A0A077Z9U7_TRITR Loading...

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4

Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity.

AlphaFold DB , UniProt , Accession A0A077Z9U7, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 42 aa.

						>A0A077Z9U7_TRITR|A0A077Z9U7
MIADIQLAWFANMLGMVIFVLIILYHYVTASNPRRSGSRDER
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	66.3	Low	89.2	Confident	199 Å²	199	112.3 Å²	112.3	98%	0.98	59%	0.588	S	S	*	*				0	-65.2	0	-82.1	-168.1	147	0	0	113.5	A3 D4	M1-A3 PolarHBondContact O-N 2.83Å; M1-D4 WeakPolarHBondContact CA-OD2 3.13Å; M1-D4 PolarHBondContact N-OD2 3.34Å; M1-D4 PolarHBondContact O-N 3.2Å
2	I	80	Confident	89.7	Confident	130 Å²	130	111.4 Å²	111.4	67%	0.667	58%	0.584	S	S	*	*	H	α-helix	trans	-62.6	-28.7	175.9	-157.2	76.1	0	0	0	112.6	D4 I5 Q6	I2-D4 VanDerWaalsContact C-N 3.34Å; I2-D4 PolarHBondContact O-N 3.24Å; I2-I5 HydrophobicContact CD1-CG2 4.47Å; I2-I5 WeakPolarHBondContact O-CG2 3.38Å; I2-Q6 WeakPolarHBondContact O-CG 3.06Å; I2-Q6 PolarHBondContact O-N 3.02Å
3	A	89.5	Confident	90.2	Very high	57 Å²	57	109.2 Å²	109.2	47%	0.471	57%	0.571	S	S	.	*	H	α-helix	trans	-67.1	-30.9	177.9	0	0	0	0	0	113.2	M1 Q6 L7	M1-A3 PolarHBondContact O-N 2.83Å; A3-Q6 PolarHBondContact O-N 3.39Å; A3-L7 VanDerWaalsContact O-CB 3.25Å; A3-L7 WeakPolarHBondContact O-CB 3.25Å; A3-L7 PolarHBondContact O-N 3.46Å
4	D	92.4	Very high	90.6	Very high	106 Å²	106	109.1 Å²	109.1	57%	0.567	57%	0.57	S	S	*	*	H	α-helix	trans	-70.6	-40.6	-174.3	-52.2	-55.3	0	0	0	111	M1 I2 L7 A8	M1-D4 WeakPolarHBondContact CA-OD2 3.13Å; M1-D4 PolarHBondContact N-OD2 3.34Å; M1-D4 PolarHBondContact O-N 3.2Å; I2-D4 VanDerWaalsContact C-N 3.34Å; I2-D4 PolarHBondContact O-N 3.24Å; D4-L7 PolarHBondContact O-N 3.04Å; D4-A8 PolarHBondContact O-N 3.49Å
5	I	91.1	Very high	91	Very high	114 Å²	114	104.5 Å²	104.5	59%	0.585	56%	0.559	S	S	*	*	H	α-helix	trans	-70.2	-38.1	174.8	-171.4	66.4	0	0	0	111.9	I2 A8 W9	I2-I5 HydrophobicContact CD1-CG2 4.47Å; I2-I5 WeakPolarHBondContact O-CG2 3.38Å; I5-A8 PolarHBondContact O-N 2.85Å; I5-W9 PolarHBondContact O-N 3.33Å
6	Q	92.6	Very high	91.4	Very high	103 Å²	103	105.6 Å²	105.6	48%	0.481	56%	0.562	S	S	.	*	H	α-helix	trans	-64.8	-43.1	174.7	-72.1	178	7	0	0	110.9	I2 A3 A8 W9 F10	I2-Q6 WeakPolarHBondContact O-CG 3.06Å; I2-Q6 PolarHBondContact O-N 3.02Å; A3-Q6 PolarHBondContact O-N 3.39Å; Q6-A8 VanDerWaalsContact C-N 3.32Å; Q6-A8 PolarHBondContact O-N 3.44Å; Q6-W9 WeakPolarHBondContact O-CB 3.49Å; Q6-W9 PolarHBondContact O-N 3.48Å; Q6-F10 WeakPolarHBondContact O-CD2 3.43Å; Q6-F10 PolarHBondContact O-N 2.98Å
