A0A077Z981_TRITR Loading...

Zf-C3HC4 domain containing protein

AlphaFold DB , UniProt , Accession A0A077Z981, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 143 aa.

						>A0A077Z981_TRITR|A0A077Z981
MTLKHPVGRSVAEMSLECSICCDTFPKLKTLTCQHAFCPACLEQIEFNRKIKCPLCRQETTLNAFGVKDLVSRFGGSLECTDCNLVVDMTSGLWCQTCSSILCESCSGRQIFLCASKYLFSVALQNIRITYYSHFRLARYGGA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	35.2	Very low	38.2	Very low	235 Å²	235	149.3 Å²	149.3	100%	1.158	81%	0.809	S	S	*	*				0	126.7	0	38	-85.3	-176.3	0	0	109.1
2	T	37.4	Very low	39.7	Very low	130 Å²	130	141.4 Å²	141.4	80%	0.798	78%	0.779	S	S	*	*			trans	-66	139.4	-179.3	29.1	0	0	0	0	111.8	K4	T2-K4 PolarHBondContact O-N 2.97Å
3	L	35.4	Very low	41.8	Very low	154 Å²	154	139.8 Å²	139.8	81%	0.806	76%	0.763	S	S	*	*			trans	-62.4	104.3	174.7	-69.1	171.6	0	0	0	109.3	H5	L3-H5 PolarHBondContact O-N 3.11Å; L3-H5 VanDerWaalsContact O-N 3.12Å
4	K	30.7	Very low	44.8	Very low	197 Å²	197	138.1 Å²	138.1	86%	0.857	75%	0.749	S	S	*	*			trans	-74.9	95.4	170.1	-66.2	-176.4	179.6	-175.6	0	107.9	T2	T2-K4 PolarHBondContact O-N 2.97Å
5	H	37	Very low	47.8	Very low	145 Å²	145	131.1 Å²	131.1	67%	0.671	72%	0.715	S	S	*	*			trans	-72.1	129.4	159.9	-68.5	84.7	0	0	0	107.7	L3 V7	L3-H5 PolarHBondContact O-N 3.11Å; L3-H5 VanDerWaalsContact O-N 3.12Å; H5-V7 VanDerWaalsContact C-N 3.27Å; H5-V7 PolarHBondContact O-N 3.39Å
6	P	36.8	Very low	50.6	Low	129 Å²	129	124.3 Å²	124.3	84%	0.838	68%	0.677	S	S	*	*			trans	-72.2	84.8	172.4	29.7	-31.8	0	0	0	108.9	G8	P6-G8 PolarHBondContact O-N 2.91Å
7	V	39.7	Very low	53.2	Low	119 Å²	119	124.4 Å²	124.4	72%	0.721	67%	0.672	S	S	*	*			trans	-81.5	92.6	165.4	-178.3	0	0	0	0	107	H5 R9	H5-V7 VanDerWaalsContact C-N 3.27Å; H5-V7 PolarHBondContact O-N 3.39Å; V7-R9 PolarHBondContact O-N 3.32Å
8	G	35.7	Very low	55.6	Low	66 Å²	66	117.5 Å²	117.5	68%	0.68	64%	0.635	S	S	*	*			trans	-58.6	103.5	158.3	0	0	0	0	0	108.7	P6	P6-G8 PolarHBondContact O-N 2.91Å
9	R	39.1	Very low	57.6	Low	242 Å²	242	114.6 Å²	114.6	91%	0.913	63%	0.625	S	S	*	*	S	Bend	trans	32.2	124.4	142.8	-150.1	171.4	-166.1	157.7	1.7	117.5	V7	V7-R9 PolarHBondContact O-N 3.32Å
10	S	44.8	Very low	59.6	Low	99 Å²	99	112.2 Å²	112.2	69%	0.692	61%	0.61	S	S	*	*	S	Bend	trans	88.4	111.2	-169.8	-169.4	0	0	0	0	110.2	A12	S10-A12 PolarHBondContact O-N 3.1Å
11	V	48.7	Very low	61.4	Low	126 Å²	126	109 Å²	109	76%	0.764	60%	0.596	S	S	*	*			trans	-46.2	113.1	161.6	174.7	0	0	0	0	105.1	E13	V11-E13 PolarHBondContact O-N 3.24Å
12	A	56.2	Low	64.2	Low	55 Å²	55	101.9 Å²	101.9	46%	0.455	57%	0.568	S	S	.	*			trans	-56.3	103.7	169.6	0	0	0	0	0	103.9	S10 M14	S10-A12 PolarHBondContact O-N 3.1Å; A12-M14 PolarHBondContact O-N 3.35Å
13	E	66.6	Low	67	Low	121 Å²	121	100.1 Å²	100.1	57%	0.565	55%	0.554	S	S	*	*			trans	-64.7	108.7	-168.6	-173.3	147.3	-162.1	0	0	105.3	V11 S15 G76	V11-E13 PolarHBondContact O-N 3.24Å; E13-S15 WeakPolarHBondContact CG-OG 3.32Å; E13-S15 PolarHBondContact O-N 2.63Å; E13-S15 PolarHBondContact OE1-OG 2.79Å; E13-G76 PolarHBondContact O-N 3.02Å
14	M	84.4	Confident	69.7	Low	115 Å²	115	96.6 Å²	96.6	57%	0.567	54%	0.539	S	S	*	.	S	Bend	trans	-71	23.3	-179.6	-64.1	-65.8	-66.1	0	0	110.9	A12 P26 M89	A12-M14 PolarHBondContact O-N 3.35Å; M14-P26 WeakPolarHBondContact O-CA 3.33Å; M14-M89 HydrophobicContact CE-CE 3.41Å; M14-M89 VanDerWaalsContact CE-CE 3.41Å; M14-M89 HydrophobicContact CE-SD 4.38Å; M14-M89 HydrophobicContact SD-CE 4.12Å
15	S	89.8	Confident	72.8	Confident	34 Å²	34	89.9 Å²	89.9	24%	0.238	51%	0.51	C	S	.	.			trans	-133.3	159.1	-175.9	29.3	0	0	0	0	110.3	E13 F25	E13-S15 WeakPolarHBondContact CG-OG 3.32Å; E13-S15 PolarHBondContact O-N 2.63Å; E13-S15 PolarHBondContact OE1-OG 2.79Å; S15-F25 CarbonylContact C-O 3.57Å; S15-F25 WeakPolarHBondContact CA-O 3.3Å; S15-F25 WeakPolarHBondContact CB-O 3.33Å
16	L	92	Very high	75.4	Confident	22 Å²	22	87.3 Å²	87.3	12%	0.115	51%	0.506	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.3	142	176.9	-63	167.3	0	0	0	107.4	T24 F25 L28 R73 G75	L16-T24 CarbonylContact O-C 3.45Å; L16-T24 WeakPolarHBondContact O-CA 3.35Å; L16-F25 PolarHBondContact N-O 2.9Å; L16-F25 PolarHBondContact O-N 3.37Å; L16-L28 HydrophobicContact CB-CD1 3.53Å; L16-L28 HydrophobicContact CB-CG 3.74Å; L16-L28 HydrophobicContact CD1-CB 4.21Å; L16-L28 HydrophobicContact CD1-CD1 4.19Å; L16-L28 HydrophobicContact CD1-CG 3.98Å; L16-L28 HydrophobicContact CG-CD1 4.49Å; L16-R73 HydrophobicContact CD1-CB 4.03Å; L16-R73 HydrophobicContact CD1-CG 3.81Å; L16-R73 WeakPolarHBondContact CD1-O 3.33Å; L16-G75 VanDerWaalsContact CG-CA 3.48Å
17	E	94.3	Very high	78	Confident	126 Å²	126	86 Å²	86	59%	0.589	49%	0.487	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-84.6	134.6	174	-170.5	-177.4	87.7	0	0	110.7	D23 L28	E17-D23 WeakPolarHBondContact CA-O 3.41Å; E17-L28 WeakPolarHBondContact O-CD1 3.47Å
18	C	96.4	Very high	80.6	Confident	0 Å²	0	80.6 Å²	80.6	0%	0	45%	0.454	C	S	.	.			trans	-84.4	121.6	169.7	-178.9	0	0	0	0	110.2	I20 C22 D23 F25 L28 C38	C18-I20 PolarHBondContact O-N 2.74Å; C18-C22 WeakPolarHBondContact O-CA 3.45Å; C18-C22 PolarHBondContact O-N 3.29Å; C18-D23 PolarHBondContact N-O 3.4Å; C18-F25 HydrophobicContact CB-CD2 4.22Å; C18-F25 HydrophobicContact CB-CE2 4.03Å; C18-L28 HydrophobicContact CB-CD2 4.24Å; C18-C38 HydrophobicContact CB-CB 4Å; C18-C38 PolarHBondContact SG-N 2.81Å
19	S	94.8	Very high	83.5	Confident	63 Å²	63	78.5 Å²	78.5	44%	0.441	43%	0.426	S	S	.	.	T	Hydrogen-bonded Turn	trans	-71.6	1.5	-179.8	56.8	0	0	0	0	115.8	F37	S19-F37 VanDerWaalsContact OG-CE1 3.26Å; S19-F37 WeakPolarHBondContact OG-CE1 3.5Å
20	I	96.8	Very high	86.2	Confident	66 Å²	66	68.3 Å²	68.3	34%	0.338	39%	0.391	S	S	.	.	T	Hydrogen-bonded Turn	trans	-96	-52.4	175.4	-61.8	166.3	0	0	0	110.7	C18 F37 C41 I45 P54	C18-I20 PolarHBondContact O-N 2.74Å; I20-F37 HydrophobicContact CD1-CB 4.14Å; I20-F37 HydrophobicContact CD1-CD1 3.42Å; I20-F37 VanDerWaalsContact CD1-CD1 3.42Å; I20-F37 HydrophobicContact CD1-CE1 3.98Å; I20-F37 HydrophobicContact CD1-CG 3.89Å; I20-F37 HydrophobicContact CG1-CD1 3.65Å; I20-F37 HydrophobicContact CG1-CE1 3.98Å; I20-C41 HydrophobicContact CB-CB 4.12Å; I20-C41 HydrophobicContact CD1-CB 3.72Å; I20-C41 HydrophobicContact CG2-CB 4.07Å; I20-I45 HydrophobicContact CD1-CD1 4.48Å; I20-P54 HydrophobicContact CD1-CG 4.01Å; I20-P54 HydrophobicContact CG1-CG 4.43Å
21	C	97.2	Very high	88.7	Confident	45 Å²	45	63.9 Å²	63.9	30%	0.304	36%	0.36	S	S	.	.	T	Hydrogen-bonded Turn	trans	-100.8	-8.9	-178.3	67.3	0	0	0	0	114.2	D23	C21-D23 PolarHBondContact O-N 3.09Å; C21-D23 PolarHBondContact SG-OD2 3.44Å; C21-D23 VanDerWaalsContact SG-OD2 3.41Å
22	C	94.9	Very high	90.9	Very high	86 Å²	86	62.8 Å²	62.8	58%	0.581	35%	0.353	S	S	*	.			trans	61.2	16.5	-175.9	-52.8	0	0	0	0	114.8	C18	C18-C22 WeakPolarHBondContact O-CA 3.45Å; C18-C22 PolarHBondContact O-N 3.29Å
23	D	95.6	Very high	92.8	Very high	93 Å²	93	60.9 Å²	60.9	50%	0.497	34%	0.337	S	S	.	.			trans	-88.1	157.5	173	-64.5	-47.7	0	0	0	111.9	E17 C18 C21 F25	E17-D23 WeakPolarHBondContact CA-O 3.41Å; C18-D23 PolarHBondContact N-O 3.4Å; C21-D23 PolarHBondContact O-N 3.09Å; C21-D23 PolarHBondContact SG-OD2 3.44Å; C21-D23 VanDerWaalsContact SG-OD2 3.41Å; D23-F25 HydrophobicContact CB-CD2 4.47Å; D23-F25 HydrophobicContact CB-CE2 3.6Å; D23-F25 HydrophobicContact CB-CZ 3.9Å; D23-F25 WeakPolarHBondContact O-CD2 3.42Å
24	T	93.5	Very high	94.1	Very high	79 Å²	79	63 Å²	63	49%	0.485	35%	0.346	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.4	136.7	178.8	57.2	0	0	0	0	112.4	L16	L16-T24 CarbonylContact O-C 3.45Å; L16-T24 WeakPolarHBondContact O-CA 3.35Å
