A0A077Z9G6_TRITR Loading...

V-type proton ATPase subunit G

Subunit of the V1 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane, where it is responsible for acidifying the extracellular environment.

AlphaFold DB , UniProt , Accession A0A077Z9G6, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 118 aa.

						>A0A077Z9G6_TRITR|A0A077Z9G6
MASQTTGIQQLLAAEKKAAEQVNEARKRKARRLKQAKEEAQQEIEKYREQREQQFRQYEAKHLGSRQDIAQRIEQDAAMKVQLLEQTVSLNKEKVIQLLLQSVCDVKPVVHRNVRRHA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	55.3	Low	80.2	Confident	208 Å²	208	109.4 Å²	109.4	100%	1.025	61%	0.608	S	S	*	*				0	-34.6	0	-62.8	-60.2	-126.3	0	0	113.9	S3 Q4	M1-S3 PolarHBondContact O-N 3.4Å; M1-Q4 PolarHBondContact O-N 3.47Å
2	A	60.2	Low	81.4	Confident	77 Å²	77	108.7 Å²	108.7	64%	0.636	60%	0.601	S	S	*	*	H	α-helix	trans	-68.2	-25.6	-178	0	0	0	0	0	116.1	Q4 T5 T6	A2-Q4 VanDerWaalsContact C-N 3.31Å; A2-Q4 PolarHBondContact O-N 3.45Å; A2-T5 PolarHBondContact O-OG1 3.47Å; A2-T6 PolarHBondContact O-OG1 3.26Å
3	S	64.8	Low	82.4	Confident	102 Å²	102	105 Å²	105	71%	0.713	59%	0.594	S	S	*	*	H	α-helix	trans	-72.4	-22.6	179.2	-174.9	0	0	0	0	113.8	M1 T6	M1-S3 PolarHBondContact O-N 3.4Å; S3-T6 PolarHBondContact O-OG1 3.34Å
4	Q	74.2	Confident	83.4	Confident	141 Å²	141	101.6 Å²	101.6	66%	0.659	59%	0.586	S	S	*	*	H	α-helix	trans	-78.8	-34	-178.4	-156	-171	35.1	0	0	110.8	M1 A2 I8	M1-Q4 PolarHBondContact O-N 3.47Å; A2-Q4 VanDerWaalsContact C-N 3.31Å; A2-Q4 PolarHBondContact O-N 3.45Å; Q4-I8 WeakPolarHBondContact O-CD1 3.47Å; Q4-I8 WeakPolarHBondContact O-CG1 3.46Å; Q4-I8 PolarHBondContact O-N 3.21Å
5	T	83	Confident	84.2	Confident	77 Å²	77	103.5 Å²	103.5	47%	0.472	59%	0.587	S	S	.	*	H	α-helix	trans	-74.2	-37	-178.2	55.9	0	0	0	0	112.5	A2 I8 Q9	A2-T5 PolarHBondContact O-OG1 3.47Å; T5-I8 PolarHBondContact O-N 2.98Å; T5-Q9 WeakPolarHBondContact O-CG 3.33Å; T5-Q9 PolarHBondContact O-N 2.84Å; T5-Q9 VanDerWaalsContact O-N 3.13Å
6	T	86.4	Confident	85	Confident	73 Å²	73	105.6 Å²	105.6	45%	0.448	59%	0.587	S	S	.	*	H	α-helix	trans	-66.4	-40.1	175.5	36.6	0	0	0	0	112.8	A2 S3 Q9 Q10	A2-T6 PolarHBondContact O-OG1 3.26Å; S3-T6 PolarHBondContact O-OG1 3.34Å; T6-Q9 PolarHBondContact O-N 3.26Å; T6-Q10 PolarHBondContact O-N 2.98Å; T6-Q10 VanDerWaalsContact O-N 3.12Å
7	G	89.8	Confident	85.7	Confident	30 Å²	30	108.2 Å²	108.2	31%	0.309	59%	0.591	S	S	.	*	H	α-helix	trans	-61.9	-42.8	175.1	0	0	0	0	0	112.6	Q9 Q10 L11	G7-Q9 PolarHBondContact O-N 3.45Å; G7-Q10 PolarHBondContact O-N 3.44Å; G7-L11 WeakPolarHBondContact O-CG 3.39Å; G7-L11 PolarHBondContact O-N 2.92Å; G7-L11 VanDerWaalsContact O-N 3.12Å
8	I	90.5	Very high	86.3	Confident	91 Å²	91	105 Å²	105	47%	0.467	58%	0.582	S	S	.	*	H	α-helix	trans	-62.7	-41.5	176.4	-66.7	166.8	0	0	0	111.1	Q4 T5 Q10 L11 L12	Q4-I8 WeakPolarHBondContact O-CD1 3.47Å; Q4-I8 WeakPolarHBondContact O-CG1 3.46Å; Q4-I8 PolarHBondContact O-N 3.21Å; T5-I8 PolarHBondContact O-N 2.98Å; I8-Q10 PolarHBondContact O-N 3.28Å; I8-L11 PolarHBondContact O-N 3.45Å; I8-L12 HydrophobicContact CG2-CD1 3.99Å; I8-L12 HydrophobicContact CG2-CG 4.42Å; I8-L12 WeakPolarHBondContact O-CG 3.4Å; I8-L12 PolarHBondContact O-N 3.31Å
9	Q	91.1	Very high	86.8	Confident	129 Å²	129	101.8 Å²	101.8	60%	0.603	57%	0.571	S	S	*	*	H	α-helix	trans	-62.6	-39.7	177.4	-73.8	175.7	-5.4	0	0	112.7	T5 T6 G7 L12 A13	T5-Q9 WeakPolarHBondContact O-CG 3.33Å; T5-Q9 PolarHBondContact O-N 2.84Å; T5-Q9 VanDerWaalsContact O-N 3.13Å; T6-Q9 PolarHBondContact O-N 3.26Å; G7-Q9 PolarHBondContact O-N 3.45Å; Q9-L12 PolarHBondContact O-N 3.13Å; Q9-A13 WeakPolarHBondContact O-CB 3.35Å; Q9-A13 PolarHBondContact O-N 2.84Å
10	Q	93.4	Very high	87.4	Confident	148 Å²	148	101.9 Å²	101.9	69%	0.692	57%	0.566	S	S	*	*	H	α-helix	trans	-64.2	-41.7	175.3	-74.6	-178.7	-13.9	0	0	112	T6 G7 I8 A13 A14	T6-Q10 PolarHBondContact O-N 2.98Å; T6-Q10 VanDerWaalsContact O-N 3.12Å; G7-Q10 PolarHBondContact O-N 3.44Å; I8-Q10 PolarHBondContact O-N 3.28Å; Q10-A13 PolarHBondContact O-N 3.12Å; Q10-A14 WeakPolarHBondContact O-CB 3.3Å; Q10-A14 PolarHBondContact O-N 3.37Å
11	L	93.6	Very high	87.8	Confident	127 Å²	127	103.6 Å²	103.6	67%	0.665	57%	0.57	S	S	*	*	H	α-helix	trans	-62.8	-44.9	176.2	-69.1	173.3	0	0	0	111.7	G7 I8 A13 A14 E15	G7-L11 WeakPolarHBondContact O-CG 3.39Å; G7-L11 PolarHBondContact O-N 2.92Å; G7-L11 VanDerWaalsContact O-N 3.12Å; I8-L11 PolarHBondContact O-N 3.45Å; L11-A13 VanDerWaalsContact C-N 3.35Å; L11-A13 PolarHBondContact O-N 3.31Å; L11-A14 PolarHBondContact O-N 3.12Å; L11-E15 WeakPolarHBondContact O-CB 3.4Å; L11-E15 PolarHBondContact O-N 3.47Å
12	L	94.9	Very high	89.9	Confident	101 Å²	101	97.1 Å²	97.1	53%	0.529	54%	0.542	S	S	.	.	H	α-helix	trans	-62.8	-39.4	176.5	-71.8	170.2	0	0	0	112.4	I8 Q9 E15 K16	I8-L12 HydrophobicContact CG2-CD1 3.99Å; I8-L12 HydrophobicContact CG2-CG 4.42Å; I8-L12 WeakPolarHBondContact O-CG 3.4Å; I8-L12 PolarHBondContact O-N 3.31Å; Q9-L12 PolarHBondContact O-N 3.13Å; L12-E15 PolarHBondContact O-N 2.89Å; L12-K16 WeakPolarHBondContact O-CB 3.39Å; L12-K16 PolarHBondContact O-N 3.46Å
13	A	94.8	Very high	91.6	Very high	61 Å²	61	97.4 Å²	97.4	50%	0.504	53%	0.533	S	S	.	.	H	α-helix	trans	-66.7	-41	175.6	0	0	0	0	0	112	Q9 Q10 L11 K16 K17	Q9-A13 WeakPolarHBondContact O-CB 3.35Å; Q9-A13 PolarHBondContact O-N 2.84Å; Q10-A13 PolarHBondContact O-N 3.12Å; L11-A13 VanDerWaalsContact C-N 3.35Å; L11-A13 PolarHBondContact O-N 3.31Å; A13-K16 PolarHBondContact O-N 2.98Å; A13-K17 WeakPolarHBondContact O-CB 3.37Å; A13-K17 PolarHBondContact O-N 3.32Å
14	A	95.5	Very high	93.2	Very high	58 Å²	58	99.4 Å²	99.4	48%	0.479	53%	0.531	S	S	.	.	H	α-helix	trans	-64.6	-42.5	175.3	0	0	0	0	0	111.7	Q10 L11 K17 A18	Q10-A14 WeakPolarHBondContact O-CB 3.3Å; Q10-A14 PolarHBondContact O-N 3.37Å; L11-A14 PolarHBondContact O-N 3.12Å; A14-K17 PolarHBondContact O-N 3.33Å; A14-A18 WeakPolarHBondContact O-CB 3.46Å; A14-A18 PolarHBondContact O-N 3.48Å
15	E	96.1	Very high	94.3	Very high	130 Å²	130	95.5 Å²	95.5	61%	0.607	52%	0.523	S	S	*	.	H	α-helix	trans	-60.2	-47.4	175.3	-175	179.7	-174.6	0	0	111.2	L11 L12 K17 A18 A19	L11-E15 WeakPolarHBondContact O-CB 3.4Å; L11-E15 PolarHBondContact O-N 3.47Å; L12-E15 PolarHBondContact O-N 2.89Å; E15-K17 PolarHBondContact O-N 3.44Å; E15-A18 PolarHBondContact O-N 3.33Å; E15-A19 VanDerWaalsContact O-CB 3.3Å; E15-A19 WeakPolarHBondContact O-CB 3.46Å; E15-A19 PolarHBondContact O-N 3.01Å
16	K	96.7	Very high	95	Very high	136 Å²	136	100.1 Å²	100.1	59%	0.591	53%	0.532	S	S	*	.	H	α-helix	trans	-58.8	-46.5	176.3	-173.9	179.4	175.7	-175.8	0	111.7	L12 A13 A19 E20	L12-K16 WeakPolarHBondContact O-CB 3.39Å; L12-K16 PolarHBondContact O-N 3.46Å; A13-K16 PolarHBondContact O-N 2.98Å; K16-A19 PolarHBondContact O-N 2.98Å; K16-E20 WeakPolarHBondContact CE-OE1 3.44Å; K16-E20 WeakPolarHBondContact O-CB 3.45Å; K16-E20 WeakPolarHBondContact O-CG 3.34Å; K16-E20 PolarHBondContact O-N 2.92Å
17	K	96.4	Very high	95.6	Very high	150 Å²	150	104.3 Å²	104.3	65%	0.652	54%	0.544	S	S	*	.	H	α-helix	trans	-64.7	-41.3	179.6	-168.7	175.9	-177.9	177.9	0	112.1	A13 A14 E15 E20 Q21	A13-K17 WeakPolarHBondContact O-CB 3.37Å; A13-K17 PolarHBondContact O-N 3.32Å; A14-K17 PolarHBondContact O-N 3.33Å; E15-K17 PolarHBondContact O-N 3.44Å; K17-E20 PolarHBondContact O-N 3.32Å; K17-Q21 WeakPolarHBondContact O-CB 3.37Å; K17-Q21 PolarHBondContact O-N 2.91Å