7	L	92.1	Very high	91.7	Very high	121 Å²	121	104.4 Å²	104.4	63%	0.634	56%	0.559	S	S	*	*	H	α-helix	trans	-62	-41.9	177.6	-172.7	63.7	0	0	0	111.2	A3 D4 W9 F10 A11	A3-L7 VanDerWaalsContact O-CB 3.25Å; A3-L7 WeakPolarHBondContact O-CB 3.25Å; A3-L7 PolarHBondContact O-N 3.46Å; D4-L7 PolarHBondContact O-N 3.04Å; L7-W9 VanDerWaalsContact C-N 3.34Å; L7-W9 PolarHBondContact O-N 3.29Å; L7-F10 PolarHBondContact O-N 3.46Å; L7-A11 WeakPolarHBondContact O-CB 3.22Å; L7-A11 PolarHBondContact O-N 3.17Å
8	A	93.4	Very high	92	Very high	45 Å²	45	103.2 Å²	103.2	37%	0.372	55%	0.551	S	S	.	*	H	α-helix	trans	-61.2	-42.4	174	0	0	0	0	0	112	D4 I5 Q6 A11 N12	D4-A8 PolarHBondContact O-N 3.49Å; I5-A8 PolarHBondContact O-N 2.85Å; Q6-A8 VanDerWaalsContact C-N 3.32Å; Q6-A8 PolarHBondContact O-N 3.44Å; A8-A11 PolarHBondContact O-N 3.01Å; A8-N12 WeakPolarHBondContact O-CB 3.32Å; A8-N12 PolarHBondContact O-N 2.86Å; A8-N12 PolarHBondContact O-ND2 2.82Å
9	W	94.5	Very high	92.2	Very high	163 Å²	163	104.4 Å²	104.4	62%	0.617	55%	0.552	S	S	*	*	H	α-helix	trans	-61.9	-48	174.6	178.2	-91.7	0	0	0	111.9	I5 Q6 L7 A11 N12 M13	I5-W9 PolarHBondContact O-N 3.33Å; Q6-W9 WeakPolarHBondContact O-CB 3.49Å; Q6-W9 PolarHBondContact O-N 3.48Å; L7-W9 VanDerWaalsContact C-N 3.34Å; L7-W9 PolarHBondContact O-N 3.29Å; W9-A11 VanDerWaalsContact C-N 3.35Å; W9-A11 PolarHBondContact O-N 3.45Å; W9-N12 PolarHBondContact O-N 2.9Å; W9-M13 HydrophobicContact CH2-CE 3.99Å; W9-M13 HydrophobicContact CZ2-CE 3.79Å; W9-M13 HydrophobicContact CZ2-CG 4.44Å; W9-M13 HydrophobicContact CZ2-SD 4.21Å; W9-M13 HydrophobicContact CZ3-CE 4.47Å; W9-M13 WeakPolarHBondContact O-CG 3.25Å; W9-M13 PolarHBondContact O-N 2.9Å
10	F	93.8	Very high	92.5	Very high	139 Å²	139	103.8 Å²	103.8	61%	0.61	55%	0.552	S	S	*	*	H	α-helix	trans	-61.2	-41.5	177.2	-82.7	-68	0	0	0	112.3	Q6 L7 M13 L14	Q6-F10 WeakPolarHBondContact O-CD2 3.43Å; Q6-F10 PolarHBondContact O-N 2.98Å; L7-F10 PolarHBondContact O-N 3.46Å; F10-M13 PolarHBondContact O-N 3.34Å; F10-L14 WeakPolarHBondContact O-CB 3.49Å; F10-L14 PolarHBondContact O-N 3.29Å
11	A	95.6	Very high	92.7	Very high	58 Å²	58	103.6 Å²	103.6	48%	0.479	55%	0.551	S	S	.	*	H	α-helix	trans	-65.5	-40.2	177.2	0	0	0	0	0	112.2	L7 A8 W9 L14 G15	L7-A11 WeakPolarHBondContact O-CB 3.22Å; L7-A11 PolarHBondContact O-N 3.17Å; A8-A11 PolarHBondContact O-N 3.01Å; W9-A11 VanDerWaalsContact C-N 3.35Å; W9-A11 PolarHBondContact O-N 3.45Å; A11-L14 PolarHBondContact O-N 3.41Å; A11-G15 PolarHBondContact O-N 2.93Å