25	F	94.1	Very high	94.6	Very high	56 Å²	56	60.6 Å²	60.6	25%	0.246	33%	0.334	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.7	145.6	-178.2	-61.8	-90.3	0	0	0	111.3	S15 L16 C18 D23 K27 L28 C38	S15-F25 CarbonylContact C-O 3.57Å; S15-F25 WeakPolarHBondContact CA-O 3.3Å; S15-F25 WeakPolarHBondContact CB-O 3.33Å; L16-F25 PolarHBondContact N-O 2.9Å; L16-F25 PolarHBondContact O-N 3.37Å; C18-F25 HydrophobicContact CB-CD2 4.22Å; C18-F25 HydrophobicContact CB-CE2 4.03Å; D23-F25 HydrophobicContact CB-CD2 4.47Å; D23-F25 HydrophobicContact CB-CE2 3.6Å; D23-F25 HydrophobicContact CB-CZ 3.9Å; D23-F25 WeakPolarHBondContact O-CD2 3.42Å; F25-K27 PolarHBondContact O-N 3.23Å; F25-L28 HydrophobicContact CB-CD2 3.79Å; F25-L28 HydrophobicContact CD2-CD2 3.76Å; F25-L28 HydrophobicContact CG-CD2 4.04Å; F25-C38 HydrophobicContact CD1-CB 4.26Å; F25-C38 HydrophobicContact CD2-CB 3.57Å; F25-C38 HydrophobicContact CE1-CB 4.06Å; F25-C38 HydrophobicContact CE2-CB 3.3Å; F25-C38 HydrophobicContact CG-CB 4.04Å; F25-C38 HydrophobicContact CZ-CB 3.58Å
26	P	91.3	Very high	94.9	Very high	92 Å²	92	59.9 Å²	59.9	60%	0.597	33%	0.329	S	S	*	.	S	Bend	trans	-64.3	-23.9	177.1	26.7	-35.2	0	0	0	113.1	M14 G75	M14-P26 WeakPolarHBondContact O-CA 3.33Å; P26-G75 PolarHBondContact O-N 3.46Å
27	K	91.9	Very high	95.2	Very high	101 Å²	101	58.8 Å²	58.8	44%	0.439	32%	0.324	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-148.8	144.4	175.8	65.2	-174.7	179.8	-176.4	0	111.3	F25 R73 F74	F25-K27 PolarHBondContact O-N 3.23Å; K27-R73 CarbonylContact C-O 3.46Å; K27-R73 WeakPolarHBondContact CA-O 3.06Å; K27-F74 HydrophobicContact CB-CD1 3.78Å; K27-F74 HydrophobicContact CB-CE1 4.01Å; K27-F74 HydrophobicContact CB-CG 4.49Å; K27-F74 HydrophobicContact CD-CD1 4.46Å; K27-F74 HydrophobicContact CD-CE1 3.86Å
28	L	95.3	Very high	95.3	Very high	5 Å²	5	52.9 Å²	52.9	3%	0.026	30%	0.297	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.8	158.5	171.4	-59.8	-178.9	0	0	0	109.6	L16 E17 C18 F25 A36 F37 C38 S72 R73	L16-L28 HydrophobicContact CB-CD1 3.53Å; L16-L28 HydrophobicContact CB-CG 3.74Å; L16-L28 HydrophobicContact CD1-CB 4.21Å; L16-L28 HydrophobicContact CD1-CD1 4.19Å; L16-L28 HydrophobicContact CD1-CG 3.98Å; L16-L28 HydrophobicContact CG-CD1 4.49Å; E17-L28 WeakPolarHBondContact O-CD1 3.47Å; C18-L28 HydrophobicContact CB-CD2 4.24Å; F25-L28 HydrophobicContact CB-CD2 3.79Å; F25-L28 HydrophobicContact CD2-CD2 3.76Å; F25-L28 HydrophobicContact CG-CD2 4.04Å; L28-A36 HydrophobicContact CB-CB 3.82Å; L28-A36 HydrophobicContact CD1-CB 4.43Å; L28-F37 CarbonylContact C-O 3.6Å; L28-F37 WeakPolarHBondContact CA-O 3.3Å; L28-F37 WeakPolarHBondContact CB-O 3.43Å; L28-C38 HydrophobicContact CD2-CB 3.84Å; L28-S72 CarbonylContact O-C 3.52Å; L28-S72 VanDerWaalsContact O-CA 3.3Å; L28-S72 WeakPolarHBondContact O-CA 3.39Å; L28-R73 PolarHBondContact N-O 3Å; L28-R73 PolarHBondContact O-N 3.48Å
29	K	96.8	Very high	95.3	Very high	22 Å²	22	55 Å²	55	10%	0.096	31%	0.31	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.8	128.9	176.1	-70.3	-54.2	-158.7	172.4	0	110.1	A36 F37 P39 L42 V67 K68 L70 S72	K29-A36 WeakPolarHBondContact O-CA 3.37Å; K29-F37 PolarHBondContact N-O 2.92Å; K29-F37 PolarHBondContact O-N 3.42Å; K29-P39 HydrophobicContact CG-CG 4.17Å; K29-L42 HydrophobicContact CB-CD1 3.5Å; K29-L42 HydrophobicContact CG-CD1 4.48Å; K29-V67 WeakPolarHBondContact CE-O 3.5Å; K29-V67 HydrophobicContact CG-CG1 4.09Å; K29-K68 WeakPolarHBondContact CE-O 3.37Å; K29-K68 PolarHBondContact NZ-O 3.32Å; K29-L70 HydrophobicContact CB-CB 4.05Å; K29-L70 HydrophobicContact CB-CD1 4.17Å; K29-L70 HydrophobicContact CD-CB 4.05Å; K29-L70 WeakPolarHBondContact CD-O 3.42Å; K29-L70 HydrophobicContact CG-CB 4.37Å; K29-L70 PolarHBondContact NZ-O 3.3Å; K29-S72 PolarHBondContact NZ-OG 3.09Å; K29-S72 VanDerWaalsContact NZ-OG 3.09Å
30	T	95.8	Very high	95.5	Very high	29 Å²	29	54.6 Å²	54.6	18%	0.178	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.9	127	-174.8	-52.5	0	0	0	0	110.3	H35 V71 R73	T30-H35 WeakPolarHBondContact CA-O 3.43Å; T30-V71 WeakPolarHBondContact CB-O 3.15Å; T30-V71 PolarHBondContact N-O 2.9Å; T30-V71 PolarHBondContact OG1-O 3.06Å; T30-R73 WeakPolarHBondContact OG1-CB 3.37Å
31	L	96.5	Very high	95.5	Very high	6 Å²	6	51.8 Å²	51.8	3%	0.031	30%	0.297	C	S	.	.	P	Polyproline II helix	trans	-77.6	168.3	173	-62.8	-174.2	0	0	0	111.3	C33 Q34 H35 F37 L42 I51 C53 T60 L70	L31-C33 PolarHBondContact O-N 2.72Å; L31-C33 VanDerWaalsContact O-N 3.12Å; L31-Q34 PolarHBondContact O-N 3.16Å; L31-H35 PolarHBondContact N-O 2.78Å; L31-F37 HydrophobicContact CD1-CD2 4.18Å; L31-F37 HydrophobicContact CD1-CE2 3.84Å; L31-F37 HydrophobicContact CG-CD2 4.4Å; L31-F37 HydrophobicContact CG-CE2 4.41Å; L31-L42 HydrophobicContact CD2-CD1 4.21Å; L31-L42 HydrophobicContact CD2-CD2 4.24Å; L31-I51 HydrophobicContact CD1-CG2 3.97Å; L31-I51 HydrophobicContact CD2-CB 4.37Å; L31-I51 HydrophobicContact CD2-CD1 4.43Å; L31-I51 HydrophobicContact CD2-CG2 3.96Å; L31-C53 HydrophobicContact CD1-CB 3.79Å; L31-T60 WeakPolarHBondContact CB-OG1 3.45Å; L31-T60 HydrophobicContact CD2-CG2 4.24Å; L31-L70 HydrophobicContact CD2-CD1 3.97Å
32	T	94.8	Very high	95.6	Very high	102 Å²	102	49.7 Å²	49.7	63%	0.626	28%	0.282	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.3	-24.4	176.1	49.3	0	0	0	0	112.9	Q34 T60	T32-Q34 PolarHBondContact O-N 3.22Å; T32-T60 HydrophobicContact CG2-CG2 3.9Å; T32-T60 PolarHBondContact N-OG1 3.32Å; T32-T60 VanDerWaalsContact N-OG1 3.12Å; T32-T60 PolarHBondContact OG1-OG1 3.15Å
33	C	96.1	Very high	95.6	Very high	16 Å²	16	50.3 Å²	50.3	11%	0.108	28%	0.277	C	S	.	.	T	Hydrogen-bonded Turn	trans	-80.4	6.7	173.8	68	0	0	0	0	114.8	L31 H35 C56 Q58	L31-C33 PolarHBondContact O-N 2.72Å; L31-C33 VanDerWaalsContact O-N 3.12Å; C33-H35 PolarHBondContact O-N 3.26Å; C33-H35 VanDerWaalsContact O-N 3.15Å; C33-H35 PolarHBondContact SG-ND1 2.96Å; C33-C56 VanDerWaalsContact CB-SG 3.53Å; C33-C56 VanDerWaalsContact SG-SG 3.61Å; C33-Q58 HydrophobicContact CB-CB 3.92Å; C33-Q58 HydrophobicContact CB-CG 4.43Å
34	Q	93.4	Very high	95.7	Very high	165 Å²	165	53.2 Å²	53.2	77%	0.771	29%	0.287	S	S	*	.	S	Bend	trans	67.8	0	-179.2	-53.5	179	-4.6	0	0	116.6	L31 T32	L31-Q34 PolarHBondContact O-N 3.16Å; T32-Q34 PolarHBondContact O-N 3.22Å
35	H	96.4	Very high	95.8	Very high	65 Å²	65	52.5 Å²	52.5	30%	0.301	28%	0.28	S	S	.	.			trans	-76	145.5	167.7	-61.7	106.1	0	0	0	111.1	T30 L31 C33 F37 L55	T30-H35 WeakPolarHBondContact CA-O 3.43Å; L31-H35 PolarHBondContact N-O 2.78Å; C33-H35 PolarHBondContact O-N 3.26Å; C33-H35 VanDerWaalsContact O-N 3.15Å; C33-H35 PolarHBondContact SG-ND1 2.96Å; H35-F37 HydrophobicContact CB-CE2 3.8Å; H35-F37 HydrophobicContact CB-CZ 4.05Å; H35-L55 HydrophobicContact CB-CD1 4.14Å; H35-L55 VanDerWaalsContact CD2-CD1 3.43Å; H35-L55 WeakPolarHBondContact CD2-CD1 3.26Å
36	A	95.4	Very high	95.9	Very high	18 Å²	18	52.9 Å²	52.9	15%	0.149	28%	0.283	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127	141.1	-175.6	0	0	0	0	0	112.8	L28 K29 R73	L28-A36 HydrophobicContact CB-CB 3.82Å; L28-A36 HydrophobicContact CD1-CB 4.43Å; K29-A36 WeakPolarHBondContact O-CA 3.37Å; A36-R73 HydrophobicContact CB-CB 4.24Å
37	F	97.9	Very high	96.1	Very high	0 Å²	0	56.6 Å²	56.6	0%	0	29%	0.29	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.7	164.7	-177.4	-51.7	-87.6	0	0	0	110.8	S19 I20 L28 K29 L31 H35 L42 P54 L55	S19-F37 VanDerWaalsContact OG-CE1 3.26Å; S19-F37 WeakPolarHBondContact OG-CE1 3.5Å; I20-F37 HydrophobicContact CD1-CB 4.14Å; I20-F37 HydrophobicContact CD1-CD1 3.42Å; I20-F37 VanDerWaalsContact CD1-CD1 3.42Å; I20-F37 HydrophobicContact CD1-CE1 3.98Å; I20-F37 HydrophobicContact CD1-CG 3.89Å; I20-F37 HydrophobicContact CG1-CD1 3.65Å; I20-F37 HydrophobicContact CG1-CE1 3.98Å; L28-F37 CarbonylContact C-O 3.6Å; L28-F37 WeakPolarHBondContact CA-O 3.3Å; L28-F37 WeakPolarHBondContact CB-O 3.43Å; K29-F37 PolarHBondContact N-O 2.92Å; K29-F37 PolarHBondContact O-N 3.42Å; L31-F37 HydrophobicContact CD1-CD2 4.18Å; L31-F37 HydrophobicContact CD1-CE2 3.84Å; L31-F37 HydrophobicContact CG-CD2 4.4Å; L31-F37 HydrophobicContact CG-CE2 4.41Å; H35-F37 HydrophobicContact CB-CE2 3.8Å; H35-F37 HydrophobicContact CB-CZ 4.05Å; F37-L42 HydrophobicContact CB-CD2 3.75Å; F37-L42 HydrophobicContact CB-CG 3.91Å; F37-L42 HydrophobicContact CD2-CD2 3.78Å; F37-L42 HydrophobicContact CG-CD2 4.07Å; F37-P54 HydrophobicContact CE1-CG 4.43Å; F37-P54 HydrophobicContact CZ-CG 4.33Å; F37-L55 HydrophobicContact CE1-CD1 4.09Å; F37-L55 HydrophobicContact CE1-CG 4.23Å; F37-L55 HydrophobicContact CZ-CD1 3.77Å; F37-L55 HydrophobicContact CZ-CG 3.9Å