18	A	96.6	Very high	96	Very high	51 Å²	51	109.6 Å²	109.6	42%	0.421	55%	0.554	S	S	.	*	H	α-helix	trans	-64.5	-43.6	175.1	0	0	0	0	0	111.4	A14 E15 Q21 V22	A14-A18 WeakPolarHBondContact O-CB 3.46Å; A14-A18 PolarHBondContact O-N 3.48Å; E15-A18 PolarHBondContact O-N 3.33Å; A18-Q21 PolarHBondContact O-N 3.39Å; A18-V22 WeakPolarHBondContact O-CG2 3.3Å; A18-V22 PolarHBondContact O-N 2.98Å
19	A	96.9	Very high	96.3	Very high	45 Å²	45	112.3 Å²	112.3	37%	0.372	56%	0.563	S	S	.	*	H	α-helix	trans	-62.4	-42.5	176.4	0	0	0	0	0	112	E15 K16 V22 N23	E15-A19 VanDerWaalsContact O-CB 3.3Å; E15-A19 WeakPolarHBondContact O-CB 3.46Å; E15-A19 PolarHBondContact O-N 3.01Å; K16-A19 PolarHBondContact O-N 2.98Å; A19-V22 PolarHBondContact O-N 3.01Å; A19-N23 VanDerWaalsContact O-CB 3.3Å; A19-N23 WeakPolarHBondContact O-CB 3.44Å; A19-N23 VanDerWaalsContact O-CG 3.22Å; A19-N23 PolarHBondContact O-N 2.88Å; A19-N23 PolarHBondContact O-ND2 3.15Å
20	E	97.3	Very high	96.6	Very high	102 Å²	102	109 Å²	109	48%	0.477	56%	0.557	S	S	.	*	H	α-helix	trans	-60.4	-48.1	174.1	-77.4	173.2	-178.5	0	0	111.5	K16 K17 V22 N23 E24	K16-E20 WeakPolarHBondContact CE-OE1 3.44Å; K16-E20 WeakPolarHBondContact O-CB 3.45Å; K16-E20 WeakPolarHBondContact O-CG 3.34Å; K16-E20 PolarHBondContact O-N 2.92Å; K17-E20 PolarHBondContact O-N 3.32Å; E20-V22 VanDerWaalsContact C-N 3.35Å; E20-V22 PolarHBondContact O-N 3.33Å; E20-N23 PolarHBondContact O-N 3.21Å; E20-N23 VanDerWaalsContact O-N 3.15Å; E20-E24 PolarHBondContact O-N 3.36Å
21	Q	97.4	Very high	96.8	Very high	138 Å²	138	109.8 Å²	109.8	65%	0.645	55%	0.554	S	S	*	*	H	α-helix	trans	-61.2	-41.8	179.1	-171.4	174.4	2.3	0	0	112.3	K17 A18 A25	K17-Q21 WeakPolarHBondContact O-CB 3.37Å; K17-Q21 PolarHBondContact O-N 2.91Å; A18-Q21 PolarHBondContact O-N 3.39Å; Q21-A25 WeakPolarHBondContact O-CB 3.47Å; Q21-A25 PolarHBondContact O-N 3.46Å
22	V	97.8	Very high	97	Very high	72 Å²	72	111 Å²	111	44%	0.436	55%	0.549	S	S	.	.	H	α-helix	trans	-65.8	-41.8	175.3	172.2	0	0	0	0	111	A18 A19 E20 A25 R26	A18-V22 WeakPolarHBondContact O-CG2 3.3Å; A18-V22 PolarHBondContact O-N 2.98Å; A19-V22 PolarHBondContact O-N 3.01Å; E20-V22 VanDerWaalsContact C-N 3.35Å; E20-V22 PolarHBondContact O-N 3.33Å; V22-A25 PolarHBondContact O-N 2.98Å; V22-R26 HydrophobicContact CG1-CG 4.5Å; V22-R26 WeakPolarHBondContact O-CG 3.39Å; V22-R26 PolarHBondContact O-N 3.46Å
23	N	97.4	Very high	97.2	Very high	84 Å²	84	111 Å²	111	45%	0.449	55%	0.549	S	S	.	.	H	α-helix	trans	-65.5	-40.5	178.3	-77.6	-27.2	0	0	0	112.3	A19 E20 R26 K27	A19-N23 VanDerWaalsContact O-CB 3.3Å; A19-N23 WeakPolarHBondContact O-CB 3.44Å; A19-N23 VanDerWaalsContact O-CG 3.22Å; A19-N23 PolarHBondContact O-N 2.88Å; A19-N23 PolarHBondContact O-ND2 3.15Å; E20-N23 PolarHBondContact O-N 3.21Å; E20-N23 VanDerWaalsContact O-N 3.15Å; N23-R26 PolarHBondContact O-N 2.94Å; N23-K27 WeakPolarHBondContact O-CG 3.12Å; N23-K27 PolarHBondContact O-N 3.45Å
24	E	97.6	Very high	97.3	Very high	143 Å²	143	114.5 Å²	114.5	67%	0.668	55%	0.554	S	S	*	*	H	α-helix	trans	-62.2	-44.3	172.3	-75	-166.5	154.7	0	0	112	E20 R26 K27 R28	E20-E24 PolarHBondContact O-N 3.36Å; E24-R26 VanDerWaalsContact C-N 3.33Å; E24-R26 PolarHBondContact O-N 3.29Å; E24-K27 PolarHBondContact O-N 3.42Å; E24-R28 WeakPolarHBondContact O-CB 3.48Å; E24-R28 PolarHBondContact O-N 2.94Å
25	A	97.8	Very high	97.4	Very high	60 Å²	60	116.1 Å²	116.1	50%	0.496	55%	0.551	S	S	.	*	H	α-helix	trans	-60.2	-42.4	175.8	0	0	0	0	0	111.8	Q21 V22 R28 K29	Q21-A25 WeakPolarHBondContact O-CB 3.47Å; Q21-A25 PolarHBondContact O-N 3.46Å; V22-A25 PolarHBondContact O-N 2.98Å; A25-R28 PolarHBondContact O-N 3.27Å; A25-K29 WeakPolarHBondContact O-CB 3.4Å; A25-K29 PolarHBondContact O-N 3.36Å
26	R	97.8	Very high	97.5	Very high	173 Å²	173	112.4 Å²	112.4	65%	0.653	54%	0.543	S	S	*	.	H	α-helix	trans	-63	-46.8	174.9	-73.6	175.6	-179.9	-169.8	0.7	112	V22 N23 E24 R28 K29 A30	V22-R26 HydrophobicContact CG1-CG 4.5Å; V22-R26 WeakPolarHBondContact O-CG 3.39Å; V22-R26 PolarHBondContact O-N 3.46Å; N23-R26 PolarHBondContact O-N 2.94Å; E24-R26 VanDerWaalsContact C-N 3.33Å; E24-R26 PolarHBondContact O-N 3.29Å; R26-R28 VanDerWaalsContact C-N 3.34Å; R26-R28 PolarHBondContact O-N 2.9Å; R26-K29 PolarHBondContact O-N 3.41Å; R26-A30 PolarHBondContact O-N 2.85Å
27	K	97.7	Very high	97.6	Very high	161 Å²	161	113.6 Å²	113.6	70%	0.7	55%	0.548	S	S	*	.	H	α-helix	trans	-59.5	-43.7	175.7	-76.4	179	-179	178.5	0	111.5	N23 E24 A30 R31	N23-K27 WeakPolarHBondContact O-CG 3.12Å; N23-K27 PolarHBondContact O-N 3.45Å; E24-K27 PolarHBondContact O-N 3.42Å; K27-A30 PolarHBondContact O-N 2.85Å; K27-R31 WeakPolarHBondContact O-CB 3.43Å; K27-R31 PolarHBondContact O-N 3.19Å
28	R	97.9	Very high	97.6	Very high	142 Å²	142	111 Å²	111	54%	0.536	54%	0.538	S	S	.	.	H	α-helix	trans	-63.5	-41.8	177.3	-172.5	178.6	179.6	176.4	0.8	112	E24 A25 R26 R31 R32	E24-R28 WeakPolarHBondContact O-CB 3.48Å; E24-R28 PolarHBondContact O-N 2.94Å; A25-R28 PolarHBondContact O-N 3.27Å; R26-R28 VanDerWaalsContact C-N 3.34Å; R26-R28 PolarHBondContact O-N 2.9Å; R28-R31 PolarHBondContact O-N 2.98Å; R28-R32 PolarHBondContact O-N 3.48Å
29	K	97.9	Very high	97.7	Very high	147 Å²	147	113.4 Å²	113.4	64%	0.639	54%	0.541	S	S	*	.	H	α-helix	trans	-61.7	-48	175	-176.6	178.5	178.2	179.4	0	111.2	A25 R26 R31 R32 L33	A25-K29 WeakPolarHBondContact O-CB 3.4Å; A25-K29 PolarHBondContact O-N 3.36Å; R26-K29 PolarHBondContact O-N 3.41Å; K29-R31 VanDerWaalsContact C-N 3.34Å; K29-R31 PolarHBondContact O-N 3.46Å; K29-R32 PolarHBondContact O-N 2.94Å; K29-L33 HydrophobicContact CG-CD1 4.2Å; K29-L33 WeakPolarHBondContact O-CG 3.48Å; K29-L33 PolarHBondContact O-N 3.45Å
30	A	97.8	Very high	97.7	Very high	59 Å²	59	113.5 Å²	113.5	49%	0.488	54%	0.541	S	S	.	.	H	α-helix	trans	-60.2	-43.4	177.7	0	0	0	0	0	112	R26 K27 L33 K34	R26-A30 PolarHBondContact O-N 2.85Å; K27-A30 PolarHBondContact O-N 2.85Å; A30-L33 PolarHBondContact O-N 3.44Å; A30-K34 PolarHBondContact O-N 3.07Å
31	R	97.9	Very high	97.7	Very high	166 Å²	166	113.2 Å²	113.2	63%	0.626	54%	0.54	S	S	*	.	H	α-helix	trans	-60.5	-47.1	175.8	-170.6	178.4	73.3	-162.1	4.3	112.1	K27 R28 K29 L33 K34 Q35	K27-R31 WeakPolarHBondContact O-CB 3.43Å; K27-R31 PolarHBondContact O-N 3.19Å; R28-R31 PolarHBondContact O-N 2.98Å; K29-R31 VanDerWaalsContact C-N 3.34Å; K29-R31 PolarHBondContact O-N 3.46Å; R31-L33 VanDerWaalsContact C-N 3.34Å; R31-L33 PolarHBondContact O-N 2.92Å; R31-K34 PolarHBondContact O-N 3.34Å; R31-Q35 WeakPolarHBondContact O-CB 3.41Å; R31-Q35 PolarHBondContact O-N 3.29Å
32	R	97.7	Very high	97.8	Very high	151 Å²	151	111.6 Å²	111.6	57%	0.57	53%	0.533	S	S	*	.	H	α-helix	trans	-62.1	-39.9	177.6	-81.1	-169.1	170.9	179.6	-2.9	112.6	R28 K29 Q35 A36	R28-R32 PolarHBondContact O-N 3.48Å; K29-R32 PolarHBondContact O-N 2.94Å; R32-Q35 PolarHBondContact O-N 3.3Å; R32-A36 WeakPolarHBondContact O-CB 3.43Å; R32-A36 PolarHBondContact O-N 2.99Å