12	N	94.9	Very high	94.1	Very high	102 Å²	102	99.1 Å²	99.1	55%	0.545	53%	0.529	S	S	.	.	H	α-helix	trans	-64.7	-45.4	174.4	-84.9	-81	0	0	0	111.7	A8 W9 L14 G15 M16	A8-N12 WeakPolarHBondContact O-CB 3.32Å; A8-N12 PolarHBondContact O-N 2.86Å; A8-N12 PolarHBondContact O-ND2 2.82Å; W9-N12 PolarHBondContact O-N 2.9Å; N12-L14 VanDerWaalsContact C-N 3.35Å; N12-L14 PolarHBondContact O-N 3.44Å; N12-G15 PolarHBondContact O-N 3.35Å; N12-M16 WeakPolarHBondContact O-CG 3.14Å; N12-M16 PolarHBondContact O-N 3.41Å
13	M	95.9	Very high	94.9	Very high	83 Å²	83	97.3 Å²	97.3	41%	0.409	52%	0.52	S	S	.	.	H	α-helix	trans	-61.3	-43.7	175.6	-70.6	-66.8	118.7	0	0	111.3	W9 F10 G15 M16 V17	W9-M13 HydrophobicContact CH2-CE 3.99Å; W9-M13 HydrophobicContact CZ2-CE 3.79Å; W9-M13 HydrophobicContact CZ2-CG 4.44Å; W9-M13 HydrophobicContact CZ2-SD 4.21Å; W9-M13 HydrophobicContact CZ3-CE 4.47Å; W9-M13 WeakPolarHBondContact O-CG 3.25Å; W9-M13 PolarHBondContact O-N 2.9Å; F10-M13 PolarHBondContact O-N 3.34Å; M13-G15 PolarHBondContact O-N 3.5Å; M13-M16 PolarHBondContact O-N 2.92Å; M13-V17 VanDerWaalsContact O-CG2 3.28Å; M13-V17 WeakPolarHBondContact O-CG2 3.46Å; M13-V17 PolarHBondContact O-N 3.32Å
14	L	96.4	Very high	95.1	Very high	108 Å²	108	99.1 Å²	99.1	57%	0.565	52%	0.522	S	S	*	.	H	α-helix	trans	-61.7	-43.6	175.9	-172.8	70.8	0	0	0	111.4	F10 A11 N12 V17 I18	F10-L14 WeakPolarHBondContact O-CB 3.49Å; F10-L14 PolarHBondContact O-N 3.29Å; A11-L14 PolarHBondContact O-N 3.41Å; N12-L14 VanDerWaalsContact C-N 3.35Å; N12-L14 PolarHBondContact O-N 3.44Å; L14-V17 PolarHBondContact O-N 2.84Å; L14-I18 HydrophobicContact CD1-CD1 4.37Å; L14-I18 HydrophobicContact CG-CD1 3.97Å; L14-I18 WeakPolarHBondContact O-CB 3.39Å; L14-I18 VanDerWaalsContact O-CG1 3.3Å; L14-I18 WeakPolarHBondContact O-CG1 3.27Å; L14-I18 PolarHBondContact O-N 3.5Å
15	G	96.9	Very high	95.2	Very high	39 Å²	39	102 Å²	102	40%	0.402	53%	0.525	S	S	.	.	H	α-helix	trans	-60.6	-45.6	175.4	0	0	0	0	0	112.4	A11 N12 M13 I18 F19	A11-G15 PolarHBondContact O-N 2.93Å; N12-G15 PolarHBondContact O-N 3.35Å; M13-G15 PolarHBondContact O-N 3.5Å; G15-I18 PolarHBondContact O-N 3.45Å; G15-F19 VanDerWaalsContact O-CB 3.25Å; G15-F19 WeakPolarHBondContact O-CB 3.34Å; G15-F19 PolarHBondContact O-N 2.82Å