38	C	97.2	Very high	96.2	Very high	2 Å²	2	58 Å²	58	1%	0.014	30%	0.302	C	S	.	.			trans	-71.1	152.3	-179.7	76.3	0	0	0	0	110.4	C18 F25 L28 A40 C41 L42	C18-C38 HydrophobicContact CB-CB 4Å; C18-C38 PolarHBondContact SG-N 2.81Å; F25-C38 HydrophobicContact CD1-CB 4.26Å; F25-C38 HydrophobicContact CD2-CB 3.57Å; F25-C38 HydrophobicContact CE1-CB 4.06Å; F25-C38 HydrophobicContact CE2-CB 3.3Å; F25-C38 HydrophobicContact CG-CB 4.04Å; F25-C38 HydrophobicContact CZ-CB 3.58Å; L28-C38 HydrophobicContact CD2-CB 3.84Å; C38-A40 VanDerWaalsContact C-N 3.28Å; C38-A40 PolarHBondContact O-N 3.39Å; C38-C41 PolarHBondContact O-N 3.32Å; C38-C41 VanDerWaalsContact SG-CB 3.58Å; C38-C41 PolarHBondContact SG-N 2.8Å; C38-C41 VanDerWaalsContact SG-N 3.39Å; C38-C41 PolarHBondContact SG-SG 2.8Å; C38-L42 PolarHBondContact O-N 2.8Å; C38-L42 VanDerWaalsContact O-N 3.13Å
39	P	96.6	Very high	96.2	Very high	44 Å²	44	65.1 Å²	65.1	29%	0.286	33%	0.329	S	S	.	.	H	α-helix	trans	-55.6	-42.5	-178.8	-24.7	32.6	0	0	0	113.1	K29 C41 L42 E43 V67	K29-P39 HydrophobicContact CG-CG 4.17Å; P39-C41 PolarHBondContact O-N 3.35Å; P39-L42 PolarHBondContact O-N 3.13Å; P39-E43 WeakPolarHBondContact O-CG 3.2Å; P39-E43 PolarHBondContact O-N 2.85Å; P39-V67 HydrophobicContact CB-CG1 4.33Å
40	A	97.3	Very high	96.1	Very high	55 Å²	55	68 Å²	68	46%	0.455	34%	0.341	S	S	.	.	H	α-helix	trans	-61.9	-45.7	-178.4	0	0	0	0	0	112.4	C38 L42 E43 Q44	C38-A40 VanDerWaalsContact C-N 3.28Å; C38-A40 PolarHBondContact O-N 3.39Å; A40-L42 VanDerWaalsContact C-N 3.33Å; A40-L42 PolarHBondContact O-N 3.39Å; A40-E43 PolarHBondContact O-N 2.9Å; A40-Q44 WeakPolarHBondContact O-CG 3.38Å; A40-Q44 PolarHBondContact O-N 3.3Å; A40-Q44 VanDerWaalsContact O-N 3.09Å
41	C	98.3	Very high	96.2	Very high	7 Å²	7	66.7 Å²	66.7	5%	0.047	33%	0.333	C	S	.	.	H	α-helix	trans	-66.8	-35.1	177.3	-70.9	0	0	0	0	112.3	I20 C38 P39 Q44 I45	I20-C41 HydrophobicContact CB-CB 4.12Å; I20-C41 HydrophobicContact CD1-CB 3.72Å; I20-C41 HydrophobicContact CG2-CB 4.07Å; C38-C41 PolarHBondContact O-N 3.32Å; C38-C41 VanDerWaalsContact SG-CB 3.58Å; C38-C41 PolarHBondContact SG-N 2.8Å; C38-C41 VanDerWaalsContact SG-N 3.39Å; C38-C41 PolarHBondContact SG-SG 2.8Å; P39-C41 PolarHBondContact O-N 3.35Å; C41-Q44 PolarHBondContact O-N 2.78Å; C41-I45 WeakPolarHBondContact O-CG1 3.44Å; C41-I45 PolarHBondContact O-N 2.91Å
42	L	97.8	Very high	96.3	Very high	0 Å²	0	73.1 Å²	73.1	0%	0	36%	0.361	C	S	.	.	H	α-helix	trans	-67.5	-41.5	175.1	-71.6	-170.3	0	0	0	112.3	K29 L31 F37 C38 P39 A40 Q44 I45 E46 I51 V67 L70	K29-L42 HydrophobicContact CB-CD1 3.5Å; K29-L42 HydrophobicContact CG-CD1 4.48Å; L31-L42 HydrophobicContact CD2-CD1 4.21Å; L31-L42 HydrophobicContact CD2-CD2 4.24Å; F37-L42 HydrophobicContact CB-CD2 3.75Å; F37-L42 HydrophobicContact CB-CG 3.91Å; F37-L42 HydrophobicContact CD2-CD2 3.78Å; F37-L42 HydrophobicContact CG-CD2 4.07Å; C38-L42 PolarHBondContact O-N 2.8Å; C38-L42 VanDerWaalsContact O-N 3.13Å; P39-L42 PolarHBondContact O-N 3.13Å; A40-L42 VanDerWaalsContact C-N 3.33Å; A40-L42 PolarHBondContact O-N 3.39Å; L42-Q44 VanDerWaalsContact C-N 3.26Å; L42-Q44 PolarHBondContact O-N 3.12Å; L42-I45 HydrophobicContact CD2-CD1 4.09Å; L42-I45 WeakPolarHBondContact O-CG1 3.48Å; L42-I45 PolarHBondContact O-N 3.12Å; L42-E46 WeakPolarHBondContact O-CB 3.49Å; L42-E46 PolarHBondContact O-N 3.48Å; L42-I51 HydrophobicContact CB-CD1 4Å; L42-I51 HydrophobicContact CD2-CD1 4.26Å; L42-I51 HydrophobicContact CD2-CG2 4.19Å; L42-I51 HydrophobicContact CG-CD1 4.5Å; L42-V67 HydrophobicContact CB-CB 4.47Å; L42-V67 HydrophobicContact CB-CG1 3.72Å; L42-V67 HydrophobicContact CB-CG2 3.81Å; L42-V67 HydrophobicContact CD1-CG1 4.02Å; L42-L70 HydrophobicContact CD1-CD1 3.76Å
43	E	96.6	Very high	96.4	Very high	99 Å²	99	68.3 Å²	68.3	46%	0.463	33%	0.331	S	S	.	.	H	α-helix	trans	-62.9	-33.3	176.2	-73.6	173	179.2	0	0	111.6	P39 A40 V67	P39-E43 WeakPolarHBondContact O-CG 3.2Å; P39-E43 PolarHBondContact O-N 2.85Å; A40-E43 PolarHBondContact O-N 2.9Å; E43-V67 HydrophobicContact CG-CB 4.02Å; E43-V67 HydrophobicContact CG-CG1 4.33Å; E43-V67 HydrophobicContact CG-CG2 3.96Å
44	Q	96.9	Very high	96.4	Very high	154 Å²	154	71 Å²	71	72%	0.72	35%	0.349	S	S	*	.	H	α-helix	trans	-70.2	-33.3	176.8	-75.3	173.9	-21.2	0	0	114	A40 C41 L42	A40-Q44 WeakPolarHBondContact O-CG 3.38Å; A40-Q44 PolarHBondContact O-N 3.3Å; A40-Q44 VanDerWaalsContact O-N 3.09Å; C41-Q44 PolarHBondContact O-N 2.78Å; L42-Q44 VanDerWaalsContact C-N 3.26Å; L42-Q44 PolarHBondContact O-N 3.12Å
45	I	96.1	Very high	96.6	Very high	65 Å²	65	68 Å²	68	33%	0.333	34%	0.337	S	S	.	.	H	α-helix	trans	-98.6	-4	-178.7	69	177.1	0	0	0	112.9	I20 C41 L42 F47 I51 P54	I20-I45 HydrophobicContact CD1-CD1 4.48Å; C41-I45 WeakPolarHBondContact O-CG1 3.44Å; C41-I45 PolarHBondContact O-N 2.91Å; L42-I45 HydrophobicContact CD2-CD1 4.09Å; L42-I45 WeakPolarHBondContact O-CG1 3.48Å; L42-I45 PolarHBondContact O-N 3.12Å; I45-F47 PolarHBondContact O-N 3.07Å; I45-I51 HydrophobicContact CD1-CG2 3.88Å; I45-I51 HydrophobicContact CG1-CG2 4.12Å; I45-P54 HydrophobicContact CD1-CG 3.86Å
46	E	95.4	Very high	96.7	Very high	64 Å²	64	67.2 Å²	67.2	30%	0.299	34%	0.338	S	S	.	.			trans	-64	126.3	173.4	-177.2	-174.6	159.3	0	0	109.9	L42 I51 L62	L42-E46 WeakPolarHBondContact O-CB 3.49Å; L42-E46 PolarHBondContact O-N 3.48Å; E46-I51 HydrophobicContact CB-CD1 4.36Å; E46-I51 HydrophobicContact CB-CG1 4.05Å; E46-I51 HydrophobicContact CG-CG1 4.32Å; E46-L62 HydrophobicContact CG-CD1 3.63Å; E46-L62 VanDerWaalsContact OE2-CD1 3.32Å; E46-L62 WeakPolarHBondContact OE2-CD1 3.42Å
47	F	95.5	Very high	96.7	Very high	170 Å²	170	76.6 Å²	76.6	75%	0.746	37%	0.37	S	S	*	.	B	Isolated β-bridge	trans	-136.1	123.4	173.4	-175.2	-102.4	0	0	0	110.3	I45 R49 K50	I45-F47 PolarHBondContact O-N 3.07Å; F47-R49 VanDerWaalsContact C-N 3.34Å; F47-R49 PolarHBondContact O-N 3.41Å; F47-K50 PolarHBondContact N-O 3.45Å; F47-K50 WeakPolarHBondContact O-CB 3.44Å; F47-K50 PolarHBondContact O-N 3.41Å; F47-K50 VanDerWaalsContact O-O 3.13Å
48	N	94.5	Very high	96.7	Very high	131 Å²	131	82 Å²	82	70%	0.701	40%	0.395	S	S	*	.	T	Hydrogen-bonded Turn	trans	52.9	46.6	179.3	-161.4	35.7	0	0	0	113.4	K50	N48-K50 PolarHBondContact O-N 3.22Å
49	R	94.3	Very high	96.7	Very high	154 Å²	154	85.8 Å²	85.8	58%	0.581	41%	0.413	S	S	*	.	T	Hydrogen-bonded Turn	trans	57.4	28.2	-175.7	-56.3	-177.5	-179.8	175.7	-0.4	114	F47 L62	F47-R49 VanDerWaalsContact C-N 3.34Å; F47-R49 PolarHBondContact O-N 3.41Å; R49-L62 HydrophobicContact CB-CB 4.35Å; R49-L62 PolarHBondContact O-N 2.89Å
50	K	96.5	Very high	96.7	Very high	83 Å²	83	83.8 Å²	83.8	36%	0.361	40%	0.4	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.1	141.3	178.5	-68	168.5	167.5	-135.8	0	109.5	F47 N48 E59 T60 T61	F47-K50 PolarHBondContact N-O 3.45Å; F47-K50 WeakPolarHBondContact O-CB 3.44Å; F47-K50 PolarHBondContact O-N 3.41Å; F47-K50 VanDerWaalsContact O-O 3.13Å; N48-K50 PolarHBondContact O-N 3.22Å; K50-E59 HydrophobicContact CB-CG 4.17Å; K50-E59 VanDerWaalsContact CD-OE1 3.3Å; K50-E59 WeakPolarHBondContact CD-OE1 3.48Å; K50-E59 WeakPolarHBondContact CE-OE1 3.42Å; K50-E59 HydrophobicContact CG-CG 4.43Å; K50-E59 IonicContact NZ-OE1 2.74Å; K50-E59 PolarHBondContact NZ-OE1 2.79Å; K50-T60 WeakPolarHBondContact CA-O 3.41Å; K50-T61 HydrophobicContact CG-CG2 4.2Å
