68 PolarHBondContact O-N 3.46Å; E65-L68 PolarHBondContact O-N 3.07Å
69	R	87.2	Confident	85.7	Confident	166 Å²	166	117.8 Å²	117.8	63%	0.626	61%	0.607	S	S	*	*	S	Bend	trans	-76.4	131.5	175.8	-68.3	178.1	-173.3	-169.7	3.9	110.2	E65 K66 R67 N71	E65-R69 WeakPolarHBondContact O-CG 3.33Å; E65-R69 PolarHBondContact O-N 2.98Å; E65-R69 IonicContact OE1-CZ 2.69Å; E65-R69 IonicContact OE1-NE 3.62Å; E65-R69 IonicContact OE1-NH2 2.64Å; E65-R69 PolarHBondContact OE1-NH2 3.32Å; K66-R69 PolarHBondContact O-N 3.45Å; R67-R69 VanDerWaalsContact C-N 3.3Å; R69-N71 PolarHBondContact O-N 3.09Å
70	K	81.5	Confident	85.2	Confident	176 Å²	176	116.7 Å²	116.7	77%	0.765	61%	0.61	S	S	*	*			trans	-60.5	133.5	174.4	-68.2	-174.5	-179.6	-175.6	0	110	P72 F75	K70-P72 WeakPolarHBondContact O-CD 3.42Å; K70-F75 HydrophobicContact CB-CE2 4.19Å; K70-F75 HydrophobicContact CD-CE2 4.36Å; K70-F75 HydrophobicContact CD-CZ 4.28Å
71	N	83.6	Confident	84.6	Confident	103 Å²	103	120.8 Å²	120.8	55%	0.551	62%	0.622	S	S	*	*			trans	-84.9	113.8	171.7	-177.7	2.7	0	0	0	109.2	R69 A73 A74 F75	R69-N71 PolarHBondContact O-N 3.09Å; N71-A73 PolarHBondContact O-N 3.4Å; N71-A73 WeakPolarHBondContact OD1-CB 3.48Å; N71-A73 PolarHBondContact OD1-N 3.13Å; N71-A73 VanDerWaalsContact OD1-N 3.1Å; N71-A74 WeakPolarHBondContact O-CB 3.32Å; N71-A74 PolarHBondContact O-N 3.03Å; N71-F75 WeakPolarHBondContact O-CD2 3.37Å
72	P	81.2	Confident	84	Confident	105 Å²	105	122.2 Å²	122.2	68%	0.682	63%	0.631	S	S	*	*	G	3₁₀ helix	trans	-60.2	-27.2	179.4	24.6	-33.6	0	0	0	112.8	K70 A74 F75	K70-P72 WeakPolarHBondContact O-CD 3.42Å; P72-A74 PolarHBondContact O-N 3.23Å; P72-F75 PolarHBondContact O-N 3.18Å; P72-F75 VanDerWaalsContact O-N 3.13Å
73	A	83.9	Confident	83.3	Confident	69 Å²	69	123.2 Å²	123.2	57%	0.57	64%	0.641	S	S	*	*	G	3₁₀ helix	trans	-65.2	-21.1	176.7	0	0	0	0	0	113.3	N71 F75	N71-A73 PolarHBondContact O-N 3.4Å; N71-A73 WeakPolarHBondContact OD1-CB 3.48Å; N71-A73 PolarHBondContact OD1-N 3.13Å; N71-A73 VanDerWaalsContact OD1-N 3.1Å; A73-F75 PolarHBondContact O-N 3.1Å
74	A	80.9	Confident	82.7	Confident	70 Å²	70	126.3 Å²	126.3	58%	0.579	66%	0.659	S	S	*	*	G	3₁₀ helix	trans	-71.3	-18.5	176.1	0	0	0	0	0	113	N71 P72	N71-A74 WeakPolarHBondContact O-CB 3.32Å; N71-A74 PolarHBondContact O-N 3.03Å; P72-A74 PolarHBondContact O-N 3.23Å
75	F	80.6	Confident	82	Confident	108 Å²	108	128.1 Å²	128.1	47%	0.474	67%	0.672	S	S	.	*	G	3₁₀ helix	trans	-107.8	3.8	-178.7	-51.9	-77.9	0	0	0	112.6	K70 N71 P72 A73 N77 D78	K70-F75 HydrophobicContact CB-CE2 4.19Å; K70-F75 HydrophobicContact CD-CE2 4.36Å; K70-F75 HydrophobicContact CD-CZ 4.28Å; N71-F75 WeakPolarHBondContact O-CD2 3.37Å; P72-F75 PolarHBondContact O-N 3.18Å; P72-F75 VanDerWaalsContact O-N 3.13Å; A73-F75 PolarHBondContact O-N 3.1Å; F75-N77 PolarHBondContact O-N 3.06Å; F75-D78 PolarHBondContact O-N 3.37Å
76	A	77.7	Confident	81.1	Confident	73 Å²	73	130.1 Å²	130.1	60%	0.603	69%	0.687	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.1	-25.2	-174.4	0	0	0	0	0	113.4
77	N	78.5	Confident	80.4	Confident	154 Å²	154	129.8 Å²	129.8	82%	0.824	70%	0.695	S	S	*	*	T	Hydrogen-bonded Turn	trans	-114.1	15.2	-179.3	-61.8	-25.2	0	0	0	112.5	F75 V79	F75-N77 PolarHBondContact O-N 3.06Å; N77-V79 PolarHBondContact O-N 3.3Å
78	D	70.6	Confident	79.7	Confident	128 Å²	128	123.8 Å²	123.8	68%	0.684	69%	0.689	S	S	*	*			trans	-80.2	76.4	170.8	-106.3	-9.8	0	0	0	108.3	F75	F75-D78 PolarHBondContact O-N 3.37Å
79	V	61.6	Low	78.8	Confident	204 Å²	204	123.3 Å²	123.3	100%	1.236	69%	0.69	S	S	*	*			trans	-139.4	0	170.2	-179.8	0	0	0	0	109.2	N77	N77-V79 PolarHBondContact O-N 3.3Å

Retrieved 79 of 79 residues in 107.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).