33	L	97.6	Very high	97.7	Very high	101 Å²	101	115.1 Å²	115.1	53%	0.529	54%	0.544	S	S	.	.	H	α-helix	trans	-65.4	-39.5	175.9	-73.6	170.4	0	0	0	112.2	K29 A30 R31 K37	K29-L33 HydrophobicContact CG-CD1 4.2Å; K29-L33 WeakPolarHBondContact O-CG 3.48Å; K29-L33 PolarHBondContact O-N 3.45Å; A30-L33 PolarHBondContact O-N 3.44Å; R31-L33 VanDerWaalsContact C-N 3.34Å; R31-L33 PolarHBondContact O-N 2.92Å; L33-K37 WeakPolarHBondContact O-CG 3.37Å; L33-K37 PolarHBondContact O-N 2.97Å
34	K	98	Very high	97.7	Very high	136 Å²	136	115.2 Å²	115.2	59%	0.591	54%	0.544	S	S	*	.	H	α-helix	trans	-65.2	-47.4	175.8	-173.7	176.8	173	-176.6	0	111.2	A30 R31 A36 K37 E38	A30-K34 PolarHBondContact O-N 3.07Å; R31-K34 PolarHBondContact O-N 3.34Å; K34-A36 PolarHBondContact O-N 2.86Å; K34-K37 WeakPolarHBondContact O-CB 3.34Å; K34-K37 PolarHBondContact O-N 2.91Å; K34-K37 VanDerWaalsContact O-N 3.16Å; K34-E38 WeakPolarHBondContact CE-OE1 3.3Å; K34-E38 IonicContact NZ-OE1 3.43Å; K34-E38 PolarHBondContact O-N 2.99Å
35	Q	97.8	Very high	97.8	Very high	91 Å²	91	112.9 Å²	112.9	43%	0.425	53%	0.533	S	S	.	.	H	α-helix	trans	-58.5	-46.4	177	-177.7	176.9	-0.7	0	0	111.7	R31 R32 K37 E38 E39	R31-Q35 WeakPolarHBondContact O-CB 3.41Å; R31-Q35 PolarHBondContact O-N 3.29Å; R32-Q35 PolarHBondContact O-N 3.3Å; Q35-K37 VanDerWaalsContact C-N 3.27Å; Q35-K37 PolarHBondContact O-N 3.25Å; Q35-E38 PolarHBondContact O-N 3.16Å; Q35-E38 VanDerWaalsContact O-N 3.14Å; Q35-E39 HydrophobicContact CG-CG 4.31Å; Q35-E39 VanDerWaalsContact CG-OE1 3.26Å; Q35-E39 WeakPolarHBondContact CG-OE1 3.26Å; Q35-E39 PolarHBondContact NE2-OE1 2.77Å; Q35-E39 WeakPolarHBondContact O-CB 3.48Å; Q35-E39 WeakPolarHBondContact O-CG 3.43Å; Q35-E39 PolarHBondContact O-N 3.45Å
36	A	97.7	Very high	97.8	Very high	53 Å²	53	116.1 Å²	116.1	44%	0.438	54%	0.536	S	S	.	.	H	α-helix	trans	-60.5	-35.9	177.9	0	0	0	0	0	112.7	R32 K34 A40	R32-A36 WeakPolarHBondContact O-CB 3.43Å; R32-A36 PolarHBondContact O-N 2.99Å; K34-A36 PolarHBondContact O-N 2.86Å; A36-A40 VanDerWaalsContact O-CB 3.3Å; A36-A40 WeakPolarHBondContact O-CB 3.29Å; A36-A40 PolarHBondContact O-N 3.14Å
37	K	97.8	Very high	97.8	Very high	161 Å²	161	114.6 Å²	114.6	70%	0.7	53%	0.531	S	S	*	.	H	α-helix	trans	-68.2	-43.4	174.3	-74.1	-178.2	177.8	-171	0	112.1	L33 K34 Q35 Q41	L33-K37 WeakPolarHBondContact O-CG 3.37Å; L33-K37 PolarHBondContact O-N 2.97Å; K34-K37 WeakPolarHBondContact O-CB 3.34Å; K34-K37 PolarHBondContact O-N 2.91Å; K34-K37 VanDerWaalsContact O-N 3.16Å; Q35-K37 VanDerWaalsContact C-N 3.27Å; Q35-K37 PolarHBondContact O-N 3.25Å; K37-Q41 WeakPolarHBondContact O-CB 3.48Å; K37-Q41 PolarHBondContact O-N 3.29Å
38	E	98	Very high	97.8	Very high	96 Å²	96	115.6 Å²	115.6	45%	0.449	53%	0.53	S	S	.	.	H	α-helix	trans	-64.9	-44.1	178.4	-73.8	172.4	179.4	0	0	111.3	K34 Q35 Q41 Q42	K34-E38 WeakPolarHBondContact CE-OE1 3.3Å; K34-E38 IonicContact NZ-OE1 3.43Å; K34-E38 PolarHBondContact O-N 2.99Å; Q35-E38 PolarHBondContact O-N 3.16Å; Q35-E38 VanDerWaalsContact O-N 3.14Å; E38-Q41 PolarHBondContact O-N 3.03Å; E38-Q42 VanDerWaalsContact O-CG 3.29Å; E38-Q42 WeakPolarHBondContact O-CG 2.97Å; E38-Q42 PolarHBondContact O-N 3.31Å
39	E	97.5	Very high	97.7	Very high	101 Å²	101	114.5 Å²	114.5	47%	0.472	53%	0.531	S	S	.	.	H	α-helix	trans	-62.6	-45.6	176.8	-73	172.6	-177.1	0	0	111.6	Q35 Q41 Q42 E43	Q35-E39 HydrophobicContact CG-CG 4.31Å; Q35-E39 VanDerWaalsContact CG-OE1 3.26Å; Q35-E39 WeakPolarHBondContact CG-OE1 3.26Å; Q35-E39 PolarHBondContact NE2-OE1 2.77Å; Q35-E39 WeakPolarHBondContact O-CB 3.48Å; Q35-E39 WeakPolarHBondContact O-CG 3.43Å; Q35-E39 PolarHBondContact O-N 3.45Å; E39-Q41 VanDerWaalsContact C-N 3.33Å; E39-Q41 PolarHBondContact O-N 3.35Å; E39-Q42 PolarHBondContact O-N 2.92Å; E39-E43 PolarHBondContact O-N 2.98Å
40	A	97.6	Very high	97.7	Very high	46 Å²	46	112.9 Å²	112.9	38%	0.38	53%	0.526	S	S	.	.	H	α-helix	trans	-61.5	-41.1	175.7	0	0	0	0	0	112.2	A36 E43 I44	A36-A40 VanDerWaalsContact O-CB 3.3Å; A36-A40 WeakPolarHBondContact O-CB 3.29Å; A36-A40 PolarHBondContact O-N 3.14Å; A40-E43 PolarHBondContact O-N 3.31Å; A40-I44 VanDerWaalsContact O-CG1 3.29Å; A40-I44 WeakPolarHBondContact O-CG1 3.28Å; A40-I44 PolarHBondContact O-N 3.14Å
41	Q	97.8	Very high	97.7	Very high	97 Å²	97	116.2 Å²	116.2	45%	0.453	53%	0.526	S	S	.	.	H	α-helix	trans	-64.9	-43.2	177.6	-173.9	62.8	26.8	0	0	111.6	K37 E38 E39 E43 I44 E45	K37-Q41 WeakPolarHBondContact O-CB 3.48Å; K37-Q41 PolarHBondContact O-N 3.29Å; E38-Q41 PolarHBondContact O-N 3.03Å; E39-Q41 VanDerWaalsContact C-N 3.33Å; E39-Q41 PolarHBondContact O-N 3.35Å; Q41-E43 VanDerWaalsContact C-N 3.31Å; Q41-E43 PolarHBondContact O-N 2.98Å; Q41-I44 PolarHBondContact O-N 2.91Å; Q41-E45 PolarHBondContact NE2-OE1 3.43Å; Q41-E45 WeakPolarHBondContact O-CG 3.29Å; Q41-E45 PolarHBondContact O-N 2.98Å
42	Q	98	Very high	97.7	Very high	104 Å²	104	112.3 Å²	112.3	49%	0.486	52%	0.515	S	S	.	.	H	α-helix	trans	-61.5	-39.1	175.4	-73.7	175.1	15.3	0	0	112.2	E38 E39 E45 K46	E38-Q42 VanDerWaalsContact O-CG 3.29Å; E38-Q42 WeakPolarHBondContact O-CG 2.97Å; E38-Q42 PolarHBondContact O-N 3.31Å; E39-Q42 PolarHBondContact O-N 2.92Å; Q42-E45 PolarHBondContact O-N 3.43Å; Q42-K46 WeakPolarHBondContact O-CB 3.43Å; Q42-K46 WeakPolarHBondContact O-CG 3.49Å; Q42-K46 PolarHBondContact O-N 3.38Å
43	E	97.4	Very high	97.6	Very high	145 Å²	145	110.7 Å²	110.7	68%	0.678	51%	0.514	S	S	*	.	H	α-helix	trans	-67.3	-40.6	177.5	-167.9	169.5	-164.4	0	0	111.8	E39 A40 Q41 E45 K46 Y47	E39-E43 PolarHBondContact O-N 2.98Å; A40-E43 PolarHBondContact O-N 3.31Å; Q41-E43 VanDerWaalsContact C-N 3.31Å; Q41-E43 PolarHBondContact O-N 2.98Å; E43-E45 PolarHBondContact O-N 2.97Å; E43-K46 PolarHBondContact O-N 3.36Å; E43-Y47 WeakPolarHBondContact O-CB 3.48Å; E43-Y47 PolarHBondContact O-N 3.35Å
44	I	97.5	Very high	97.6	Very high	86 Å²	86	110.6 Å²	110.6	44%	0.441	51%	0.511	S	S	.	.	H	α-helix	trans	-61.2	-44.1	173.9	-69.6	166.2	0	0	0	111.2	A40 Q41 Y47 R48	A40-I44 VanDerWaalsContact O-CG1 3.29Å; A40-I44 WeakPolarHBondContact O-CG1 3.28Å; A40-I44 PolarHBondContact O-N 3.14Å; Q41-I44 PolarHBondContact O-N 2.91Å; I44-Y47 PolarHBondContact O-N 3.46Å; I44-R48 WeakPolarHBondContact O-CG 3.44Å; I44-R48 PolarHBondContact O-N 2.9Å
45	E	97.8	Very high	97.4	Very high	95 Å²	95	109.7 Å²	109.7	44%	0.444	51%	0.507	S	S	.	.	H	α-helix	trans	-64.9	-46.7	179.3	-76.5	169.1	-169	0	0	111.6	Q41 Q42 E43 Y47 R48 E49	Q41-E45 PolarHBondContact NE2-OE1 3.43Å; Q41-E45 WeakPolarHBondContact O-CG 3.29Å; Q41-E45 PolarHBondContact O-N 2.98Å; Q42-E45 PolarHBondContact O-N 3.43Å; E43-E45 PolarHBondContact O-N 2.97Å; E45-Y47 VanDerWaalsContact C-N 3.29Å; E45-Y47 PolarHBondContact O-N 2.98Å; E45-R48 WeakPolarHBondContact O-CB 3.33Å; E45-R48 PolarHBondContact O-N 2.85Å; E45-R48 VanDerWaalsContact O-N 3.14Å; E45-E49 WeakPolarHBondContact O-CG 3.47Å; E45-E49 PolarHBondContact O-N 2.95Å
46	K	97.9	Very high	97.2	Very high	127 Å²	127	112.7 Å²	112.7	55%	0.552	51%	0.514	S	S	*	.	H	α-helix	trans	-57.4	-43	173.7	-74.9	175.6	-176.6	174.9	0	112	Q42 E43 E49 Q50	Q42-K46 WeakPolarHBondContact O-CB 3.43Å; Q42-K46 WeakPolarHBondContact O-CG 3.49Å; Q42-K46 PolarHBondContact O-N 3.38Å; E43-K46 PolarHBondContact O-N 3.36Å; K46-E49 PolarHBondContact O-N 2.94Å; K46-Q50 WeakPolarHBondContact O-CB 3.31Å; K46-Q50 VanDerWaalsContact O-CG 3.29Å; K46-Q50 WeakPolarHBondContact O-CG 3.34Å; K46-Q50 PolarHBondContact O-N 3.26Å