16	M	97.2	Very high	95.2	Very high	123 Å²	123	102.9 Å²	102.9	61%	0.606	53%	0.527	S	S	*	.	H	α-helix	trans	-62.2	-43.6	175.8	-73.5	-66.1	-177.2	0	0	112	N12 M13 F19 V20	N12-M16 WeakPolarHBondContact O-CG 3.14Å; N12-M16 PolarHBondContact O-N 3.41Å; M13-M16 PolarHBondContact O-N 2.92Å; M16-F19 PolarHBondContact O-N 3.46Å; M16-V20 WeakPolarHBondContact O-CG2 3.28Å; M16-V20 PolarHBondContact O-N 3.26Å
17	V	96.7	Very high	95.2	Very high	84 Å²	84	105.6 Å²	105.6	51%	0.509	53%	0.534	S	S	.	.	H	α-helix	trans	-63.1	-47.4	177.9	170.2	0	0	0	0	111.1	M13 L14 F19 V20 L21	M13-V17 VanDerWaalsContact O-CG2 3.28Å; M13-V17 WeakPolarHBondContact O-CG2 3.46Å; M13-V17 PolarHBondContact O-N 3.32Å; L14-V17 PolarHBondContact O-N 2.84Å; V17-F19 VanDerWaalsContact C-N 3.33Å; V17-F19 PolarHBondContact O-N 3.38Å; V17-V20 PolarHBondContact O-N 3.1Å; V17-L21 HydrophobicContact CG1-CD1 3.85Å; V17-L21 HydrophobicContact CG1-CG 4.42Å; V17-L21 WeakPolarHBondContact O-CB 3.3Å; V17-L21 VanDerWaalsContact O-CG 3.27Å; V17-L21 WeakPolarHBondContact O-CG 3.28Å; V17-L21 PolarHBondContact O-N 3.43Å
18	I	96.8	Very high	95.1	Very high	83 Å²	83	103.9 Å²	103.9	43%	0.426	53%	0.528	S	S	.	.	H	α-helix	trans	-62.5	-42.4	177.7	-68.9	169.4	0	0	0	110.7	L14 G15 V20 L21 I22	L14-I18 HydrophobicContact CD1-CD1 4.37Å; L14-I18 HydrophobicContact CG-CD1 3.97Å; L14-I18 WeakPolarHBondContact O-CB 3.39Å; L14-I18 VanDerWaalsContact O-CG1 3.3Å; L14-I18 WeakPolarHBondContact O-CG1 3.27Å; L14-I18 PolarHBondContact O-N 3.5Å; G15-I18 PolarHBondContact O-N 3.45Å; I18-V20 PolarHBondContact O-N 3.35Å; I18-L21 PolarHBondContact O-N 2.94Å; I18-I22 HydrophobicContact CG2-CD1 3.75Å; I18-I22 HydrophobicContact CG2-CG1 4.36Å; I18-I22 VanDerWaalsContact O-CG1 3.28Å; I18-I22 WeakPolarHBondContact O-CG1 3.34Å; I18-I22 PolarHBondContact O-N 3.37Å
19	F	96.4	Very high	95	Very high	127 Å²	127	105.2 Å²	105.2	56%	0.557	53%	0.532	S	S	*	.	H	α-helix	trans	-59.9	-46.6	178.2	-173.5	-104	0	0	0	112	G15 M16 V17 I22 I23	G15-F19 VanDerWaalsContact O-CB 3.25Å; G15-F19 WeakPolarHBondContact O-CB 3.34Å; G15-F19 PolarHBondContact O-N 2.82Å; M16-F19 PolarHBondContact O-N 3.46Å; V17-F19 VanDerWaalsContact C-N 3.33Å; V17-F19 PolarHBondContact O-N 3.38Å; F19-I22 PolarHBondContact O-N 2.94Å; F19-I23 HydrophobicContact CD1-CD1 3.79Å; F19-I23 HydrophobicContact CE1-CD1 3.35Å; F19-I23 HydrophobicContact CE1-CG1 4.49Å; F19-I23 HydrophobicContact CE2-CD1 4.48Å; F19-I23 HydrophobicContact CZ-CD1 3.75Å; F19-I23 WeakPolarHBondContact O-CG1 3.46Å; F19-I23 PolarHBondContact O-N 2.81Å; F19-I23 VanDerWaalsContact O-N 3.1Å