51	I	97.7	Very high	96.7	Very high	0 Å²	0	85.8 Å²	85.8	0%	0	41%	0.407	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.8	127.3	173.8	-68.3	174.1	0	0	0	107.7	L31 L42 I45 E46 E59 T60 L62 V67	L31-I51 HydrophobicContact CD1-CG2 3.97Å; L31-I51 HydrophobicContact CD2-CB 4.37Å; L31-I51 HydrophobicContact CD2-CD1 4.43Å; L31-I51 HydrophobicContact CD2-CG2 3.96Å; L42-I51 HydrophobicContact CB-CD1 4Å; L42-I51 HydrophobicContact CD2-CD1 4.26Å; L42-I51 HydrophobicContact CD2-CG2 4.19Å; L42-I51 HydrophobicContact CG-CD1 4.5Å; I45-I51 HydrophobicContact CD1-CG2 3.88Å; I45-I51 HydrophobicContact CG1-CG2 4.12Å; E46-I51 HydrophobicContact CB-CD1 4.36Å; E46-I51 HydrophobicContact CB-CG1 4.05Å; E46-I51 HydrophobicContact CG-CG1 4.32Å; I51-E59 CarbonylContact O-C 3.56Å; I51-E59 WeakPolarHBondContact O-CA 3.42Å; I51-T60 PolarHBondContact N-O 3.01Å; I51-T60 PolarHBondContact O-N 3.18Å; I51-L62 HydrophobicContact CD1-CD1 3.87Å; I51-L62 HydrophobicContact CD1-CD2 4.18Å; I51-L62 HydrophobicContact CD1-CG 4.38Å; I51-L62 HydrophobicContact CG1-CD1 4.15Å; I51-V67 HydrophobicContact CD1-CG2 3.8Å
52	K	97.5	Very high	96.6	Very high	141 Å²	141	86.3 Å²	86.3	61%	0.613	41%	0.409	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-93.9	122.8	168.1	-70.9	-177.3	-180	177	0	108.7	P54 E59	K52-P54 WeakPolarHBondContact O-CD 3.15Å; K52-E59 WeakPolarHBondContact CE-OE2 3.18Å; K52-E59 HydrophobicContact CG-CG 4.48Å
53	C	97.9	Very high	96.4	Very high	2 Å²	2	89.6 Å²	89.6	1%	0.014	43%	0.426	C	S	.	.			trans	-60	124.3	-179.1	-179.8	0	0	0	0	111.1	L31 L55 R57 Q58	L31-C53 HydrophobicContact CD1-CB 3.79Å; C53-L55 PolarHBondContact O-N 2.82Å; C53-L55 PolarHBondContact SG-N 3.05Å; C53-R57 WeakPolarHBondContact O-CA 3.36Å; C53-R57 PolarHBondContact O-N 3.01Å; C53-Q58 WeakPolarHBondContact CB-O 3.19Å; C53-Q58 PolarHBondContact N-O 2.76Å
54	P	96.2	Very high	96.2	Very high	72 Å²	72	88.8 Å²	88.8	47%	0.468	44%	0.436	S	S	.	.	T	Hydrogen-bonded Turn	trans	-61.4	-24.4	177.4	-26.8	36.6	0	0	0	114.2	I20 F37 I45 K52	I20-P54 HydrophobicContact CD1-CG 4.01Å; I20-P54 HydrophobicContact CG1-CG 4.43Å; F37-P54 HydrophobicContact CE1-CG 4.43Å; F37-P54 HydrophobicContact CZ-CG 4.33Å; I45-P54 HydrophobicContact CD1-CG 3.86Å; K52-P54 WeakPolarHBondContact O-CD 3.15Å
55	L	96.7	Very high	96	Very high	101 Å²	101	88.7 Å²	88.7	53%	0.529	43%	0.434	S	S	.	.	T	Hydrogen-bonded Turn	trans	-89.3	-47	-176.4	-61	173.4	0	0	0	112.8	H35 F37 C53	H35-L55 HydrophobicContact CB-CD1 4.14Å; H35-L55 VanDerWaalsContact CD2-CD1 3.43Å; H35-L55 WeakPolarHBondContact CD2-CD1 3.26Å; F37-L55 HydrophobicContact CE1-CD1 4.09Å; F37-L55 HydrophobicContact CE1-CG 4.23Å; F37-L55 HydrophobicContact CZ-CD1 3.77Å; F37-L55 HydrophobicContact CZ-CG 3.9Å; C53-L55 PolarHBondContact O-N 2.82Å; C53-L55 PolarHBondContact SG-N 3.05Å
56	C	97.4	Very high	95.9	Very high	49 Å²	49	86.2 Å²	86.2	33%	0.331	43%	0.425	S	S	.	.	T	Hydrogen-bonded Turn	trans	-118.8	-1.8	-173.9	71	0	0	0	0	114.9	C33 Q58	C33-C56 VanDerWaalsContact CB-SG 3.53Å; C33-C56 VanDerWaalsContact SG-SG 3.61Å; C56-Q58 PolarHBondContact O-N 2.84Å
57	R	96.1	Very high	95.8	Very high	215 Å²	215	83.3 Å²	83.3	81%	0.811	41%	0.411	S	S	*	.			trans	62.5	2.1	-179.4	-52	178.1	-178.8	-173.4	-0.5	116	C53	C53-R57 WeakPolarHBondContact O-CA 3.36Å; C53-R57 PolarHBondContact O-N 3.01Å
58	Q	97.9	Very high	95.7	Very high	113 Å²	113	82.7 Å²	82.7	53%	0.528	41%	0.408	S	S	.	.			trans	-62	139	171.9	-69.7	-173.8	-25.6	0	0	110.3	C33 C53 C56	C33-Q58 HydrophobicContact CB-CB 3.92Å; C33-Q58 HydrophobicContact CB-CG 4.43Å; C53-Q58 WeakPolarHBondContact CB-O 3.19Å; C53-Q58 PolarHBondContact N-O 2.76Å; C56-Q58 PolarHBondContact O-N 2.84Å
59	E	97.1	Very high	95.7	Very high	82 Å²	82	81 Å²	81	38%	0.383	40%	0.399	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.1	134.4	-178.4	-171	170.5	101.5	0	0	110.6	K50 I51 K52	K50-E59 HydrophobicContact CB-CG 4.17Å; K50-E59 VanDerWaalsContact CD-OE1 3.3Å; K50-E59 WeakPolarHBondContact CD-OE1 3.48Å; K50-E59 WeakPolarHBondContact CE-OE1 3.42Å; K50-E59 HydrophobicContact CG-CG 4.43Å; K50-E59 IonicContact NZ-OE1 2.74Å; K50-E59 PolarHBondContact NZ-OE1 2.79Å; I51-E59 CarbonylContact O-C 3.56Å; I51-E59 WeakPolarHBondContact O-CA 3.42Å; K52-E59 WeakPolarHBondContact CE-OE2 3.18Å; K52-E59 HydrophobicContact CG-CG 4.48Å
60	T	97.4	Very high	95.7	Very high	2 Å²	2	74.8 Å²	74.8	1%	0.012	38%	0.377	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114	119.7	171.3	-62.5	0	0	0	0	108.7	L31 T32 K50 I51 L70	L31-T60 WeakPolarHBondContact CB-OG1 3.45Å; L31-T60 HydrophobicContact CD2-CG2 4.24Å; T32-T60 HydrophobicContact CG2-CG2 3.9Å; T32-T60 PolarHBondContact N-OG1 3.32Å; T32-T60 VanDerWaalsContact N-OG1 3.12Å; T32-T60 PolarHBondContact OG1-OG1 3.15Å; K50-T60 WeakPolarHBondContact CA-O 3.41Å; I51-T60 PolarHBondContact N-O 3.01Å; I51-T60 PolarHBondContact O-N 3.18Å; T60-L70 HydrophobicContact CG2-CD2 4.07Å
61	T	96.8	Very high	95.5	Very high	98 Å²	98	76 Å²	76	60%	0.601	39%	0.392	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-82.9	129.6	172.3	50.5	0	0	0	0	110.3	K50	K50-T61 HydrophobicContact CG-CG2 4.2Å
62	L	95.5	Very high	95.2	Very high	17 Å²	17	77.3 Å²	77.3	9%	0.089	40%	0.4	C	S	.	.			trans	-92.6	150.9	177.9	-56.2	175.6	0	0	0	110.8	E46 R49 I51 V67 L70	E46-L62 HydrophobicContact CG-CD1 3.63Å; E46-L62 VanDerWaalsContact OE2-CD1 3.32Å; E46-L62 WeakPolarHBondContact OE2-CD1 3.42Å; R49-L62 HydrophobicContact CB-CB 4.35Å; R49-L62 PolarHBondContact O-N 2.89Å; I51-L62 HydrophobicContact CD1-CD1 3.87Å; I51-L62 HydrophobicContact CD1-CD2 4.18Å; I51-L62 HydrophobicContact CD1-CG 4.38Å; I51-L62 HydrophobicContact CG1-CD1 4.15Å; L62-V67 HydrophobicContact CD1-CG2 4.07Å; L62-L70 HydrophobicContact CD2-CD1 3.92Å; L62-L70 HydrophobicContact CD2-CD2 3.77Å; L62-L70 HydrophobicContact CD2-CG 3.89Å
63	N	93.9	Very high	94.8	Very high	70 Å²	70	74.4 Å²	74.4	37%	0.374	39%	0.385	S	S	.	.			trans	-85.7	-170	171.6	69.1	10.7	0	0	0	111.2	F65 G66 D69	N63-F65 PolarHBondContact O-N 3.45Å; N63-F65 VanDerWaalsContact O-N 3.11Å; N63-F65 WeakPolarHBondContact OD1-CB 3.49Å; N63-F65 PolarHBondContact OD1-N 3.19Å; N63-G66 PolarHBondContact O-N 2.82Å; N63-G66 VanDerWaalsContact O-N 3.1Å; N63-D69 PolarHBondContact ND2-OD2 2.74Å
64	A	92.2	Very high	94.4	Very high	81 Å²	81	77.6 Å²	77.6	67%	0.669	40%	0.399	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.1	-19.6	-178.7	0	0	0	0	0	114.3
65	F	93.3	Very high	94	Very high	153 Å²	153	74.2 Å²	74.2	67%	0.671	38%	0.377	S	S	*	.	T	Hydrogen-bonded Turn	trans	-93.1	-2.2	-179.7	-59	-74.3	0	0	0	113.2	N63 D69	N63-F65 PolarHBondContact O-N 3.45Å; N63-F65 VanDerWaalsContact O-N 3.11Å; N63-F65 WeakPolarHBondContact OD1-CB 3.49Å; N63-F65 PolarHBondContact OD1-N 3.19Å; F65-D69 HydrophobicContact CB-CB 3.75Å
66	G	93.4	Very high	93.5	Very high	13 Å²	13	69.6 Å²	69.6	13%	0.134	36%	0.355	C	S	.	.	G	3₁₀ helix	trans	65.1	-147.5	174.6	0	0	0	0	0	113.5	N63 K68 D69	N63-G66 PolarHBondContact O-N 2.82Å; N63-G66 VanDerWaalsContact O-N 3.1Å; G66-K68 PolarHBondContact O-N 3.39Å; G66-K68 VanDerWaalsContact O-N 3.16Å; G66-D69 PolarHBondContact O-N 3.01Å
67	V	95	Very high	92.9	Very high	3 Å²	3	69.8 Å²	69.8	2%	0.018	36%	0.356	C	S	.	.	G	3₁₀ helix	trans	-56.9	-29.6	-179	172.3	0	0	0	0	113.5	K29 P39 L42 E43 I51 L62 D69 L70	K29-V67 WeakPolarHBondContact CE-O 3.5Å; K29-V67 HydrophobicContact CG-CG1 4.09Å; P39-V67 HydrophobicContact CB-CG1 4.33Å; L42-V67 HydrophobicContact CB-CB 4.47Å; L42-V67 HydrophobicContact CB-CG1 3.72Å; L42-V67 HydrophobicContact CB-CG2 3.81Å; L42-V67 HydrophobicContact CD1-CG1 4.02Å; E43-V67 HydrophobicContact CG-CB 4.02Å; E43-V67 HydrophobicContact CG-CG1 4.33Å; E43-V67 HydrophobicContact CG-CG2 3.96Å; I51-V67 HydrophobicContact CD1-CG2 3.8Å; L62-V67 HydrophobicContact CD1-CG2 4.07Å; V67-D69 PolarHBondContact O-N 2.85Å; V67-L70 HydrophobicContact CG1-CD1 4.44Å; V67-L70 WeakPolarHBondContact O-CB 3.43Å; V67-L70 PolarHBondContact O-N 3.41Å
68	K	92.4	Very high	92.4	Very high	157 Å²	157	61.9 Å²	61.9	68%	0.683	33%	0.33	S	S	*	.	G	3₁₀ helix	trans	-64.7	-27.5	-175.3	-67.2	179.7	-178.3	176.1	0	113.2	K29 G66	K29-K68 WeakPolarHBondContact CE-O 3.37Å; K29-K68 PolarHBondContact NZ-O 3.32Å; G66-K68 PolarHBondContact O-N 3.39Å; G66-K68 VanDerWaalsContact O-N 3.16Å