47	Y	97.8	Very high	97	Very high	141 Å²	141	115.6 Å²	115.6	55%	0.553	52%	0.519	S	S	*	.	H	α-helix	trans	-65	-41.7	177.8	-174.2	-101.9	0	0	0	111.6	E43 I44 E45 Q50 R51	E43-Y47 WeakPolarHBondContact O-CB 3.48Å; E43-Y47 PolarHBondContact O-N 3.35Å; I44-Y47 PolarHBondContact O-N 3.46Å; E45-Y47 VanDerWaalsContact C-N 3.29Å; E45-Y47 PolarHBondContact O-N 2.98Å; Y47-Q50 PolarHBondContact O-N 3.49Å; Y47-R51 HydrophobicContact CD1-CG 4.03Å; Y47-R51 HydrophobicContact CE1-CG 3.64Å; Y47-R51 HydrophobicContact CE2-CG 4.21Å; Y47-R51 HydrophobicContact CG-CG 4.49Å; Y47-R51 WeakPolarHBondContact O-CB 3.49Å; Y47-R51 VanDerWaalsContact O-CG 3.28Å; Y47-R51 WeakPolarHBondContact O-CG 3.47Å; Y47-R51 PolarHBondContact O-N 3.44Å
48	R	97.6	Very high	96.7	Very high	182 Å²	182	114.7 Å²	114.7	69%	0.687	51%	0.512	S	S	*	.	H	α-helix	trans	-59.4	-47.9	174.2	-81.5	-178.1	172.2	-169.2	-1.8	111.8	I44 E45 Q50 R51 E52	I44-R48 WeakPolarHBondContact O-CG 3.44Å; I44-R48 PolarHBondContact O-N 2.9Å; E45-R48 WeakPolarHBondContact O-CB 3.33Å; E45-R48 PolarHBondContact O-N 2.85Å; E45-R48 VanDerWaalsContact O-N 3.14Å; R48-Q50 PolarHBondContact O-N 3.43Å; R48-R51 PolarHBondContact O-N 2.97Å; R48-E52 VanDerWaalsContact O-CB 3.32Å; R48-E52 WeakPolarHBondContact O-CB 3.29Å; R48-E52 PolarHBondContact O-N 2.93Å
49	E	97.8	Very high	96.2	Very high	120 Å²	120	114.2 Å²	114.2	56%	0.561	51%	0.51	S	S	*	.	H	α-helix	trans	-60.1	-44.6	177.9	-71.9	177.3	176.7	0	0	112	E45 K46 R51 E52 Q53	E45-E49 WeakPolarHBondContact O-CG 3.47Å; E45-E49 PolarHBondContact O-N 2.95Å; K46-E49 PolarHBondContact O-N 2.94Å; E49-R51 PolarHBondContact O-N 2.89Å; E49-E52 PolarHBondContact O-N 3.37Å; E49-Q53 WeakPolarHBondContact O-CB 3.44Å; E49-Q53 WeakPolarHBondContact O-CG 3.44Å; E49-Q53 PolarHBondContact O-N 3.46Å
50	Q	97.6	Very high	95.7	Very high	112 Å²	112	112.9 Å²	112.9	52%	0.523	52%	0.516	S	S	.	.	H	α-helix	trans	-60.9	-43.7	176.2	-74.3	176.4	1.5	0	0	112.1	K46 Y47 R48 Q53 Q54	K46-Q50 WeakPolarHBondContact O-CB 3.31Å; K46-Q50 VanDerWaalsContact O-CG 3.29Å; K46-Q50 WeakPolarHBondContact O-CG 3.34Å; K46-Q50 PolarHBondContact O-N 3.26Å; Y47-Q50 PolarHBondContact O-N 3.49Å; R48-Q50 PolarHBondContact O-N 3.43Å; Q50-Q53 PolarHBondContact O-N 2.95Å; Q50-Q54 VanDerWaalsContact O-CG 3.31Å; Q50-Q54 WeakPolarHBondContact O-CG 3.15Å; Q50-Q54 PolarHBondContact O-N 3.47Å
51	R	97.3	Very high	95.2	Very high	130 Å²	130	117.8 Å²	117.8	49%	0.491	53%	0.529	S	S	.	.	H	α-helix	trans	-67.8	-39.6	178.6	-69.9	-60.2	-62.1	-179.2	-9.6	112.1	Y47 R48 E49 Q54 F55	Y47-R51 HydrophobicContact CD1-CG 4.03Å; Y47-R51 HydrophobicContact CE1-CG 3.64Å; Y47-R51 HydrophobicContact CE2-CG 4.21Å; Y47-R51 HydrophobicContact CG-CG 4.49Å; Y47-R51 WeakPolarHBondContact O-CB 3.49Å; Y47-R51 VanDerWaalsContact O-CG 3.28Å; Y47-R51 WeakPolarHBondContact O-CG 3.47Å; Y47-R51 PolarHBondContact O-N 3.44Å; R48-R51 PolarHBondContact O-N 2.97Å; E49-R51 PolarHBondContact O-N 2.89Å; R51-Q54 PolarHBondContact O-N 3.37Å; R51-F55 WeakPolarHBondContact O-CB 3.32Å; R51-F55 PolarHBondContact O-N 3.4Å
52	E	97.1	Very high	94.5	Very high	84 Å²	84	117.8 Å²	117.8	39%	0.393	53%	0.528	S	S	.	.	H	α-helix	trans	-63.7	-42.8	175	-179.1	63.3	-164.2	0	0	111.2	R48 E49 F55 R56	R48-E52 VanDerWaalsContact O-CB 3.32Å; R48-E52 WeakPolarHBondContact O-CB 3.29Å; R48-E52 PolarHBondContact O-N 2.93Å; E49-E52 PolarHBondContact O-N 3.37Å; E52-F55 PolarHBondContact O-N 3.47Å; E52-R56 WeakPolarHBondContact O-CG 3.45Å; E52-R56 PolarHBondContact O-N 2.81Å; E52-R56 IonicContact OE1-CZ 3.88Å; E52-R56 IonicContact OE1-NE 3.02Å; E52-R56 PolarHBondContact OE1-NE 3.02Å; E52-R56 IonicContact OE1-NH2 2.67Å; E52-R56 PolarHBondContact OE1-NH2 2.86Å
53	Q	97.1	Very high	93.5	Very high	117 Å²	117	118.6 Å²	118.6	55%	0.547	54%	0.536	S	S	.	.	H	α-helix	trans	-63	-45	174.2	-74.3	178.8	13.3	0	0	112	E49 Q50 F55 R56 Q57	E49-Q53 WeakPolarHBondContact O-CB 3.44Å; E49-Q53 WeakPolarHBondContact O-CG 3.44Å; E49-Q53 PolarHBondContact O-N 3.46Å; Q50-Q53 PolarHBondContact O-N 2.95Å; Q53-F55 VanDerWaalsContact C-N 3.3Å; Q53-F55 PolarHBondContact O-N 3.29Å; Q53-R56 PolarHBondContact O-N 2.8Å; Q53-Q57 WeakPolarHBondContact O-CB 3.32Å; Q53-Q57 VanDerWaalsContact O-CG 3.3Å; Q53-Q57 WeakPolarHBondContact O-CG 3.4Å; Q53-Q57 PolarHBondContact O-N 3.04Å
54	Q	96	Very high	92.4	Very high	98 Å²	98	113.2 Å²	113.2	46%	0.458	52%	0.519	S	S	.	.	H	α-helix	trans	-59.8	-42.6	175	-75.4	175.1	4.1	0	0	111.4	Q50 R51 Q57 Y58	Q50-Q54 VanDerWaalsContact O-CG 3.31Å; Q50-Q54 WeakPolarHBondContact O-CG 3.15Å; Q50-Q54 PolarHBondContact O-N 3.47Å; R51-Q54 PolarHBondContact O-N 3.37Å; Q54-Q57 PolarHBondContact O-N 3.14Å; Q54-Y58 WeakPolarHBondContact O-CB 3.44Å; Q54-Y58 PolarHBondContact O-N 3.42Å
55	F	94.7	Very high	91.4	Very high	118 Å²	118	111.4 Å²	111.4	52%	0.518	51%	0.514	S	S	.	.	H	α-helix	trans	-62.1	-49.8	177.6	-179.5	-98.6	0	0	0	111.3	R51 E52 Q53 Q57 Y58 E59	R51-F55 WeakPolarHBondContact O-CB 3.32Å; R51-F55 PolarHBondContact O-N 3.4Å; E52-F55 PolarHBondContact O-N 3.47Å; Q53-F55 VanDerWaalsContact C-N 3.3Å; Q53-F55 PolarHBondContact O-N 3.29Å; F55-Q57 VanDerWaalsContact C-N 3.33Å; F55-Q57 PolarHBondContact O-N 2.93Å; F55-Y58 WeakPolarHBondContact O-CB 3.38Å; F55-Y58 PolarHBondContact O-N 2.93Å; F55-Y58 VanDerWaalsContact O-N 3.14Å; F55-E59 WeakPolarHBondContact O-CB 3.3Å; F55-E59 PolarHBondContact O-N 3.39Å
56	R	93.9	Very high	90.5	Very high	153 Å²	153	116.7 Å²	116.7	58%	0.577	53%	0.53	S	S	*	.	H	α-helix	trans	-61.7	-38.6	177.2	-72.2	-176.3	-162.9	-178.7	4.3	113	E52 Q53 Y58 E59 A60	E52-R56 WeakPolarHBondContact O-CG 3.45Å; E52-R56 PolarHBondContact O-N 2.81Å; E52-R56 IonicContact OE1-CZ 3.88Å; E52-R56 IonicContact OE1-NE 3.02Å; E52-R56 PolarHBondContact OE1-NE 3.02Å; E52-R56 IonicContact OE1-NH2 2.67Å; E52-R56 PolarHBondContact OE1-NH2 2.86Å; Q53-R56 PolarHBondContact O-N 2.8Å; R56-Y58 VanDerWaalsContact C-N 3.35Å; R56-E59 PolarHBondContact O-N 2.89Å; R56-A60 VanDerWaalsContact O-CB 3.31Å; R56-A60 WeakPolarHBondContact O-CB 3.47Å; R56-A60 PolarHBondContact O-N 3.26Å
57	Q	92.9	Very high	89.8	Confident	114 Å²	114	117.3 Å²	117.3	53%	0.533	54%	0.535	S	S	.	.	H	α-helix	trans	-65.4	-40.5	175.1	-73.9	178.3	17.4	0	0	111.8	Q53 Q54 F55 K61	Q53-Q57 WeakPolarHBondContact O-CB 3.32Å; Q53-Q57 VanDerWaalsContact O-CG 3.3Å; Q53-Q57 WeakPolarHBondContact O-CG 3.4Å; Q53-Q57 PolarHBondContact O-N 3.04Å; Q54-Q57 PolarHBondContact O-N 3.14Å; F55-Q57 VanDerWaalsContact C-N 3.33Å; F55-Q57 PolarHBondContact O-N 2.93Å; Q57-K61 WeakPolarHBondContact O-CB 3.39Å; Q57-K61 VanDerWaalsContact O-CG 3.3Å; Q57-K61 WeakPolarHBondContact O-CG 3.43Å; Q57-K61 PolarHBondContact O-N 2.77Å; Q57-K61 VanDerWaalsContact O-N 3.12Å