20	V	96.6	Very high	94.6	Very high	91 Å²	91	100.8 Å²	100.8	55%	0.552	53%	0.53	S	S	*	.	H	α-helix	trans	-63.5	-42.6	175.9	172	0	0	0	0	111.4	M16 V17 I18 I22 I23 L24	M16-V20 WeakPolarHBondContact O-CG2 3.28Å; M16-V20 PolarHBondContact O-N 3.26Å; V17-V20 PolarHBondContact O-N 3.1Å; I18-V20 PolarHBondContact O-N 3.35Å; V20-I22 VanDerWaalsContact C-N 3.33Å; V20-I22 PolarHBondContact O-N 2.99Å; V20-I23 PolarHBondContact O-N 3.28Å; V20-L24 VanDerWaalsContact O-CB 3.3Å; V20-L24 WeakPolarHBondContact O-CB 3.41Å; V20-L24 PolarHBondContact O-N 3.47Å
21	L	96.4	Very high	94.1	Very high	101 Å²	101	97.5 Å²	97.5	53%	0.529	53%	0.525	S	S	.	.	H	α-helix	trans	-61.3	-39.6	177.5	-74.9	168.7	0	0	0	112.2	V17 I18 L24 Y25	V17-L21 HydrophobicContact CG1-CD1 3.85Å; V17-L21 HydrophobicContact CG1-CG 4.42Å; V17-L21 WeakPolarHBondContact O-CB 3.3Å; V17-L21 VanDerWaalsContact O-CG 3.27Å; V17-L21 WeakPolarHBondContact O-CG 3.28Å; V17-L21 PolarHBondContact O-N 3.43Å; I18-L21 PolarHBondContact O-N 2.94Å; L21-L24 PolarHBondContact O-N 2.94Å; L21-Y25 VanDerWaalsContact O-CB 3.23Å; L21-Y25 WeakPolarHBondContact O-CB 3.37Å; L21-Y25 PolarHBondContact O-N 3.25Å
22	I	96.8	Very high	93	Very high	104 Å²	104	99.4 Å²	99.4	53%	0.533	53%	0.527	S	S	.	.	H	α-helix	trans	-65.6	-46.1	177	-68.8	165.9	0	0	0	110.8	I18 F19 V20 L24 Y25 H26	I18-I22 HydrophobicContact CG2-CD1 3.75Å; I18-I22 HydrophobicContact CG2-CG1 4.36Å; I18-I22 VanDerWaalsContact O-CG1 3.28Å; I18-I22 WeakPolarHBondContact O-CG1 3.34Å; I18-I22 PolarHBondContact O-N 3.37Å; F19-I22 PolarHBondContact O-N 2.94Å; V20-I22 VanDerWaalsContact C-N 3.33Å; V20-I22 PolarHBondContact O-N 2.99Å; I22-L24 VanDerWaalsContact C-N 3.35Å; I22-Y25 PolarHBondContact O-N 2.86Å; I22-H26 WeakPolarHBondContact O-CB 3.3Å; I22-H26 PolarHBondContact O-N 2.84Å
23	I	95.9	Very high	91.6	Very high	92 Å²	92	99.7 Å²	99.7	47%	0.472	53%	0.534	S	S	.	.	H	α-helix	trans	-62.2	-45.6	177.3	-68.1	172.4	0	0	0	110.3	F19 V20 Y25 H26 Y27	F19-I23 HydrophobicContact CD1-CD1 3.79Å; F19-I23 HydrophobicContact CE1-CD1 3.35Å; F19-I23 HydrophobicContact CE1-CG1 4.49Å; F19-I23 HydrophobicContact CE2-CD1 4.48Å; F19-I23 HydrophobicContact CZ-CD1 3.75Å; F19-I23 WeakPolarHBondContact O-CG1 3.46Å; F19-I23 PolarHBondContact O-N 2.81Å; F19-I23 VanDerWaalsContact O-N 3.1Å; V20-I23 PolarHBondContact O-N 3.28Å; I23-Y25 PolarHBondContact O-N 2.69Å; I23-H26 PolarHBondContact O-N 3.49Å; I23-Y27 WeakPolarHBondContact O-CB 3.24Å; I23-Y27 PolarHBondContact O-N 3.37Å