69	D	94	Very high	91.8	Very high	94 Å²	94	62.5 Å²	62.5	50%	0.503	33%	0.333	S	S	.	.	G	3₁₀ helix	trans	-89.3	-6	-178.5	-164.3	68.4	0	0	0	113.8	N63 F65 G66 V67	N63-D69 PolarHBondContact ND2-OD2 2.74Å; F65-D69 HydrophobicContact CB-CB 3.75Å; G66-D69 PolarHBondContact O-N 3.01Å; V67-D69 PolarHBondContact O-N 2.85Å
70	L	94.8	Very high	91.3	Very high	24 Å²	24	58.6 Å²	58.6	13%	0.126	32%	0.315	C	S	.	.	S	Bend	trans	-60.9	144.5	173	-68.2	175.4	0	0	0	111.1	K29 L31 L42 T60 L62 V67 S72	K29-L70 HydrophobicContact CB-CB 4.05Å; K29-L70 HydrophobicContact CB-CD1 4.17Å; K29-L70 HydrophobicContact CD-CB 4.05Å; K29-L70 WeakPolarHBondContact CD-O 3.42Å; K29-L70 HydrophobicContact CG-CB 4.37Å; K29-L70 PolarHBondContact NZ-O 3.3Å; L31-L70 HydrophobicContact CD2-CD1 3.97Å; L42-L70 HydrophobicContact CD1-CD1 3.76Å; T60-L70 HydrophobicContact CG2-CD2 4.07Å; L62-L70 HydrophobicContact CD2-CD1 3.92Å; L62-L70 HydrophobicContact CD2-CD2 3.77Å; L62-L70 HydrophobicContact CD2-CG 3.89Å; V67-L70 HydrophobicContact CG1-CD1 4.44Å; V67-L70 WeakPolarHBondContact O-CB 3.43Å; V67-L70 PolarHBondContact O-N 3.41Å; L70-S72 PolarHBondContact O-N 3.12Å
71	V	91.9	Very high	90.6	Very high	110 Å²	110	62.3 Å²	62.3	67%	0.667	34%	0.337	S	S	*	.	P	Polyproline II helix	trans	-55.3	136.9	174.3	179.6	0	0	0	0	108.9	T30	T30-V71 WeakPolarHBondContact CB-O 3.15Å; T30-V71 PolarHBondContact N-O 2.9Å; T30-V71 PolarHBondContact OG1-O 3.06Å
72	S	91.3	Very high	90.1	Very high	26 Å²	26	61.4 Å²	61.4	18%	0.182	33%	0.329	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.9	135	-179.6	-53.2	0	0	0	0	110.5	L28 K29 L70	L28-S72 CarbonylContact O-C 3.52Å; L28-S72 VanDerWaalsContact O-CA 3.3Å; L28-S72 WeakPolarHBondContact O-CA 3.39Å; K29-S72 PolarHBondContact NZ-OG 3.09Å; K29-S72 VanDerWaalsContact NZ-OG 3.09Å; L70-S72 PolarHBondContact O-N 3.12Å
73	R	90	Very high	89.8	Confident	80 Å²	80	63.8 Å²	63.8	30%	0.302	35%	0.346	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.9	123.3	163.8	-170.2	-178.7	149	112.1	5.2	107.6	L16 K27 L28 T30 A36 D88 T90	L16-R73 HydrophobicContact CD1-CB 4.03Å; L16-R73 HydrophobicContact CD1-CG 3.81Å; L16-R73 WeakPolarHBondContact CD1-O 3.33Å; K27-R73 CarbonylContact C-O 3.46Å; K27-R73 WeakPolarHBondContact CA-O 3.06Å; L28-R73 PolarHBondContact N-O 3Å; L28-R73 PolarHBondContact O-N 3.48Å; T30-R73 WeakPolarHBondContact OG1-CB 3.37Å; A36-R73 HydrophobicContact CB-CB 4.24Å; R73-D88 IonicContact CZ-OD2 3.24Å; R73-D88 VanDerWaalsContact CZ-OD2 3.24Å; R73-D88 IonicContact NH1-OD2 3.15Å; R73-D88 PolarHBondContact NH1-OD2 3.1Å; R73-D88 VanDerWaalsContact NH1-OD2 3.15Å; R73-D88 IonicContact NH2-OD1 3.56Å; R73-D88 IonicContact NH2-OD2 2.69Å; R73-D88 PolarHBondContact NH2-OD2 2.81Å; R73-T90 HydrophobicContact CB-CG2 4.46Å; R73-T90 HydrophobicContact CG-CG2 4.15Å
74	F	89.5	Confident	89.6	Confident	69 Å²	69	65.9 Å²	65.9	30%	0.303	36%	0.357	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.8	142.1	177.8	-62.3	-86.1	0	0	0	110.5	K27 T90	K27-F74 HydrophobicContact CB-CD1 3.78Å; K27-F74 HydrophobicContact CB-CE1 4.01Å; K27-F74 HydrophobicContact CB-CG 4.49Å; K27-F74 HydrophobicContact CD-CD1 4.46Å; K27-F74 HydrophobicContact CD-CE1 3.86Å; F74-T90 HydrophobicContact CB-CG2 4.16Å; F74-T90 HydrophobicContact CD2-CG2 3.9Å
75	G	87.4	Confident	89.4	Confident	1 Å²	1	66.5 Å²	66.5	1%	0.01	35%	0.349	C	S	.	.	S	Bend	trans	-75.7	151.7	173.2	0	0	0	0	0	111.6	L16 P26 M89	L16-G75 VanDerWaalsContact CG-CA 3.48Å; P26-G75 PolarHBondContact O-N 3.46Å; G75-M89 WeakPolarHBondContact O-CE 3.28Å
76	G	86.8	Confident	89.2	Confident	5 Å²	5	63.3 Å²	63.3	5%	0.052	34%	0.342	C	S	.	.			trans	106.7	160.2	-176	0	0	0	0	0	113.1	E13 M89	E13-G76 PolarHBondContact O-N 3.02Å; G76-M89 PolarHBondContact O-N 2.86Å
77	S	84.9	Confident	88.7	Confident	52 Å²	52	63.4 Å²	63.4	36%	0.364	34%	0.34	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.8	155.9	-168.8	-47.8	0	0	0	0	111.2	V86 V87	S77-V86 VanDerWaalsContact CB-CG1 3.44Å; S77-V87 CarbonylContact C-O 3.5Å; S77-V87 WeakPolarHBondContact CA-O 3.43Å; S77-V87 WeakPolarHBondContact CB-O 3.39Å
78	L	84.3	Confident	88.1	Confident	49 Å²	49	65.6 Å²	65.6	26%	0.257	35%	0.351	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.8	152.9	179.3	-63	166	0	0	0	109	V86 V87 M89 I101	L78-V86 CarbonylContact O-C 3.39Å; L78-V86 WeakPolarHBondContact O-CA 3.18Å; L78-V87 PolarHBondContact N-O 2.85Å; L78-V87 WeakPolarHBondContact O-CG2 2.95Å; L78-V87 PolarHBondContact O-N 3.15Å; L78-M89 HydrophobicContact CD1-CG 3.89Å; L78-M89 HydrophobicContact CG-CG 3.86Å; L78-I101 HydrophobicContact CB-CG2 3.81Å; L78-I101 HydrophobicContact CD1-CD1 3.91Å; L78-I101 HydrophobicContact CD1-CG1 4.17Å; L78-I101 HydrophobicContact CD1-CG2 4.15Å
79	E	86.3	Confident	87.6	Confident	127 Å²	127	59.5 Å²	59.5	59%	0.593	33%	0.325	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-92.3	132.6	176.6	-70.6	176.7	-168.6	0	0	111	T81 V86	E79-T81 PolarHBondContact O-N 3.22Å; E79-V86 HydrophobicContact CG-CG2 4.02Å
80	C	85.6	Confident	86.9	Confident	0 Å²	0	56 Å²	56	0%	0	31%	0.308	C	S	.	.			trans	-65	123.1	170.6	179.2	0	0	0	0	110	D82 C83 N84 L85 I101 C103	C80-D82 VanDerWaalsContact C-N 3.26Å; C80-D82 PolarHBondContact O-N 3.01Å; C80-C83 PolarHBondContact SG-SG 2.95Å; C80-N84 WeakPolarHBondContact O-CA 2.73Å; C80-N84 PolarHBondContact O-N 2.9Å; C80-L85 HydrophobicContact CB-CB 4.22Å; C80-L85 VanDerWaalsContact CB-O 3.26Å; C80-L85 WeakPolarHBondContact CB-O 3.42Å; C80-L85 PolarHBondContact N-O 2.93Å; C80-I101 CarbonylContact C-O 3.53Å; C80-I101 WeakPolarHBondContact CA-O 3.38Å; C80-C103 HydrophobicContact CB-CB 4.1Å; C80-C103 PolarHBondContact SG-N 3.19Å; C80-C103 VanDerWaalsContact SG-N 3.37Å
81	T	84.3	Confident	86.1	Confident	79 Å²	79	57.3 Å²	57.3	49%	0.485	32%	0.319	S	S	.	.	T	Hydrogen-bonded Turn	trans	-63	-29.5	-177.7	-51.3	0	0	0	0	113.3	E79 I101	E79-T81 PolarHBondContact O-N 3.22Å; T81-I101 PolarHBondContact N-O 2.82Å; T81-I101 PolarHBondContact OG1-N 2.82Å; T81-I101 PolarHBondContact OG1-O 3.24Å
82	D	84.7	Confident	85.7	Confident	80 Å²	80	52.1 Å²	52.1	43%	0.428	29%	0.287	S	S	.	.	T	Hydrogen-bonded Turn	trans	-89.2	-28.2	-173.7	-71.3	-5.4	0	0	0	113.7	C80 L102 C106 Q110	C80-D82 VanDerWaalsContact C-N 3.26Å; C80-D82 PolarHBondContact O-N 3.01Å; D82-L102 HydrophobicContact CB-CD2 4.38Å; D82-C106 HydrophobicContact CB-CB 4.1Å; D82-Q110 PolarHBondContact OD1-NE2 3.14Å; D82-Q110 WeakPolarHBondContact OD2-CG 3.49Å; D82-Q110 PolarHBondContact OD2-NE2 3.25Å
83	C	90.5	Very high	85.2	Confident	66 Å²	66	51.7 Å²	51.7	45%	0.446	28%	0.283	S	S	.	.	T	Hydrogen-bonded Turn	trans	-134.4	2.3	-174.5	69	0	0	0	0	114.6	C80 L85 C106	C80-C83 PolarHBondContact SG-SG 2.95Å; C83-L85 PolarHBondContact O-N 3.08Å; C83-L85 VanDerWaalsContact O-N 3.08Å; C83-L85 VanDerWaalsContact SG-CB 3.51Å; C83-C106 VanDerWaalsContact SG-SG 3.61Å
84	N	89.1	Confident	84.3	Confident	115 Å²	115	51.9 Å²	51.9	62%	0.615	28%	0.284	S	S	*	.			trans	57.6	16.8	-177.1	-56.8	-24.3	0	0	0	114.7	C80 V86	C80-N84 WeakPolarHBondContact O-CA 2.73Å; C80-N84 PolarHBondContact O-N 2.9Å; N84-V86 PolarHBondContact O-N 2.69Å
85	L	89	Confident	83.6	Confident	93 Å²	93	49.6 Å²	49.6	49%	0.487	28%	0.276	S	S	.	.			trans	-67.7	124.9	172.7	-178.1	66.4	0	0	0	109.9	C80 C83 V87 C103	C80-L85 HydrophobicContact CB-CB 4.22Å; C80-L85 VanDerWaalsContact CB-O 3.26Å; C80-L85 WeakPolarHBondContact CB-O 3.42Å; C80-L85 PolarHBondContact N-O 2.93Å; C83-L85 PolarHBondContact O-N 3.08Å; C83-L85 VanDerWaalsContact O-N 3.08Å; C83-L85 VanDerWaalsContact SG-CB 3.51Å; L85-V87 HydrophobicContact CD2-CG1 4.38Å; L85-V87 HydrophobicContact CG-CG1 4.39Å; L85-V87 PolarHBondContact O-N 2.91Å; L85-C103 HydrophobicContact CD2-CB 3.91Å
86	V	87.9	Confident	82.7	Confident	86 Å²	86	54.9 Å²	54.9	52%	0.521	30%	0.301	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.3	125	172.1	-179.5	0	0	0	0	109.3	S77 L78 E79 N84	S77-V86 VanDerWaalsContact CB-CG1 3.44Å; L78-V86 CarbonylContact O-C 3.39Å; L78-V86 WeakPolarHBondContact O-CA 3.18Å; E79-V86 HydrophobicContact CG-CG2 4.02Å; N84-V86 PolarHBondContact O-N 2.69Å