58	Y	91.1	Very high	89.2	Confident	143 Å²	143	115 Å²	115	56%	0.561	53%	0.532	S	S	*	.	H	α-helix	trans	-64.6	-47.6	175.8	-176.7	-91.2	0	0	0	110.8	Q54 F55 R56 K61 H62	Q54-Y58 WeakPolarHBondContact O-CB 3.44Å; Q54-Y58 PolarHBondContact O-N 3.42Å; F55-Y58 WeakPolarHBondContact O-CB 3.38Å; F55-Y58 PolarHBondContact O-N 2.93Å; F55-Y58 VanDerWaalsContact O-N 3.14Å; R56-Y58 VanDerWaalsContact C-N 3.35Å; Y58-K61 PolarHBondContact O-N 3.38Å; Y58-H62 AromaticContact CD2-CE1 3.45Å; Y58-H62 VanDerWaalsContact CD2-CE1 3.45Å; Y58-H62 WeakPolarHBondContact CD2-CE1 3.42Å; Y58-H62 AromaticContact CD2-ND1 3.76Å; Y58-H62 AromaticContact CE1-CG 3.99Å; Y58-H62 AromaticContact CE1-ND1 3.99Å; Y58-H62 AromaticContact CE2-CE1 3.15Å; Y58-H62 WeakPolarHBondContact CE2-CE1 3.43Å; Y58-H62 AromaticContact CE2-ND1 3.71Å; Y58-H62 AromaticContact CE2-NE2 3.4Å; Y58-H62 WeakPolarHBondContact CE2-NE2 3.3Å; Y58-H62 AromaticContact CG-ND1 3.93Å; Y58-H62 AromaticContact CZ-CD2 3.72Å; Y58-H62 AromaticContact CZ-CE1 3.57Å; Y58-H62 AromaticContact CZ-CG 3.92Å; Y58-H62 AromaticContact CZ-ND1 3.82Å; Y58-H62 AromaticContact CZ-NE2 3.5Å; Y58-H62 PolarHBondContact O-N 3.45Å; Y58-H62 PolarHBondContact O-ND1 3.3Å
59	E	88.7	Confident	88.7	Confident	86 Å²	86	110.6 Å²	110.6	40%	0.402	52%	0.521	S	S	.	.	H	α-helix	trans	-56	-53.4	175.9	-172.8	179.9	-161.1	0	0	110.7	F55 R56 K61 H62 L63	F55-E59 WeakPolarHBondContact O-CB 3.3Å; F55-E59 PolarHBondContact O-N 3.39Å; R56-E59 PolarHBondContact O-N 2.89Å; E59-K61 VanDerWaalsContact C-N 3.3Å; E59-K61 PolarHBondContact O-N 3.46Å; E59-H62 PolarHBondContact O-N 3.1Å; E59-H62 VanDerWaalsContact O-N 3.1Å; E59-L63 HydrophobicContact CG-CD1 3.92Å; E59-L63 WeakPolarHBondContact O-CB 3.48Å; E59-L63 PolarHBondContact O-N 3.26Å
60	A	87.3	Confident	88.3	Confident	73 Å²	73	107.4 Å²	107.4	60%	0.603	52%	0.515	S	S	*	.	H	α-helix	trans	-57.2	-40.4	179.5	0	0	0	0	0	113.1	R56	R56-A60 VanDerWaalsContact O-CB 3.31Å; R56-A60 WeakPolarHBondContact O-CB 3.47Å; R56-A60 PolarHBondContact O-N 3.26Å
61	K	86.2	Confident	88.1	Confident	149 Å²	149	107.3 Å²	107.3	65%	0.648	52%	0.515	S	S	*	.	H	α-helix	trans	-67.5	-36.4	177.6	-75.8	173.5	179.7	177.8	0	112.9	Q57 Y58 E59	Q57-K61 WeakPolarHBondContact O-CB 3.39Å; Q57-K61 VanDerWaalsContact O-CG 3.3Å; Q57-K61 WeakPolarHBondContact O-CG 3.43Å; Q57-K61 PolarHBondContact O-N 2.77Å; Q57-K61 VanDerWaalsContact O-N 3.12Å; Y58-K61 PolarHBondContact O-N 3.38Å; E59-K61 VanDerWaalsContact C-N 3.3Å; E59-K61 PolarHBondContact O-N 3.46Å
62	H	82.7	Confident	87.9	Confident	96 Å²	96	109.7 Å²	109.7	44%	0.444	52%	0.524	S	S	.	.	H	α-helix	trans	-95.2	-29.4	-172	-67.3	67.2	0	0	0	112.8	Y58 E59 S65 R66	Y58-H62 AromaticContact CD2-CE1 3.45Å; Y58-H62 VanDerWaalsContact CD2-CE1 3.45Å; Y58-H62 WeakPolarHBondContact CD2-CE1 3.42Å; Y58-H62 AromaticContact CD2-ND1 3.76Å; Y58-H62 AromaticContact CE1-CG 3.99Å; Y58-H62 AromaticContact CE1-ND1 3.99Å; Y58-H62 AromaticContact CE2-CE1 3.15Å; Y58-H62 WeakPolarHBondContact CE2-CE1 3.43Å; Y58-H62 AromaticContact CE2-ND1 3.71Å; Y58-H62 AromaticContact CE2-NE2 3.4Å; Y58-H62 WeakPolarHBondContact CE2-NE2 3.3Å; Y58-H62 AromaticContact CG-ND1 3.93Å; Y58-H62 AromaticContact CZ-CD2 3.72Å; Y58-H62 AromaticContact CZ-CE1 3.57Å; Y58-H62 AromaticContact CZ-CG 3.92Å; Y58-H62 AromaticContact CZ-ND1 3.82Å; Y58-H62 AromaticContact CZ-NE2 3.5Å; Y58-H62 PolarHBondContact O-N 3.45Å; Y58-H62 PolarHBondContact O-ND1 3.3Å; E59-H62 PolarHBondContact O-N 3.1Å; E59-H62 VanDerWaalsContact O-N 3.1Å; H62-S65 PolarHBondContact O-N 2.79Å; H62-R66 PolarHBondContact O-N 3.12Å
63	L	77.4	Confident	87.8	Confident	121 Å²	121	110.9 Å²	110.9	63%	0.634	53%	0.532	S	S	*	.	H	α-helix	trans	-66	-44.2	176.6	-128.2	92.4	0	0	0	111.2	E59 S65 R66	E59-L63 HydrophobicContact CG-CD1 3.92Å; E59-L63 WeakPolarHBondContact O-CB 3.48Å; E59-L63 PolarHBondContact O-N 3.26Å; L63-S65 VanDerWaalsContact C-N 3.32Å; L63-S65 PolarHBondContact O-N 3.49Å; L63-R66 PolarHBondContact O-N 2.97Å
64	G	73.5	Confident	87.7	Confident	33 Å²	33	112.1 Å²	112.1	34%	0.34	54%	0.538	S	S	.	.	H	α-helix	trans	-63.7	-38.7	176.3	0	0	0	0	0	112.4	R66 Q67 D68	G64-R66 PolarHBondContact O-N 3.26Å; G64-R66 VanDerWaalsContact O-N 3.16Å; G64-Q67 PolarHBondContact O-N 2.93Å; G64-Q67 VanDerWaalsContact O-N 3.13Å; G64-D68 PolarHBondContact O-N 3.3Å
65	S	77	Confident	87.8	Confident	48 Å²	48	113.4 Å²	113.4	34%	0.336	54%	0.544	S	S	.	.	H	α-helix	trans	-60.1	-30.2	-179.1	-179.7	0	0	0	0	113.5	H62 L63 Q67 D68 I69	H62-S65 PolarHBondContact O-N 2.79Å; L63-S65 VanDerWaalsContact C-N 3.32Å; L63-S65 PolarHBondContact O-N 3.49Å; S65-Q67 VanDerWaalsContact C-N 3.34Å; S65-Q67 PolarHBondContact O-N 2.87Å; S65-D68 PolarHBondContact O-N 3.5Å; S65-I69 WeakPolarHBondContact O-CB 3.35Å; S65-I69 WeakPolarHBondContact O-CD1 3.29Å; S65-I69 WeakPolarHBondContact O-CG1 3.31Å; S65-I69 PolarHBondContact O-N 3.49Å; S65-I69 WeakPolarHBondContact OG-CD1 3.4Å
66	R	79.1	Confident	87.9	Confident	206 Å²	206	111.8 Å²	111.8	78%	0.777	54%	0.541	S	S	*	.	H	α-helix	trans	-64	-39.7	178.3	-175.2	176.7	175.2	177.2	-1.3	112.2	H62 L63 G64 A70	H62-R66 PolarHBondContact O-N 3.12Å; L63-R66 PolarHBondContact O-N 2.97Å; G64-R66 PolarHBondContact O-N 3.26Å; G64-R66 VanDerWaalsContact O-N 3.16Å; R66-A70 WeakPolarHBondContact O-CB 3.17Å; R66-A70 PolarHBondContact O-N 3.48Å
67	Q	83	Confident	88	Confident	140 Å²	140	106.8 Å²	106.8	65%	0.654	53%	0.532	S	S	*	.	H	α-helix	trans	-69.5	-43.6	177.2	-71.5	-178.8	-15.4	0	0	110.7	G64 S65 I69 A70 Q71	G64-Q67 PolarHBondContact O-N 2.93Å; G64-Q67 VanDerWaalsContact O-N 3.13Å; S65-Q67 VanDerWaalsContact C-N 3.34Å; S65-Q67 PolarHBondContact O-N 2.87Å; Q67-I69 VanDerWaalsContact C-N 3.32Å; Q67-I69 PolarHBondContact O-N 2.88Å; Q67-A70 PolarHBondContact O-N 3.42Å; Q67-Q71 WeakPolarHBondContact O-CG 3.41Å; Q67-Q71 PolarHBondContact O-N 3.3Å
68	D	85.7	Confident	88.2	Confident	92 Å²	92	103.7 Å²	103.7	49%	0.492	53%	0.526	S	S	.	.	H	α-helix	trans	-60.4	-41.8	177.1	-63	-22.5	0	0	0	112	G64 S65 R72	G64-D68 PolarHBondContact O-N 3.3Å; S65-D68 PolarHBondContact O-N 3.5Å; D68-R72 WeakPolarHBondContact O-CB 3.18Å; D68-R72 WeakPolarHBondContact O-CG 3.31Å; D68-R72 PolarHBondContact O-N 3.19Å
69	I	86.7	Confident	88.6	Confident	89 Å²	89	102.1 Å²	102.1	46%	0.456	53%	0.525	S	S	.	.	H	α-helix	trans	-65.3	-44.6	176.4	-68.9	164.3	0	0	0	110.4	S65 Q67 Q71 R72 I73	S65-I69 WeakPolarHBondContact O-CB 3.35Å; S65-I69 WeakPolarHBondContact O-CD1 3.29Å; S65-I69 WeakPolarHBondContact O-CG1 3.31Å; S65-I69 PolarHBondContact O-N 3.49Å; S65-I69 WeakPolarHBondContact OG-CD1 3.4Å; Q67-I69 VanDerWaalsContact C-N 3.32Å; Q67-I69 PolarHBondContact O-N 2.88Å; I69-Q71 PolarHBondContact O-N 3.39Å; I69-R72 PolarHBondContact O-N 3.37Å; I69-I73 HydrophobicContact CG2-CD1 3.77Å; I69-I73 HydrophobicContact CG2-CG1 4.39Å; I69-I73 VanDerWaalsContact O-CG1 3.29Å; I69-I73 WeakPolarHBondContact O-CG1 3.42Å; I69-I73 PolarHBondContact O-N 3.45Å
70	A	90.4	Very high	89	Confident	53 Å²	53	104.7 Å²	104.7	44%	0.438	54%	0.535	S	S	.	.	H	α-helix	trans	-60.9	-45	178	0	0	0	0	0	111.6	R66 Q67 R72 I73 E74	R66-A70 WeakPolarHBondContact O-CB 3.17Å; R66-A70 PolarHBondContact O-N 3.48Å; Q67-A70 PolarHBondContact O-N 3.42Å; A70-R72 PolarHBondContact O-N 3.04Å; A70-I73 PolarHBondContact O-N 3.16Å; A70-E74 WeakPolarHBondContact O-CB 3.34Å; A70-E74 PolarHBondContact O-N 3.43Å
71	Q	92.1	Very high	89.5	Confident	111 Å²	111	104.8 Å²	104.8	52%	0.519	53%	0.528	S	S	.	.	H	α-helix	trans	-62	-41.9	176	-73.8	-176.7	-11.9	0	0	112.2	Q67 I69 E74 Q75	Q67-Q71 WeakPolarHBondContact O-CG 3.41Å; Q67-Q71 PolarHBondContact O-N 3.3Å; I69-Q71 PolarHBondContact O-N 3.39Å; Q71-E74 PolarHBondContact O-N 3.06Å; Q71-Q75 WeakPolarHBondContact O-CB 3.49Å; Q71-Q75 VanDerWaalsContact O-CG 3.3Å; Q71-Q75 WeakPolarHBondContact O-CG 3.23Å; Q71-Q75 PolarHBondContact O-N 3.4Å
72	R	92.9	Very high	90	Very high	179 Å²	179	103 Å²	103	68%	0.675	52%	0.521	S	S	*	.	H	α-helix	trans	-62.1	-43.9	174.8	-77.1	179.6	179.5	-164.5	0.7	112.2	D68 I69 A70 E74 Q75 D76	D68-R72 WeakPolarHBondContact O-CB 3.18Å; D68-R72 WeakPolarHBondContact O-CG 3.31Å; D68-R72 PolarHBondContact O-N 3.19Å; I69-R72 PolarHBondContact O-N 3.37Å; A70-R72 PolarHBondContact O-N 3.04Å; R72-E74 VanDerWaalsContact C-N 3.31Å; R72-E74 PolarHBondContact O-N 3.3Å; R72-Q75 PolarHBondContact O-N 3.13Å; R72-D76 WeakPolarHBondContact O-CB 3.47Å; R72-D76 PolarHBondContact O-N 3.36Å
73	I	95.3	Very high	90.7	Very high	110 Å²	110	103.3 Å²	103.3	56%	0.564	53%	0.526	S	S	*	.	H	α-helix	trans	-61.6	-42.4	176.7	-69.4	167.9	0	0	0	110.5	I69 A70 D76 A77	I69-I73 HydrophobicContact CG2-CD1 3.77Å; I69-I73 HydrophobicContact CG2-CG1 4.39Å; I69-I73 VanDerWaalsContact O-CG1 3.29Å; I69-I73 WeakPolarHBondContact O-CG1 3.42Å; I69-I73 PolarHBondContact O-N 3.45Å; A70-I73 PolarHBondContact O-N 3.16Å; I73-D76 PolarHBondContact O-N 2.85Å; I73-A77 VanDerWaalsContact O-CB 3.23Å; I73-A77 WeakPolarHBondContact O-CB 3.37Å; I73-A77 PolarHBondContact O-N 2.9Å
74	E	96.2	Very high	91.6	Very high	143 Å²	143	102.9 Å²	102.9	67%	0.668	52%	0.524	S	S	*	.	H	α-helix	trans	-65.2	-43.2	178.5	-170.5	172.7	-167.3	0	0	111.9	A70 Q71 R72 A77 A78	A70-E74 WeakPolarHBondContact O-CB 3.34Å; A70-E74 PolarHBondContact O-N 3.43Å; Q71-E74 PolarHBondContact O-N 3.06Å; R72-E74 VanDerWaalsContact C-N 3.31Å; R72-E74 PolarHBondContact O-N 3.3Å; E74-A77 PolarHBondContact O-N 3.46Å; E74-A78 WeakPolarHBondContact O-CB 3.09Å; E74-A78 PolarHBondContact O-N 3.46Å
75	Q	96.7	Very high	92.7	Very high	125 Å²	125	107.2 Å²	107.2	58%	0.584	54%	0.535	S	S	*	.	H	α-helix	trans	-61.5	-47.4	174.2	-73.3	174.5	-3.2	0	0	111.9	Q71 R72 A77 A78 M79	Q71-Q75 WeakPolarHBondContact O-CB 3.49Å; Q71-Q75 VanDerWaalsContact O-CG 3.3Å; Q71-Q75 WeakPolarHBondContact O-CG 3.23Å; Q71-Q75 PolarHBondContact O-N 3.4Å; R72-Q75 PolarHBondContact O-N 3.13Å; Q75-A77 VanDerWaalsContact C-N 3.33Å; Q75-A77 PolarHBondContact O-N 3.37Å; Q75-A78 PolarHBondContact O-N 3.45Å; Q75-M79 WeakPolarHBondContact O-CG 3.35Å; Q75-M79 PolarHBondContact O-N 3.27Å
76	D	96.9	Very high	93.7	Very high	84 Å²	84	110.5 Å²	110.5	45%	0.449	55%	0.545	S	S	.	.	H	α-helix	trans	-62.9	-39.7	177.1	-81.9	-5.6	0	0	0	111.9	R72 I73 M79 K80	R72-D76 WeakPolarHBondContact O-CB 3.47Å; R72-D76 PolarHBondContact O-N 3.36Å; I73-D76 PolarHBondContact O-N 2.85Å; D76-M79 WeakPolarHBondContact OD1-CE 3.43Å; D76-K80 WeakPolarHBondContact O-CB 3.46Å; D76-K80 VanDerWaalsContact O-CG 3.31Å; D76-K80 WeakPolarHBondContact O-CG 3.47Å; D76-K80 PolarHBondContact O-N 2.93Å
77	A	96.9	Very high	94.5	Very high	48 Å²	48	103.8 Å²	103.8	40%	0.397	53%	0.527	S	S	.	.	H	α-helix	trans	-64.3	-46.3	175.6	0	0	0	0	0	111.1	I73 E74 Q75 M79 K80 V81	I73-A77 VanDerWaalsContact O-CB 3.23Å; I73-A77 WeakPolarHBondContact O-CB 3.37Å; I73-A77 PolarHBondContact O-N 2.9Å; E74-A77 PolarHBondContact O-N 3.46Å; Q75-A77 VanDerWaalsContact C-N 3.33Å; Q75-A77 PolarHBondContact O-N 3.37Å; A77-M79 PolarHBondContact O-N 3.48Å; A77-K80 PolarHBondContact O-N 2.9Å; A77-V81 WeakPolarHBondContact O-CG2 3.3Å; A77-V81 PolarHBondContact O-N 3.18Å
78	A	97.3	Very high	95.1	Very high	49 Å²	49	101.5 Å²	101.5	41%	0.405	52%	0.523	S	S	.	.	H	α-helix	trans	-59.8	-44.6	177.2	0	0	0	0	0	111.8	E74 Q75 K80 V81 Q82	E74-A78 WeakPolarHBondContact O-CB 3.09Å; E74-A78 PolarHBondContact O-N 3.46Å; Q75-A78 PolarHBondContact O-N 3.45Å; A78-K80 PolarHBondContact O-N 2.89Å; A78-V81 PolarHBondContact O-N 2.76Å; A78-Q82 WeakPolarHBondContact O-CG 3.37Å; A78-Q82 PolarHBondContact O-N 2.96Å
79	M	97.6	Very high	95.6	Very high	109 Å²	109	101 Å²	101	54%	0.537	53%	0.527	S	S	.	.	H	α-helix	trans	-61.1	-43.2	175.1	-72.7	-169.9	-67.4	0	0	112.1	Q75 D76 A77 Q82 L83	Q75-M79 WeakPolarHBondContact O-CG 3.35Å; Q75-M79 PolarHBondContact O-N 3.27Å; D76-M79 WeakPolarHBondContact OD1-CE 3.43Å; A77-M79 PolarHBondContact O-N 3.48Å; M79-Q82 PolarHBondContact O-N 2.96Å; M79-L83 PolarHBondContact O-N 3.31Å
80	K	97.4	Very high	96.1	Very high	141 Å²	141	102.9 Å²	102.9	61%	0.613	54%	0.537	S	S	*	.	H	α-helix	trans	-65.1	-39.8	177.5	-76.2	176.2	-178	175.2	0	112.5	D76 A77 A78 L83 L84	D76-K80 WeakPolarHBondContact O-CB 3.46Å; D76-K80 VanDerWaalsContact O-CG 3.31Å; D76-K80 WeakPolarHBondContact O-CG 3.47Å; D76-K80 PolarHBondContact O-N 2.93Å; A77-K80 PolarHBondContact O-N 2.9Å; A78-K80 PolarHBondContact O-N 2.89Å; K80-L83 PolarHBondContact O-N 2.67Å; K80-L84 WeakPolarHBondContact O-CG 3.32Å; K80-L84 PolarHBondContact O-N 3.15Å
81	V	97.4	Very high	96.3	Very high	74 Å²	74	103.5 Å²	103.5	45%	0.448	53%	0.533	S	S	.	.	H	α-helix	trans	-62.2	-46.5	175.5	170.8	0	0	0	0	110.2	A77 A78 L83 L84 E85	A77-V81 WeakPolarHBondContact O-CG2 3.3Å; A77-V81 PolarHBondContact O-N 3.18Å; A78-V81 PolarHBondContact O-N 2.76Å; V81-L83 VanDerWaalsContact C-N 3.33Å; V81-L83 PolarHBondContact O-N 3.49Å; V81-L84 WeakPolarHBondContact O-CB 3.13Å; V81-L84 PolarHBondContact O-N 3.38Å; V81-L84 VanDerWaalsContact O-N 3.15Å; V81-E85 HydrophobicContact CG1-CG 4.46Å; V81-E85 WeakPolarHBondContact O-CG 3.4Å; V81-E85 PolarHBondContact O-N 3Å
82	Q	97.5	Very high	96.5	Very high	111 Å²	111	104.4 Å²	104.4	52%	0.519	54%	0.535	S	S	.	.	H	α-helix	trans	-60	-42.2	176.9	-72.4	177.1	0.4	0	0	112.4	A78 M79 L84 E85 Q86	A78-Q82 WeakPolarHBondContact O-CG 3.37Å; A78-Q82 PolarHBondContact O-N 2.96Å; M79-Q82 PolarHBondContact O-N 2.96Å; Q82-L84 VanDerWaalsContact C-N 3.34Å; Q82-L84 PolarHBondContact O-N 3.33Å; Q82-E85 PolarHBondContact O-N 3.47Å; Q82-Q86 WeakPolarHBondContact O-CG 3.48Å; Q82-Q86 PolarHBondContact O-N 3.38Å
83	L	97.1	Very high	96.6	Very high	104 Å²	104	101.1 Å²	101.1	55%	0.545	53%	0.527	S	S	.	.	H	α-helix	trans	-63.5	-40.6	176.1	-178.9	64.3	0	0	0	112	M79 K80 V81 Q86 T87	M79-L83 PolarHBondContact O-N 3.31Å; K80-L83 PolarHBondContact O-N 2.67Å; V81-L83 VanDerWaalsContact C-N 3.33Å; V81-L83 PolarHBondContact O-N 3.49Å; L83-Q86 PolarHBondContact O-N 3Å; L83-T87 WeakPolarHBondContact O-CB 3.25Å; L83-T87 PolarHBondContact O-N 3.3Å; L83-T87 PolarHBondContact O-OG1 2.97Å
84	L	96.8	Very high	96.7	Very high	112 Å²	112	102.5 Å²	102.5	59%	0.586	53%	0.529	S	S	*	.	H	α-helix	trans	-63.3	-45	175.3	-76.3	169.3	0	0	0	111.2	K80 V81 Q82 Q86 T87 V88	K80-L84 WeakPolarHBondContact O-CG 3.32Å; K80-L84 PolarHBondContact O-N 3.15Å; V81-L84 WeakPolarHBondContact O-CB 3.13Å; V81-L84 PolarHBondContact O-N 3.38Å; V81-L84 VanDerWaalsContact O-N 3.15Å; Q82-L84 VanDerWaalsContact C-N 3.34Å; Q82-L84 PolarHBondContact O-N 3.33Å; L84-Q86 VanDerWaalsContact C-N 3.33Å; L84-Q86 PolarHBondContact O-N 2.89Å; L84-T87 PolarHBondContact O-N 3.3Å; L84-T87 VanDerWaalsContact O-N 3.16Å; L84-V88 WeakPolarHBondContact O-CB 3.28Å; L84-V88 VanDerWaalsContact O-CG2 3.3Å; L84-V88 WeakPolarHBondContact O-CG2 3.42Å; L84-V88 PolarHBondContact O-N 2.86Å