87	V	82.7	Confident	82.1	Confident	15 Å²	15	58.4 Å²	58.4	9%	0.091	32%	0.321	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123	149	176.7	-66.1	0	0	0	0	110.4	S77 L78 L85 I101 C103	S77-V87 CarbonylContact C-O 3.5Å; S77-V87 WeakPolarHBondContact CA-O 3.43Å; S77-V87 WeakPolarHBondContact CB-O 3.39Å; L78-V87 PolarHBondContact N-O 2.85Å; L78-V87 WeakPolarHBondContact O-CG2 2.95Å; L78-V87 PolarHBondContact O-N 3.15Å; L85-V87 HydrophobicContact CD2-CG1 4.38Å; L85-V87 HydrophobicContact CG-CG1 4.39Å; L85-V87 PolarHBondContact O-N 2.91Å; V87-I101 HydrophobicContact CG2-CG2 4.39Å; V87-C103 HydrophobicContact CG1-CB 3.49Å; V87-C103 VanDerWaalsContact CG1-CB 3.49Å
88	D	83.5	Confident	81.5	Confident	49 Å²	49	58.1 Å²	58.1	26%	0.262	32%	0.318	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-61.4	147.7	172	-59.8	-43.8	0	0	0	110.5	R73 T90 S91 G92	R73-D88 IonicContact CZ-OD2 3.24Å; R73-D88 VanDerWaalsContact CZ-OD2 3.24Å; R73-D88 IonicContact NH1-OD2 3.15Å; R73-D88 PolarHBondContact NH1-OD2 3.1Å; R73-D88 VanDerWaalsContact NH1-OD2 3.15Å; R73-D88 IonicContact NH2-OD1 3.56Å; R73-D88 IonicContact NH2-OD2 2.69Å; R73-D88 PolarHBondContact NH2-OD2 2.81Å; D88-T90 PolarHBondContact O-N 3.18Å; D88-S91 PolarHBondContact N-OG 3.33Å; D88-S91 PolarHBondContact O-N 3.3Å; D88-S91 PolarHBondContact O-OG 2.94Å; D88-S91 VanDerWaalsContact O-OG 3.08Å; D88-G92 PolarHBondContact O-N 2.85Å
89	M	81.4	Confident	81.2	Confident	29 Å²	29	60.1 Å²	60.1	14%	0.143	34%	0.337	C	S	.	.	T	Hydrogen-bonded Turn	trans	-53.4	-31.4	179.3	-82.8	-161	-76.1	0	0	113.4	M14 G75 G76 L78 Y140	M14-M89 HydrophobicContact CE-CE 3.41Å; M14-M89 VanDerWaalsContact CE-CE 3.41Å; M14-M89 HydrophobicContact CE-SD 4.38Å; M14-M89 HydrophobicContact SD-CE 4.12Å; G75-M89 WeakPolarHBondContact O-CE 3.28Å; G76-M89 PolarHBondContact O-N 2.86Å; L78-M89 HydrophobicContact CD1-CG 3.89Å; L78-M89 HydrophobicContact CG-CG 3.86Å; M89-Y140 WeakPolarHBondContact O-CB 3.48Å
90	T	79	Confident	80.9	Confident	22 Å²	22	54.9 Å²	54.9	14%	0.135	31%	0.314	C	S	.	.	T	Hydrogen-bonded Turn	trans	-82.1	-20.4	179.5	56.7	0	0	0	0	115.1	R73 F74 D88	R73-T90 HydrophobicContact CB-CG2 4.46Å; R73-T90 HydrophobicContact CG-CG2 4.15Å; F74-T90 HydrophobicContact CB-CG2 4.16Å; F74-T90 HydrophobicContact CD2-CG2 3.9Å; D88-T90 PolarHBondContact O-N 3.18Å
91	S	78.8	Confident	80.7	Confident	51 Å²	51	56 Å²	56	36%	0.357	32%	0.32	S	S	.	.	T	Hydrogen-bonded Turn	trans	-98	-20.8	177.2	58.5	0	0	0	0	112.1	D88	D88-S91 PolarHBondContact N-OG 3.33Å; D88-S91 PolarHBondContact O-N 3.3Å; D88-S91 PolarHBondContact O-OG 2.94Å; D88-S91 VanDerWaalsContact O-OG 3.08Å
92	G	82.6	Confident	80.6	Confident	0 Å²	0	52.5 Å²	52.5	0%	0	30%	0.298	C	S	.	.			trans	-62.1	135.5	170.2	0	0	0	0	0	112.5	D88	D88-G92 PolarHBondContact O-N 2.85Å
93	L	80	Confident	80.6	Confident	18 Å²	18	48.9 Å²	48.9	9%	0.094	28%	0.279	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.7	124.4	175.6	-71.3	173.7	0	0	0	109.4	I101 L102 S107 L137 R139	L93-I101 WeakPolarHBondContact O-CA 3.2Å; L93-L102 PolarHBondContact N-O 3.46Å; L93-L102 PolarHBondContact O-N 3.34Å; L93-S107 VanDerWaalsContact CD1-OG 3.27Å; L93-S107 WeakPolarHBondContact CD1-OG 3.27Å; L93-L137 HydrophobicContact CB-CD2 4.09Å; L93-L137 HydrophobicContact CD1-CD1 3.84Å; L93-L137 HydrophobicContact CD1-CD2 3.95Å; L93-L137 HydrophobicContact CD1-CG 4.41Å; L93-L137 HydrophobicContact CD2-CB 3.88Å; L93-L137 HydrophobicContact CD2-CD1 4.3Å; L93-L137 HydrophobicContact CD2-CD2 4.15Å; L93-L137 HydrophobicContact CD2-CG 4.35Å; L93-L137 HydrophobicContact CG-CD2 4.28Å; L93-R139 HydrophobicContact CD2-CG 4.22Å
94	W	72.8	Confident	80.2	Confident	83 Å²	83	53.7 Å²	53.7	31%	0.314	30%	0.295	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.4	125.9	177.9	-177.3	60.2	0	0	0	111	Q96 I101 Y140	W94-Q96 HydrophobicContact CE3-CB 4.38Å; W94-Q96 HydrophobicContact CE3-CG 3.73Å; W94-Q96 HydrophobicContact CH2-CB 3.98Å; W94-Q96 HydrophobicContact CH2-CG 4.08Å; W94-Q96 HydrophobicContact CZ3-CB 3.87Å; W94-Q96 HydrophobicContact CZ3-CG 3.44Å; W94-Q96 VanDerWaalsContact CZ3-CG 3.44Å; W94-I101 HydrophobicContact CB-CD1 3.82Å; W94-I101 HydrophobicContact CG-CD1 4.03Å; W94-Y140 HydrophobicContact CB-CD2 4.27Å
95	C	73.6	Confident	79.8	Confident	21 Å²	21	52.9 Å²	52.9	14%	0.142	30%	0.298	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-89	111.1	171.2	-177.4	0	0	0	0	109.6	T97 C98 S99 S100	C95-T97 PolarHBondContact O-N 3.4Å; C95-C98 HydrophobicContact CB-CB 4.07Å; C95-C98 PolarHBondContact SG-N 3.11Å; C95-C98 VanDerWaalsContact SG-SG 3.65Å; C95-S99 VanDerWaalsContact O-CA 3.28Å; C95-S99 WeakPolarHBondContact O-CA 3.13Å; C95-S99 PolarHBondContact O-N 2.98Å; C95-S100 PolarHBondContact N-O 3.05Å
96	Q	69.8	Low	79.5	Confident	113 Å²	113	49.2 Å²	49.2	53%	0.528	28%	0.28	S	S	.	.	T	Hydrogen-bonded Turn	trans	-62.7	-32.1	-179.6	-45.3	-162.2	-31.6	0	0	112.4	W94	W94-Q96 HydrophobicContact CE3-CB 4.38Å; W94-Q96 HydrophobicContact CE3-CG 3.73Å; W94-Q96 HydrophobicContact CH2-CB 3.98Å; W94-Q96 HydrophobicContact CH2-CG 4.08Å; W94-Q96 HydrophobicContact CZ3-CB 3.87Å; W94-Q96 HydrophobicContact CZ3-CG 3.44Å; W94-Q96 VanDerWaalsContact CZ3-CG 3.44Å
97	T	73.5	Confident	78.9	Confident	78 Å²	78	45.6 Å²	45.6	48%	0.479	26%	0.258	S	S	.	.	T	Hydrogen-bonded Turn	trans	-78.5	-46.4	-178.5	-53.3	0	0	0	0	112.3	C95 C114 Y118	C95-T97 PolarHBondContact O-N 3.4Å; T97-C114 VanDerWaalsContact CB-SG 3.54Å; T97-Y118 HydrophobicContact CG2-CD2 3.78Å; T97-Y118 HydrophobicContact CG2-CE2 3.73Å
98	C	72.8	Confident	78.3	Confident	46 Å²	46	46.4 Å²	46.4	31%	0.311	27%	0.27	S	S	.	.	T	Hydrogen-bonded Turn	trans	-86.1	-11.2	-178	-60.7	0	0	0	0	112.8	C95 S100	C95-C98 HydrophobicContact CB-CB 4.07Å; C95-C98 PolarHBondContact SG-N 3.11Å; C95-C98 VanDerWaalsContact SG-SG 3.65Å; C98-S100 PolarHBondContact O-N 3.46Å; C98-S100 PolarHBondContact O-OG 3.44Å; C98-S100 VanDerWaalsContact O-OG 3.14Å
99	S	76.9	Confident	77.4	Confident	91 Å²	91	53 Å²	53	64%	0.636	29%	0.292	S	S	*	.	T	Hydrogen-bonded Turn	trans	51.6	36.9	-170.5	-62.5	0	0	0	0	112.9	C95	C95-S99 VanDerWaalsContact O-CA 3.28Å; C95-S99 WeakPolarHBondContact O-CA 3.13Å; C95-S99 PolarHBondContact O-N 2.98Å
100	S	81.2	Confident	76.4	Confident	17 Å²	17	52.6 Å²	52.6	12%	0.119	29%	0.289	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.1	148	-176.5	-49.8	0	0	0	0	111.1	C95 C98	C95-S100 PolarHBondContact N-O 3.05Å; C98-S100 PolarHBondContact O-N 3.46Å; C98-S100 PolarHBondContact O-OG 3.44Å; C98-S100 VanDerWaalsContact O-OG 3.14Å
101	I	81	Confident	75.4	Confident	25 Å²	25	54 Å²	54	13%	0.128	30%	0.295	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.7	135.2	171.8	-61.2	-66.5	0	0	0	108.6	L78 C80 T81 V87 L93 W94	L78-I101 HydrophobicContact CB-CG2 3.81Å; L78-I101 HydrophobicContact CD1-CD1 3.91Å; L78-I101 HydrophobicContact CD1-CG1 4.17Å; L78-I101 HydrophobicContact CD1-CG2 4.15Å; C80-I101 CarbonylContact C-O 3.53Å; C80-I101 WeakPolarHBondContact CA-O 3.38Å; T81-I101 PolarHBondContact N-O 2.82Å; T81-I101 PolarHBondContact OG1-N 2.82Å; T81-I101 PolarHBondContact OG1-O 3.24Å; V87-I101 HydrophobicContact CG2-CG2 4.39Å; L93-I101 WeakPolarHBondContact O-CA 3.2Å; W94-I101 HydrophobicContact CB-CD1 3.82Å; W94-I101 HydrophobicContact CG-CD1 4.03Å
102	L	81.4	Confident	74.3	Confident	5 Å²	5	59 Å²	59	3%	0.026	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.3	142.2	-175.8	-57.6	170.1	0	0	0	111.1	D82 L93 C106 Q110	D82-L102 HydrophobicContact CB-CD2 4.38Å; L93-L102 PolarHBondContact N-O 3.46Å; L93-L102 PolarHBondContact O-N 3.34Å; L102-C106 HydrophobicContact CB-CB 4.43Å; L102-C106 HydrophobicContact CD2-CB 4.18Å; L102-Q110 HydrophobicContact CD1-CB 3.35Å; L102-Q110 VanDerWaalsContact CD1-CD 3.47Å; L102-Q110 HydrophobicContact CD1-CG 3.44Å; L102-Q110 VanDerWaalsContact CD1-CG 3.44Å; L102-Q110 HydrophobicContact CD2-CG 3.77Å; L102-Q110 HydrophobicContact CG-CG 4.23Å