85	E	97.1	Very high	96.7	Very high	124 Å²	124	99.4 Å²	99.4	58%	0.579	52%	0.52	S	S	*	.	H	α-helix	trans	-60.1	-42.3	177.2	-73.7	177.8	168.3	0	0	112.2	V81 Q82 V88 S89	V81-E85 HydrophobicContact CG1-CG 4.46Å; V81-E85 WeakPolarHBondContact O-CG 3.4Å; V81-E85 PolarHBondContact O-N 3Å; Q82-E85 PolarHBondContact O-N 3.47Å; E85-V88 PolarHBondContact O-N 2.98Å; E85-S89 WeakPolarHBondContact O-CB 3.38Å; E85-S89 PolarHBondContact O-N 3.43Å; E85-S89 PolarHBondContact O-OG 3.2Å
86	Q	97.1	Very high	96.7	Very high	116 Å²	116	96.5 Å²	96.5	54%	0.542	51%	0.508	S	S	.	.	H	α-helix	trans	-63.1	-43.6	173.6	-70.6	175.3	9.4	0	0	111.7	Q82 L83 L84 V88 S89 L90	Q82-Q86 WeakPolarHBondContact O-CG 3.48Å; Q82-Q86 PolarHBondContact O-N 3.38Å; L83-Q86 PolarHBondContact O-N 3Å; L84-Q86 VanDerWaalsContact C-N 3.33Å; L84-Q86 PolarHBondContact O-N 2.89Å; Q86-V88 VanDerWaalsContact C-N 3.33Å; Q86-V88 PolarHBondContact O-N 2.81Å; Q86-S89 PolarHBondContact O-N 3.44Å; Q86-S89 PolarHBondContact O-OG 3.45Å; Q86-L90 WeakPolarHBondContact O-CB 3.36Å; Q86-L90 VanDerWaalsContact O-CG 3.25Å; Q86-L90 WeakPolarHBondContact O-CG 3.46Å; Q86-L90 PolarHBondContact O-N 2.94Å
87	T	96.6	Very high	96.6	Very high	65 Å²	65	97.8 Å²	97.8	40%	0.399	51%	0.511	S	S	.	.	H	α-helix	trans	-65.3	-39.2	179.1	-56.2	0	0	0	0	111.7	L83 L84 N91	L83-T87 WeakPolarHBondContact O-CB 3.25Å; L83-T87 PolarHBondContact O-N 3.3Å; L83-T87 PolarHBondContact O-OG1 2.97Å; L84-T87 PolarHBondContact O-N 3.3Å; L84-T87 VanDerWaalsContact O-N 3.16Å; T87-N91 WeakPolarHBondContact O-CB 3.46Å; T87-N91 PolarHBondContact O-N 3.01Å; T87-N91 PolarHBondContact O-ND2 3.46Å
88	V	96.4	Very high	96.5	Very high	93 Å²	93	100.8 Å²	100.8	56%	0.564	52%	0.52	S	S	*	.	H	α-helix	trans	-65.7	-48.6	175.1	170	0	0	0	0	110	L84 E85 Q86 L90 N91 K92	L84-V88 WeakPolarHBondContact O-CB 3.28Å; L84-V88 VanDerWaalsContact O-CG2 3.3Å; L84-V88 WeakPolarHBondContact O-CG2 3.42Å; L84-V88 PolarHBondContact O-N 2.86Å; E85-V88 PolarHBondContact O-N 2.98Å; Q86-V88 VanDerWaalsContact C-N 3.33Å; Q86-V88 PolarHBondContact O-N 2.81Å; V88-L90 VanDerWaalsContact C-N 3.3Å; V88-L90 PolarHBondContact O-N 2.96Å; V88-N91 PolarHBondContact O-N 3.45Å; V88-K92 WeakPolarHBondContact O-CA 3.34Å; V88-K92 WeakPolarHBondContact O-CB 3.41Å; V88-K92 PolarHBondContact O-N 2.98Å
89	S	95.7	Very high	96.5	Very high	82 Å²	82	103.5 Å²	103.5	57%	0.573	53%	0.527	S	S	*	.	H	α-helix	trans	-61	-39.2	-178.3	68.5	0	0	0	0	112.5	E85 Q86 N91	E85-S89 WeakPolarHBondContact O-CB 3.38Å; E85-S89 PolarHBondContact O-N 3.43Å; E85-S89 PolarHBondContact O-OG 3.2Å; Q86-S89 PolarHBondContact O-N 3.44Å; Q86-S89 PolarHBondContact O-OG 3.45Å; S89-N91 PolarHBondContact O-N 3.27Å
90	L	96.2	Very high	96.4	Very high	127 Å²	127	103.4 Å²	103.4	67%	0.665	53%	0.528	S	S	*	.	H	α-helix	trans	-66.4	-34.1	177.2	-71.9	171.7	0	0	0	113.8	Q86 V88	Q86-L90 WeakPolarHBondContact O-CB 3.36Å; Q86-L90 VanDerWaalsContact O-CG 3.25Å; Q86-L90 WeakPolarHBondContact O-CG 3.46Å; Q86-L90 PolarHBondContact O-N 2.94Å; V88-L90 VanDerWaalsContact C-N 3.3Å; V88-L90 PolarHBondContact O-N 2.96Å
91	N	96.1	Very high	96.2	Very high	66 Å²	66	103.3 Å²	103.3	35%	0.353	53%	0.53	S	S	.	.	H	α-helix	trans	-104.5	-13.9	-172.8	-66.5	-50.2	0	0	0	114	T87 V88 S89 E93 K94 V95	T87-N91 WeakPolarHBondContact O-CB 3.46Å; T87-N91 PolarHBondContact O-N 3.01Å; T87-N91 PolarHBondContact O-ND2 3.46Å; V88-N91 PolarHBondContact O-N 3.45Å; S89-N91 PolarHBondContact O-N 3.27Å; N91-E93 VanDerWaalsContact C-N 3.34Å; N91-E93 PolarHBondContact O-N 2.89Å; N91-K94 PolarHBondContact O-N 3.37Å; N91-V95 WeakPolarHBondContact O-CG2 3.18Å; N91-V95 PolarHBondContact O-N 3.47Å
92	K	95.8	Very high	96	Very high	130 Å²	130	103.6 Å²	103.6	57%	0.565	54%	0.535	S	S	*	.	H	α-helix	trans	-49.5	-52.6	-175.6	178.6	177.7	179	-175.7	0	112.2	V88 K94 V95 I96	V88-K92 WeakPolarHBondContact O-CA 3.34Å; V88-K92 WeakPolarHBondContact O-CB 3.41Å; V88-K92 PolarHBondContact O-N 2.98Å; K92-K94 PolarHBondContact O-N 3.04Å; K92-V95 PolarHBondContact O-N 3.02Å; K92-I96 HydrophobicContact CG-CD1 3.76Å; K92-I96 VanDerWaalsContact O-CG1 3.29Å; K92-I96 WeakPolarHBondContact O-CG1 3.44Å; K92-I96 PolarHBondContact O-N 3.3Å
93	E	95.2	Very high	95.8	Very high	110 Å²	110	103.7 Å²	103.7	51%	0.514	54%	0.543	S	S	.	.	H	α-helix	trans	-65.9	-41.3	-175.3	-169.9	57.3	-153	0	0	112.2	N91 V95 I96 Q97	N91-E93 VanDerWaalsContact C-N 3.34Å; N91-E93 PolarHBondContact O-N 2.89Å; E93-V95 VanDerWaalsContact C-N 3.32Å; E93-V95 PolarHBondContact O-N 3.41Å; E93-I96 PolarHBondContact O-N 3.28Å; E93-Q97 WeakPolarHBondContact O-CG 3.46Å; E93-Q97 PolarHBondContact O-N 3.43Å; E93-Q97 PolarHBondContact OE1-NE2 3.18Å; E93-Q97 VanDerWaalsContact OE1-NE2 3.09Å
94	K	95.9	Very high	95.6	Very high	140 Å²	140	103.4 Å²	103.4	61%	0.609	55%	0.549	S	S	*	.	H	α-helix	trans	-61.1	-42.7	176.9	-63	177	-176.9	170.3	0	111.5	N91 K92 L98	N91-K94 PolarHBondContact O-N 3.37Å; K92-K94 PolarHBondContact O-N 3.04Å; K94-L98 WeakPolarHBondContact O-CB 3.47Å; K94-L98 PolarHBondContact O-N 3.26Å
95	V	96.8	Very high	95.4	Very high	77 Å²	77	102 Å²	102	47%	0.467	54%	0.541	S	S	.	.	H	α-helix	trans	-68.8	-40.9	179.3	175.8	0	0	0	0	111	N91 K92 E93 L98 L99	N91-V95 WeakPolarHBondContact O-CG2 3.18Å; N91-V95 PolarHBondContact O-N 3.47Å; K92-V95 PolarHBondContact O-N 3.02Å; E93-V95 VanDerWaalsContact C-N 3.32Å; E93-V95 PolarHBondContact O-N 3.41Å; V95-L98 PolarHBondContact O-N 3.48Å; V95-L99 HydrophobicContact CG1-CD1 3.97Å; V95-L99 WeakPolarHBondContact O-CB 3.39Å; V95-L99 WeakPolarHBondContact O-CG 3.49Å; V95-L99 PolarHBondContact O-N 3.35Å
96	I	96.2	Very high	95	Very high	65 Å²	65	101.6 Å²	101.6	33%	0.333	55%	0.547	S	S	.	.	H	α-helix	trans	-60.8	-47.8	175.7	-70.9	169.3	0	0	0	110.6	K92 E93 L98 L99 L100	K92-I96 HydrophobicContact CG-CD1 3.76Å; K92-I96 VanDerWaalsContact O-CG1 3.29Å; K92-I96 WeakPolarHBondContact O-CG1 3.44Å; K92-I96 PolarHBondContact O-N 3.3Å; E93-I96 PolarHBondContact O-N 3.28Å; I96-L98 PolarHBondContact O-N 3.33Å; I96-L99 PolarHBondContact O-N 2.88Å; I96-L100 HydrophobicContact CG2-CD1 3.84Å; I96-L100 HydrophobicContact CG2-CG 4.32Å; I96-L100 WeakPolarHBondContact O-CB 3.43Å; I96-L100 WeakPolarHBondContact O-CG 3.48Å; I96-L100 PolarHBondContact O-N 3.45Å
97	Q	95.5	Very high	94.6	Very high	110 Å²	110	103 Å²	103	51%	0.514	55%	0.552	S	S	.	*	H	α-helix	trans	-62.4	-43.3	179.5	-71.5	175.2	5.3	0	0	112	E93 L99 L100 Q101	E93-Q97 WeakPolarHBondContact O-CG 3.46Å; E93-Q97 PolarHBondContact O-N 3.43Å; E93-Q97 PolarHBondContact OE1-NE2 3.18Å; E93-Q97 VanDerWaalsContact OE1-NE2 3.09Å; Q97-L99 VanDerWaalsContact C-N 3.35Å; Q97-L99 PolarHBondContact O-N 3.19Å; Q97-L100 PolarHBondContact O-N 3.27Å; Q97-Q101 WeakPolarHBondContact O-CB 3.3Å; Q97-Q101 PolarHBondContact O-N 2.79Å
98	L	95.9	Very high	94.1	Very high	111 Å²	111	105.6 Å²	105.6	58%	0.581	57%	0.57	S	S	*	*	H	α-helix	trans	-60.2	-43.9	176	-177.3	69.7	0	0	0	112	K94 V95 I96 S102	K94-L98 WeakPolarHBondContact O-CB 3.47Å; K94-L98 PolarHBondContact O-N 3.26Å; V95-L98 PolarHBondContact O-N 3.48Å; I96-L98 PolarHBondContact O-N 3.33Å; L98-S102 WeakPolarHBondContact O-CB 3.35Å; L98-S102 PolarHBondContact O-N 2.93Å; L98-S102 PolarHBondContact O-OG 3.43Å
99	L	95.5	Very high	93.7	Very high	107 Å²	107	107.2 Å²	107.2	56%	0.56	58%	0.58	S	S	*	*	H	α-helix	trans	-63.5	-48.4	176.8	-81.6	163.8	0	0	0	111.4	V95 I96 Q97 Q101 S102 V103	V95-L99 HydrophobicContact CG1-CD1 3.97Å; V95-L99 WeakPolarHBondContact O-CB 3.39Å; V95-L99 WeakPolarHBondContact O-CG 3.49Å; V95-L99 PolarHBondContact O-N 3.35Å; I96-L99 PolarHBondContact O-N 2.88Å; Q97-L99 VanDerWaalsContact C-N 3.35Å; Q97-L99 PolarHBondContact O-N 3.19Å; L99-Q101 PolarHBondContact O-N 3.44Å; L99-S102 PolarHBondContact O-N 3.04Å; L99-V103 VanDerWaalsContact O-CG2 3.28Å; L99-V103 WeakPolarHBondContact O-CG2 3.38Å; L99-V103 PolarHBondContact O-N 3.46Å
100	L	95.6	Very high	93.3	Very high	107 Å²	107	108.2 Å²	108.2	56%	0.56	58%	0.582	S	S	*	*	H	α-helix	trans	-61.5	-45	179	-72.3	174.6	0	0	0	111.7	I96 Q97 S102 V103 C104	I96-L100 HydrophobicContact CG2-CD1 3.84Å; I96-L100 HydrophobicContact CG2-CG 4.32Å; I96-L100 WeakPolarHBondContact O-CB 3.43Å; I96-L100 WeakPolarHBondContact O-CG 3.48Å; I96-L100 PolarHBondContact O-N 3.45Å; Q97-L100 PolarHBondContact O-N 3.27Å; L100-S102 VanDerWaalsContact C-N 3.33Å; L100-S102 PolarHBondContact O-N 3.33Å; L100-V103 PolarHBondContact O-N 3.01Å; L100-C104 WeakPolarHBondContact O-CB 3.36Å; L100-C104 PolarHBondContact O-N 3.34Å; L100-C104 PolarHBondContact O-SG 2.89Å; L100-C104 VanDerWaalsContact O-SG 3.37Å
101	Q	94.9	Very high	92.9	Very high	139 Å²	139	107.9 Å²	107.9	65%	0.65	58%	0.577	S	S	*	*	H	α-helix	trans	-60.3	-44.2	176.7	-174.2	178.3	5.2	0	0	111.4	Q97 L99 V103 C104 D105	Q97-Q101 WeakPolarHBondContact O-CB 3.3Å; Q97-Q101 PolarHBondContact O-N 2.79Å; L99-Q101 PolarHBondContact O-N 3.44Å; Q101-V103 VanDerWaalsContact C-N 3.32Å; Q101-V103 PolarHBondContact O-N 2.83Å; Q101-C104 PolarHBondContact O-N 3.16Å; Q101-D105 VanDerWaalsContact O-CB 3.25Å; Q101-D105 WeakPolarHBondContact O-CB 3.5Å; Q101-D105 PolarHBondContact O-N 2.95Å
102	S	92.4	Very high	92.7	Very high	80 Å²	80	115.3 Å²	115.3	56%	0.559	60%	0.6	S	S	*	*	H	α-helix	trans	-66.2	-33.8	179.8	-57.6	0	0	0	0	112.7	L98 L99 L100	L98-S102 WeakPolarHBondContact O-CB 3.35Å; L98-S102 PolarHBondContact O-N 2.93Å; L98-S102 PolarHBondContact O-OG 3.43Å; L99-S102 PolarHBondContact O-N 3.04Å; L100-S102 VanDerWaalsContact C-N 3.33Å; L100-S102 PolarHBondContact O-N 3.33Å
103	V	93.6	Very high	92.5	Very high	112 Å²	112	114.6 Å²	114.6	68%	0.679	60%	0.602	S	S	*	*	H	α-helix	trans	-76.6	-37.8	178.3	172.1	0	0	0	0	111.5	L99 L100 Q101	L99-V103 VanDerWaalsContact O-CG2 3.28Å; L99-V103 WeakPolarHBondContact O-CG2 3.38Å; L99-V103 PolarHBondContact O-N 3.46Å; L100-V103 PolarHBondContact O-N 3.01Å; Q101-V103 VanDerWaalsContact C-N 3.32Å; Q101-V103 PolarHBondContact O-N 2.83Å
104	C	92.7	Very high	92.2	Very high	99 Å²	99	114.2 Å²	114.2	67%	0.669	61%	0.607	S	S	*	*	H	α-helix	trans	-81.3	-20.9	-179.7	-67.4	0	0	0	0	113.9	L100 Q101 V106	L100-C104 WeakPolarHBondContact O-CB 3.36Å; L100-C104 PolarHBondContact O-N 3.34Å; L100-C104 PolarHBondContact O-SG 2.89Å; L100-C104 VanDerWaalsContact O-SG 3.37Å; Q101-C104 PolarHBondContact O-N 3.16Å; C104-V106 VanDerWaalsContact C-N 3.27Å; C104-V106 PolarHBondContact O-N 3.38Å
105	D	92.4	Very high	91.5	Very high	81 Å²	81	118 Å²	118	43%	0.433	62%	0.618	S	S	.	*			trans	-77.6	72.5	176.7	-174.7	20.9	0	0	0	111.5	Q101 K107	Q101-D105 VanDerWaalsContact O-CB 3.25Å; Q101-D105 WeakPolarHBondContact O-CB 3.5Å; Q101-D105 PolarHBondContact O-N 2.95Å; D105-K107 PolarHBondContact O-N 3Å; D105-K107 WeakPolarHBondContact OD1-CE 3.29Å; D105-K107 IonicContact OD1-NZ 3.87Å; D105-K107 WeakPolarHBondContact OD2-CE 3.25Å; D105-K107 IonicContact OD2-NZ 2.93Å; D105-K107 PolarHBondContact OD2-NZ 2.94Å
106	V	88.8	Confident	90.6	Very high	116 Å²	116	126.1 Å²	126.1	70%	0.703	64%	0.64	S	S	*	*			trans	-73.1	108.4	176.4	-176.2	0	0	0	0	109.3	C104 P108	C104-V106 VanDerWaalsContact C-N 3.27Å; C104-V106 PolarHBondContact O-N 3.38Å; V106-P108 WeakPolarHBondContact O-CD 3.33Å
107	K	87.7	Confident	89.3	Confident	146 Å²	146	131.8 Å²	131.8	64%	0.635	67%	0.665	S	S	*	*			trans	-102.2	90.9	172.2	-70	179.2	179.9	140.1	0	109.9	D105 V109	D105-K107 PolarHBondContact O-N 3Å; D105-K107 WeakPolarHBondContact OD1-CE 3.29Å; D105-K107 IonicContact OD1-NZ 3.87Å; D105-K107 WeakPolarHBondContact OD2-CE 3.25Å; D105-K107 IonicContact OD2-NZ 2.93Å; D105-K107 PolarHBondContact OD2-NZ 2.94Å; K107-V109 PolarHBondContact O-N 3.37Å
108	P	86.4	Confident	87.4	Confident	120 Å²	120	134.8 Å²	134.8	78%	0.779	71%	0.708	S	S	*	*			trans	-67.5	110.8	177.8	27.8	-32.8	0	0	0	109	V106	V106-P108 WeakPolarHBondContact O-CD 3.33Å
109	V	89.4	Confident	86.9	Confident	127 Å²	127	136 Å²	136	77%	0.77	72%	0.715	S	S	*	*			trans	-105.4	125.1	174.8	-174.8	0	0	0	0	108.2	K107 H111	K107-V109 PolarHBondContact O-N 3.37Å; V109-H111 PolarHBondContact O-N 2.94Å
110	V	86.3	Confident	86.5	Confident	103 Å²	103	137.5 Å²	137.5	62%	0.624	72%	0.723	S	S	*	*			trans	-63.7	132	172.3	-175.5	0	0	0	0	108	R112 V114	V110-R112 PolarHBondContact O-N 3.48Å; V110-V114 HydrophobicContact CG1-CB 3.52Å; V110-V114 HydrophobicContact CG1-CG1 3.77Å; V110-V114 HydrophobicContact CG1-CG2 3.5Å; V110-V114 VanDerWaalsContact CG1-CG2 3.5Å
111	H	88.8	Confident	86	Confident	119 Å²	119	139.2 Å²	139.2	55%	0.551	73%	0.732	S	S	*	*			trans	-55.2	132.9	178.9	-172.5	-91.7	0	0	0	110	V109 N113 V114	V109-H111 PolarHBondContact O-N 2.94Å; H111-N113 PolarHBondContact ND1-N 2.96Å; H111-N113 PolarHBondContact O-N 2.9Å; H111-V114 PolarHBondContact O-N 3.3Å
112	R	91.4	Very high	85.4	Confident	222 Å²	222	139.2 Å²	139.2	84%	0.838	74%	0.737	S	S	*	*	T	Hydrogen-bonded Turn	trans	-46.4	-18.2	-175.8	54.9	177.7	163.4	-166.5	-3.4	116.8	V110	V110-R112 PolarHBondContact O-N 3.48Å
113	N	91.5	Very high	85	Confident	116 Å²	116	142.9 Å²	142.9	62%	0.62	75%	0.748	S	S	*	*	T	Hydrogen-bonded Turn	trans	-105.9	8.6	-176.2	-62.8	-13.7	0	0	0	114.3	H111 R115	H111-N113 PolarHBondContact ND1-N 2.96Å; H111-N113 PolarHBondContact O-N 2.9Å; N113-R115 PolarHBondContact O-N 3.47Å
114	V	88.7	Confident	84.4	Confident	102 Å²	102	145 Å²	145	62%	0.618	75%	0.752	S	S	*	*			trans	-60.6	126.1	176.3	140.6	0	0	0	0	110.3	V110 H111	V110-V114 HydrophobicContact CG1-CB 3.52Å; V110-V114 HydrophobicContact CG1-CG1 3.77Å; V110-V114 HydrophobicContact CG1-CG2 3.5Å; V110-V114 VanDerWaalsContact CG1-CG2 3.5Å; H111-V114 PolarHBondContact O-N 3.3Å
115	R	82	Confident	83.9	Confident	220 Å²	220	148.3 Å²	148.3	83%	0.83	76%	0.758	S	S	*	*			trans	-117	126.2	172.3	-63.2	-172.2	-179.4	-159.7	-0	108.3	N113 H117	N113-R115 PolarHBondContact O-N 3.47Å; R115-H117 PolarHBondContact O-N 3.09Å
116	R	76.3	Confident	83.2	Confident	246 Å²	246	153.5 Å²	153.5	93%	0.928	78%	0.783	S	S	*	*			trans	-71	115.4	169.1	-91.6	-175.5	174.3	177	-1.7	107.6	A118	R116-A118 PolarHBondContact O-N 2.94Å
117	H	70.5	Confident	82.7	Confident	185 Å²	185	156.6 Å²	156.6	86%	0.856	79%	0.79	S	S	*	*			trans	-72.1	124.5	162.4	-83.9	-79.1	0	0	0	107.8	R115	R115-H117 PolarHBondContact O-N 3.09Å
118	A	54	Low	82.3	Confident	173 Å²	173	157.5 Å²	157.5	100%	1.43	80%	0.804	S	S	*	*			trans	-80.1	0	173.6	0	0	0	0	0	110.6	R116	R116-A118 PolarHBondContact O-N 2.94Å

Retrieved 118 of 118 residues in 157.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).