103	C	84.2	Confident	72.9	Confident	3 Å²	3	64.3 Å²	64.3	2%	0.02	34%	0.339	C	S	.	.			trans	-72.8	165.8	166.1	70.8	0	0	0	0	111	C80 L85 V87 S105 C106 S107	C80-C103 HydrophobicContact CB-CB 4.1Å; C80-C103 PolarHBondContact SG-N 3.19Å; C80-C103 VanDerWaalsContact SG-N 3.37Å; L85-C103 HydrophobicContact CD2-CB 3.91Å; V87-C103 HydrophobicContact CG1-CB 3.49Å; V87-C103 VanDerWaalsContact CG1-CB 3.49Å; C103-S105 PolarHBondContact O-N 3.35Å; C103-S105 VanDerWaalsContact O-N 3.17Å; C103-C106 PolarHBondContact O-N 2.86Å; C103-C106 VanDerWaalsContact O-N 3.1Å; C103-C106 PolarHBondContact SG-N 2.78Å; C103-C106 VanDerWaalsContact SG-N 3.43Å; C103-S107 WeakPolarHBondContact O-CB 3.46Å; C103-S107 PolarHBondContact O-N 3.45Å
104	E	82	Confident	71.7	Confident	168 Å²	168	64.1 Å²	64.1	79%	0.785	34%	0.339	S	S	*	.	H	α-helix	trans	-51.9	-41.1	178.7	-172.4	168	-167.1	0	0	112	S107	E104-S107 PolarHBondContact O-OG 2.8Å
105	S	82.2	Confident	70.8	Confident	97 Å²	97	61.5 Å²	61.5	68%	0.678	34%	0.335	S	S	*	.	H	α-helix	trans	-71.6	-33.5	-179.6	-46.4	0	0	0	0	114.4	C103	C103-S105 PolarHBondContact O-N 3.35Å; C103-S105 VanDerWaalsContact O-N 3.17Å
106	C	82	Confident	69.7	Low	16 Å²	16	63.4 Å²	63.4	11%	0.108	35%	0.349	C	S	.	.	H	α-helix	trans	-87.3	-24.8	179.2	-66.4	0	0	0	0	112.4	D82 C83 L102 C103 G108 R109 Q110	D82-C106 HydrophobicContact CB-CB 4.1Å; C83-C106 VanDerWaalsContact SG-SG 3.61Å; L102-C106 HydrophobicContact CB-CB 4.43Å; L102-C106 HydrophobicContact CD2-CB 4.18Å; C103-C106 PolarHBondContact O-N 2.86Å; C103-C106 VanDerWaalsContact O-N 3.1Å; C103-C106 PolarHBondContact SG-N 2.78Å; C103-C106 VanDerWaalsContact SG-N 3.43Å; C106-G108 VanDerWaalsContact C-N 3.3Å; C106-G108 PolarHBondContact O-N 2.9Å; C106-R109 PolarHBondContact O-N 3.25Å; C106-Q110 PolarHBondContact O-N 3.5Å
107	S	75	Confident	68.8	Low	10 Å²	10	65.3 Å²	65.3	7%	0.07	36%	0.355	C	S	.	.	H	α-helix	trans	-57.5	-42.4	179.6	72	0	0	0	0	112.6	L93 C103 E104 R109 Q110 I111	L93-S107 VanDerWaalsContact CD1-OG 3.27Å; L93-S107 WeakPolarHBondContact CD1-OG 3.27Å; C103-S107 WeakPolarHBondContact O-CB 3.46Å; C103-S107 PolarHBondContact O-N 3.45Å; E104-S107 PolarHBondContact O-OG 2.8Å; S107-R109 VanDerWaalsContact C-N 3.31Å; S107-R109 PolarHBondContact O-N 2.78Å; S107-Q110 PolarHBondContact O-N 3.29Å; S107-I111 WeakPolarHBondContact O-CB 3.38Å; S107-I111 WeakPolarHBondContact O-CD1 3.39Å; S107-I111 WeakPolarHBondContact O-CG1 3.34Å; S107-I111 PolarHBondContact O-N 2.88Å
108	G	70.7	Confident	67.4	Low	33 Å²	33	66.9 Å²	66.9	34%	0.34	35%	0.353	S	S	.	.	H	α-helix	trans	-57.5	-40.7	174.3	0	0	0	0	0	113.1	C106 F112	C106-G108 VanDerWaalsContact C-N 3.3Å; C106-G108 PolarHBondContact O-N 2.9Å; G108-F112 WeakPolarHBondContact O-CD2 3.15Å
109	R	65	Low	66.1	Low	188 Å²	188	70.1 Å²	70.1	71%	0.709	37%	0.367	S	S	*	.	H	α-helix	trans	-72.8	-42.9	-179.5	-63.6	-175.3	-173.3	-141.4	1.1	112.3	C106 S107 F112 L113	C106-R109 PolarHBondContact O-N 3.25Å; S107-R109 VanDerWaalsContact C-N 3.31Å; S107-R109 PolarHBondContact O-N 2.78Å; R109-F112 PolarHBondContact O-N 3.36Å; R109-L113 PolarHBondContact O-N 2.86Å
110	Q	59.1	Low	64.4	Low	19 Å²	19	74.4 Å²	74.4	9%	0.089	37%	0.374	C	S	.	.	H	α-helix	trans	-70.5	-29.5	176.6	-78	-140.5	2.3	0	0	113.3	D82 L102 C106 S107 F112 L113 C114	D82-Q110 PolarHBondContact OD1-NE2 3.14Å; D82-Q110 WeakPolarHBondContact OD2-CG 3.49Å; D82-Q110 PolarHBondContact OD2-NE2 3.25Å; L102-Q110 HydrophobicContact CD1-CB 3.35Å; L102-Q110 VanDerWaalsContact CD1-CD 3.47Å; L102-Q110 HydrophobicContact CD1-CG 3.44Å; L102-Q110 VanDerWaalsContact CD1-CG 3.44Å; L102-Q110 HydrophobicContact CD2-CG 3.77Å; L102-Q110 HydrophobicContact CG-CG 4.23Å; C106-Q110 PolarHBondContact O-N 3.5Å; S107-Q110 PolarHBondContact O-N 3.29Å; Q110-F112 PolarHBondContact O-N 2.81Å; Q110-L113 PolarHBondContact O-N 3.18Å; Q110-L113 VanDerWaalsContact O-N 3.14Å; Q110-C114 WeakPolarHBondContact O-CB 3.37Å; Q110-C114 PolarHBondContact O-N 3.36Å
111	I	58.2	Low	62.6	Low	51 Å²	51	77.2 Å²	77.2	26%	0.262	39%	0.394	S	S	.	.	H	α-helix	trans	-53.5	-45.5	173.8	-78.9	162.7	0	0	0	110.4	S107 A115 F135 L137	S107-I111 WeakPolarHBondContact O-CB 3.38Å; S107-I111 WeakPolarHBondContact O-CD1 3.39Å; S107-I111 WeakPolarHBondContact O-CG1 3.34Å; S107-I111 PolarHBondContact O-N 2.88Å; I111-A115 WeakPolarHBondContact O-CB 3.17Å; I111-A115 PolarHBondContact O-N 2.73Å; I111-A115 VanDerWaalsContact O-N 3.11Å; I111-F135 HydrophobicContact CB-CE1 4.38Å; I111-F135 HydrophobicContact CG1-CD1 4.4Å; I111-F135 HydrophobicContact CG2-CD1 4.01Å; I111-F135 HydrophobicContact CG2-CE1 3.64Å; I111-F135 HydrophobicContact CG2-CZ 4.38Å; I111-L137 HydrophobicContact CD1-CD1 3.94Å; I111-L137 HydrophobicContact CD1-CD2 4.14Å; I111-L137 HydrophobicContact CD1-CG 4.21Å; I111-L137 HydrophobicContact CG1-CD2 4.39Å
112	F	55.5	Low	60.6	Low	156 Å²	156	79.2 Å²	79.2	68%	0.684	41%	0.407	S	S	*	.	H	α-helix	trans	-65.6	-46.5	174.6	-72.9	-76.8	0	0	0	112.5	G108 R109 Q110 A115 S116	G108-F112 WeakPolarHBondContact O-CD2 3.15Å; R109-F112 PolarHBondContact O-N 3.36Å; Q110-F112 PolarHBondContact O-N 2.81Å; F112-A115 WeakPolarHBondContact O-CB 3.42Å; F112-A115 PolarHBondContact O-N 3.14Å; F112-S116 PolarHBondContact O-N 3.31Å; F112-S116 PolarHBondContact O-OG 3.1Å
113	L	54.6	Low	58.8	Low	112 Å²	112	83 Å²	83	59%	0.586	44%	0.439	S	S	*	.	H	α-helix	trans	-69.3	-35.9	-177.1	-66.5	173	0	0	0	113.3	R109 Q110 S116 K117	R109-L113 PolarHBondContact O-N 2.86Å; Q110-L113 PolarHBondContact O-N 3.18Å; Q110-L113 VanDerWaalsContact O-N 3.14Å; L113-S116 PolarHBondContact O-N 2.96Å; L113-K117 PolarHBondContact O-N 3.41Å
114	C	54.9	Low	57	Low	15 Å²	15	89.9 Å²	89.9	10%	0.101	48%	0.475	C	S	.	.	H	α-helix	trans	-68.5	-40.8	175.7	-171.9	0	0	0	0	110.6	T97 Q110 S116 K117 Y118	T97-C114 VanDerWaalsContact CB-SG 3.54Å; Q110-C114 WeakPolarHBondContact O-CB 3.37Å; Q110-C114 PolarHBondContact O-N 3.36Å; C114-S116 VanDerWaalsContact C-N 3.31Å; C114-S116 PolarHBondContact O-N 3.17Å; C114-K117 PolarHBondContact O-N 3.37Å; C114-Y118 PolarHBondContact O-N 3.04Å
115	A	53.3	Low	55.4	Low	28 Å²	28	89 Å²	89	23%	0.231	47%	0.47	C	S	.	.	H	α-helix	trans	-58.7	-43.3	170.9	0	0	0	0	0	111.5	I111 F112 Y118 L119 F135	I111-A115 WeakPolarHBondContact O-CB 3.17Å; I111-A115 PolarHBondContact O-N 2.73Å; I111-A115 VanDerWaalsContact O-N 3.11Å; F112-A115 WeakPolarHBondContact O-CB 3.42Å; F112-A115 PolarHBondContact O-N 3.14Å; A115-Y118 PolarHBondContact O-N 3.33Å; A115-L119 WeakPolarHBondContact O-CG 3.35Å; A115-L119 PolarHBondContact O-N 3.41Å; A115-F135 HydrophobicContact CB-CZ 4.01Å
116	S	50.6	Low	53.2	Low	61 Å²	61	91.4 Å²	91.4	43%	0.427	48%	0.476	S	S	.	.	H	α-helix	trans	-64.8	-44	178.7	-59.8	0	0	0	0	112.9	F112 L113 C114 Y118 L119 F120	F112-S116 PolarHBondContact O-N 3.31Å; F112-S116 PolarHBondContact O-OG 3.1Å; L113-S116 PolarHBondContact O-N 2.96Å; C114-S116 VanDerWaalsContact C-N 3.31Å; C114-S116 PolarHBondContact O-N 3.17Å; S116-Y118 VanDerWaalsContact C-N 3.32Å; S116-Y118 PolarHBondContact O-N 2.77Å; S116-L119 PolarHBondContact O-N 3.28Å; S116-F120 WeakPolarHBondContact O-CD2 3.49Å; S116-F120 PolarHBondContact O-N 2.99Å
117	K	50.8	Low	51.1	Low	153 Å²	153	97.4 Å²	97.4	67%	0.665	51%	0.505	S	S	*	.	H	α-helix	trans	-65.6	-34.4	175.5	-74.6	-170.1	176.5	-172.4	0	112.6	L113 C114 F120 S121	L113-K117 PolarHBondContact O-N 3.41Å; C114-K117 PolarHBondContact O-N 3.37Å; K117-F120 PolarHBondContact O-N 3.03Å; K117-S121 PolarHBondContact O-N 3.35Å; K117-S121 PolarHBondContact O-OG 3.27Å
118	Y	44.6	Very low	49.6	Very low	111 Å²	111	107.7 Å²	107.7	44%	0.435	54%	0.543	S	S	.	.	H	α-helix	trans	-72.3	-38.7	174.9	-125.7	-97	0	0	0	111.9	T97 C114 A115 S116 F120 S121 V122	T97-Y118 HydrophobicContact CG2-CD2 3.78Å; T97-Y118 HydrophobicContact CG2-CE2 3.73Å; C114-Y118 PolarHBondContact O-N 3.04Å; A115-Y118 PolarHBondContact O-N 3.33Å; S116-Y118 VanDerWaalsContact C-N 3.32Å; S116-Y118 PolarHBondContact O-N 2.77Å; Y118-F120 PolarHBondContact O-N 3.33Å; Y118-S121 CarbonylContact O-C 3.53Å; Y118-S121 WeakPolarHBondContact O-CA 3.4Å; Y118-S121 WeakPolarHBondContact O-CB 3.21Å; Y118-S121 PolarHBondContact O-N 3.02Å; Y118-V122 HydrophobicContact CD1-CG1 4.36Å; Y118-V122 HydrophobicContact CD1-CG2 4.23Å; Y118-V122 HydrophobicContact CE1-CG1 4.43Å; Y118-V122 WeakPolarHBondContact O-CG2 3.49Å; Y118-V122 PolarHBondContact O-N 2.98Å
119	L	44.7	Very low	48.1	Very low	114 Å²	114	113.8 Å²	113.8	60%	0.597	57%	0.566	S	S	*	*	H	α-helix	trans	-57.4	-32.9	171.9	-78.2	167.6	0	0	0	112.2	A115 S116 A123	A115-L119 WeakPolarHBondContact O-CG 3.35Å; A115-L119 PolarHBondContact O-N 3.41Å; S116-L119 PolarHBondContact O-N 3.28Å; L119-A123 WeakPolarHBondContact O-CB 3.45Å; L119-A123 PolarHBondContact O-N 3.04Å
120	F	41.9	Very low	46.6	Very low	180 Å²	180	108.8 Å²	108.8	79%	0.789	56%	0.556	S	S	*	*	H	α-helix	trans	-69.4	-30.4	169.4	-88.9	-84	0	0	0	113.7	S116 K117 Y118	S116-F120 WeakPolarHBondContact O-CD2 3.49Å; S116-F120 PolarHBondContact O-N 2.99Å; K117-F120 PolarHBondContact O-N 3.03Å; Y118-F120 PolarHBondContact O-N 3.33Å
121	S	41.9	Very low	45.6	Very low	76 Å²	76	116 Å²	116	53%	0.531	58%	0.584	S	S	.	*	H	α-helix	trans	-81.1	-37.6	179.1	-55.4	0	0	0	0	112.9	K117 Y118	K117-S121 PolarHBondContact O-N 3.35Å; K117-S121 PolarHBondContact O-OG 3.27Å; Y118-S121 CarbonylContact O-C 3.53Å; Y118-S121 WeakPolarHBondContact O-CA 3.4Å; Y118-S121 WeakPolarHBondContact O-CB 3.21Å; Y118-S121 PolarHBondContact O-N 3.02Å
122	V	39.9	Very low	44.8	Very low	67 Å²	67	123.2 Å²	123.2	41%	0.406	61%	0.609	S	S	.	*	H	α-helix	trans	-96.3	-2	179.1	-77.7	0	0	0	0	114.7	Y118 L124 Q125	Y118-V122 HydrophobicContact CD1-CG1 4.36Å; Y118-V122 HydrophobicContact CD1-CG2 4.23Å; Y118-V122 HydrophobicContact CE1-CG1 4.43Å; Y118-V122 WeakPolarHBondContact O-CG2 3.49Å; Y118-V122 PolarHBondContact O-N 2.98Å; V122-L124 PolarHBondContact O-N 3.43Å; V122-L124 VanDerWaalsContact O-N 3.1Å; V122-Q125 CarbonylContact O-C 3.57Å; V122-Q125 PolarHBondContact O-N 3.12Å
123	A	44.3	Very low	44.2	Very low	85 Å²	85	119.3 Å²	119.3	70%	0.702	60%	0.602	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61	-12.6	163.2	0	0	0	0	0	112.9	L119	L119-A123 WeakPolarHBondContact O-CB 3.45Å; L119-A123 PolarHBondContact O-N 3.04Å
124	L	46.5	Very low	43.6	Very low	148 Å²	148	120.2 Å²	120.2	78%	0.775	60%	0.603	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.8	-12.7	170.4	-75.8	170.4	0	0	0	114.8	V122	V122-L124 PolarHBondContact O-N 3.43Å; V122-L124 VanDerWaalsContact O-N 3.1Å
125	Q	46.8	Very low	43	Very low	148 Å²	148	123.8 Å²	123.8	69%	0.692	62%	0.617	S	S	*	*	S	Bend	trans	-144.5	88	177.4	-90.2	124.1	26.2	0	0	111.5	V122	V122-Q125 CarbonylContact O-C 3.57Å; V122-Q125 PolarHBondContact O-N 3.12Å
126	N	36.6	Very low	42.7	Very low	148 Å²	148	132.1 Å²	132.1	79%	0.791	64%	0.642	S	S	*	*			trans	47.5	96.9	150.7	-72.5	-58.9	0	0	0	118.7
127	I	37.5	Very low	42.5	Very low	142 Å²	142	132.8 Å²	132.8	73%	0.728	64%	0.64	S	S	*	*				25.4	125.4	122.6	-61.2	173.4	0	0	0	117.9
128	R	43.6	Very low	42.3	Very low	226 Å²	226	127 Å²	127	85%	0.853	62%	0.621	S	S	*	*	S	Bend	trans	66.3	97.5	162.2	-75.5	171.8	167.8	175.6	-3.9	113.4
129	I	39.4	Very low	42.4	Very low	161 Å²	161	129.8 Å²	129.8	83%	0.826	63%	0.631	S	S	*	*	S	Bend		-169	-4.1	92.2	-89.4	150.7	0	0	0	114.2	Y131	I129-Y131 PolarHBondContact O-N 2.8Å
130	T	34.7	Very low	42.2	Very low	83 Å²	83	130.7 Å²	130.7	51%	0.509	63%	0.627	S	S	.	*			trans	-101	27.2	-165.5	48	0	0	0	0	116.5	Y132 S133	T130-Y132 PolarHBondContact O-N 2.9Å; T130-Y132 VanDerWaalsContact O-N 3.07Å; T130-S133 WeakPolarHBondContact CB-OG 3.17Å; T130-S133 WeakPolarHBondContact CG2-OG 3.4Å; T130-S133 PolarHBondContact O-N 3.37Å
131	Y	38.4	Very low	42	Very low	170 Å²	170	124.8 Å²	124.8	67%	0.667	62%	0.617	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.8	-24.9	179.1	-164.4	-97.6	0	0	0	113.5	I129 F135	I129-Y131 PolarHBondContact O-N 2.8Å; Y131-F135 WeakPolarHBondContact O-CD2 3.15Å; Y131-F135 WeakPolarHBondContact O-CE2 3.26Å
132	Y	40.4	Very low	41.3	Very low	203 Å²	203	124.6 Å²	124.6	80%	0.796	63%	0.628	S	S	*	*	T	Hydrogen-bonded Turn	trans	-112.4	-11.1	-175.8	-78.5	-80.6	0	0	0	115.6	T130	T130-Y132 PolarHBondContact O-N 2.9Å; T130-Y132 VanDerWaalsContact O-N 3.07Å
133	S	42.8	Very low	41.1	Very low	75 Å²	75	129.7 Å²	129.7	52%	0.524	68%	0.677	S	S	.	*	T	Hydrogen-bonded Turn	trans	-94.4	-15.7	-172.3	58.9	0	0	0	0	115.1	T130	T130-S133 WeakPolarHBondContact CB-OG 3.17Å; T130-S133 WeakPolarHBondContact CG2-OG 3.4Å; T130-S133 PolarHBondContact O-N 3.37Å
134	H	41.7	Very low	40.9	Very low	131 Å²	131	132 Å²	132	61%	0.606	68%	0.676	S	S	*	*	S	Bend	trans	-96.4	-13.2	179.2	-81.4	-82.7	0	0	0	114.8	R136	H134-R136 PolarHBondContact O-N 3.25Å
135	F	43.6	Very low	40.6	Very low	90 Å²	90	131.1 Å²	131.1	40%	0.395	67%	0.67	S	S	.	*			trans	-79.6	50.3	172.6	-65.4	-77.3	0	0	0	111.4	I111 A115 Y131 L137	I111-F135 HydrophobicContact CB-CE1 4.38Å; I111-F135 HydrophobicContact CG1-CD1 4.4Å; I111-F135 HydrophobicContact CG2-CD1 4.01Å; I111-F135 HydrophobicContact CG2-CE1 3.64Å; I111-F135 HydrophobicContact CG2-CZ 4.38Å; A115-F135 HydrophobicContact CB-CZ 4.01Å; Y131-F135 WeakPolarHBondContact O-CD2 3.15Å; Y131-F135 WeakPolarHBondContact O-CE2 3.26Å; F135-L137 PolarHBondContact O-N 2.82Å
136	R	45.7	Very low	40.3	Very low	202 Å²	202	130.2 Å²	130.2	76%	0.762	67%	0.669	S	S	*	*			trans	-76	88.6	153.1	-77.7	-171.4	-179.2	-158.9	1.3	105.7	H134 A138	H134-R136 PolarHBondContact O-N 3.25Å; R136-A138 PolarHBondContact O-N 3.08Å
137	L	46.3	Very low	40.5	Very low	76 Å²	76	129.1 Å²	129.1	40%	0.398	66%	0.662	S	S	.	*			trans	-54.7	84	146.8	-79.2	-178.9	0	0	0	106.3	L93 I111 F135 R139	L93-L137 HydrophobicContact CB-CD2 4.09Å; L93-L137 HydrophobicContact CD1-CD1 3.84Å; L93-L137 HydrophobicContact CD1-CD2 3.95Å; L93-L137 HydrophobicContact CD1-CG 4.41Å; L93-L137 HydrophobicContact CD2-CB 3.88Å; L93-L137 HydrophobicContact CD2-CD1 4.3Å; L93-L137 HydrophobicContact CD2-CD2 4.15Å; L93-L137 HydrophobicContact CD2-CG 4.35Å; L93-L137 HydrophobicContact CG-CD2 4.28Å; I111-L137 HydrophobicContact CD1-CD1 3.94Å; I111-L137 HydrophobicContact CD1-CD2 4.14Å; I111-L137 HydrophobicContact CD1-CG 4.21Å; I111-L137 HydrophobicContact CG1-CD2 4.39Å; F135-L137 PolarHBondContact O-N 2.82Å; L137-R139 PolarHBondContact O-N 3.47Å; L137-R139 VanDerWaalsContact O-N 3.12Å
138	A	46.1	Very low	40.7	Very low	32 Å²	32	128.3 Å²	128.3	26%	0.264	66%	0.658	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-70.3	110.8	172.3	0	0	0	0	0	105.1	R136 Y140	R136-A138 PolarHBondContact O-N 3.08Å; A138-Y140 PolarHBondContact O-N 3.43Å
139	R	46.7	Very low	40.5	Very low	169 Å²	169	121.8 Å²	121.8	64%	0.638	65%	0.645	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-56.3	134	156.7	-68	-172.3	-177.7	-159.6	0.4	106.2	L93 L137 G141 G142	L93-R139 HydrophobicContact CD2-CG 4.22Å; L137-R139 PolarHBondContact O-N 3.47Å; L137-R139 VanDerWaalsContact O-N 3.12Å; R139-G141 PolarHBondContact O-N 3Å; R139-G142 PolarHBondContact O-N 3.19Å
140	Y	40.9	Very low	40.5	Very low	132 Å²	132	119 Å²	119	52%	0.518	63%	0.632	S	S	.	*	T	Hydrogen-bonded Turn	trans	-63.6	100.2	175.8	-146.4	-92.4	0	0	0	107.2	M89 W94 A138	M89-Y140 WeakPolarHBondContact O-CB 3.48Å; W94-Y140 HydrophobicContact CB-CD2 4.27Å; A138-Y140 PolarHBondContact O-N 3.43Å
141	G	38.1	Very low	41	Very low	56 Å²	56	121.8 Å²	121.8	58%	0.577	64%	0.641	S	S	*	*	T	Hydrogen-bonded Turn	trans	132.2	10.7	-174.3	0	0	0	0	0	117.1	R139	R139-G141 PolarHBondContact O-N 3Å
142	G	28.3	Very low	41.2	Very low	73 Å²	73	117.8 Å²	117.8	75%	0.753	64%	0.639	S	S	*	*			trans	-100	74.8	174.7	0	0	0	0	0	114.5	R139	R139-G142 PolarHBondContact O-N 3.19Å
143	A	34.1	Very low	41.3	Very low	174 Å²	174	110 Å²	110	100%	1.438	63%	0.625	S	S	*	*			trans	-176.1	0	146.7	0	0	0	0	0	108.4

Retrieved 143 of 143 residues in 86.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).