24	L	94.9	Very high	90	Very high	96 Å²	96	106.1 Å²	106.1	50%	0.503	55%	0.554	S	S	.	*	H	α-helix	trans	-61.8	-44.7	178.2	-178.4	62	0	0	0	111.2	V20 L21 I22 H26 Y27 V28	V20-L24 VanDerWaalsContact O-CB 3.3Å; V20-L24 WeakPolarHBondContact O-CB 3.41Å; V20-L24 PolarHBondContact O-N 3.47Å; L21-L24 PolarHBondContact O-N 2.94Å; I22-L24 VanDerWaalsContact C-N 3.35Å; L24-H26 VanDerWaalsContact C-N 3.33Å; L24-H26 PolarHBondContact O-N 3.49Å; L24-Y27 PolarHBondContact O-N 3.47Å; L24-V28 HydrophobicContact CD1-CG2 4.37Å; L24-V28 VanDerWaalsContact O-CG2 3.31Å; L24-V28 WeakPolarHBondContact O-CG2 3.41Å; L24-V28 PolarHBondContact O-N 3.47Å
25	Y	93.6	Very high	88.2	Confident	165 Å²	165	112.5 Å²	112.5	65%	0.647	57%	0.57	S	S	*	*	H	α-helix	trans	-59.8	-44.7	175.2	177.1	-97.1	0	0	0	111.5	L21 I22 I23 Y27 V28 T29	L21-Y25 VanDerWaalsContact O-CB 3.23Å; L21-Y25 WeakPolarHBondContact O-CB 3.37Å; L21-Y25 PolarHBondContact O-N 3.25Å; I22-Y25 PolarHBondContact O-N 2.86Å; I23-Y25 PolarHBondContact O-N 2.69Å; Y25-Y27 VanDerWaalsContact C-N 3.34Å; Y25-Y27 PolarHBondContact O-N 2.88Å; Y25-V28 PolarHBondContact O-N 3.38Å; Y25-T29 WeakPolarHBondContact O-CB 3.23Å; Y25-T29 PolarHBondContact O-N 3.49Å; Y25-T29 PolarHBondContact O-OG1 3.36Å
26	H	91.7	Very high	86.4	Confident	134 Å²	134	115.5 Å²	115.5	62%	0.62	59%	0.585	S	S	*	*	H	α-helix	trans	-62	-44	176.6	-170.5	75.1	0	0	0	111.2	I22 I23 L24 T29 A30	I22-H26 WeakPolarHBondContact O-CB 3.3Å; I22-H26 PolarHBondContact O-N 2.84Å; I23-H26 PolarHBondContact O-N 3.49Å; L24-H26 VanDerWaalsContact C-N 3.33Å; L24-H26 PolarHBondContact O-N 3.49Å; H26-T29 PolarHBondContact O-N 2.86Å; H26-A30 VanDerWaalsContact O-CB 3.24Å; H26-A30 WeakPolarHBondContact O-CB 3.4Å; H26-A30 PolarHBondContact O-N 2.82Å
27	Y	92.1	Very high	84.5	Confident	159 Å²	159	112.9 Å²	112.9	62%	0.624	59%	0.59	S	S	*	*	H	α-helix	trans	-63.1	-44.5	177.2	-173.3	-96.3	0	0	0	111.9	I23 L24 Y25 T29 A30 S31	I23-Y27 WeakPolarHBondContact O-CB 3.24Å; I23-Y27 PolarHBondContact O-N 3.37Å; L24-Y27 PolarHBondContact O-N 3.47Å; Y25-Y27 VanDerWaalsContact C-N 3.34Å; Y25-Y27 PolarHBondContact O-N 2.88Å; Y27-T29 VanDerWaalsContact C-N 3.33Å; Y27-T29 PolarHBondContact O-N 2.94Å; Y27-A30 PolarHBondContact O-N 3.26Å; Y27-S31 WeakPolarHBondContact O-CA 2.98Å; Y27-S31 WeakPolarHBondContact O-CB 3.37Å; Y27-S31 PolarHBondContact O-N 2.75Å
28	V	91.4	Very high	82.8	Confident	85 Å²	85	113.2 Å²	113.2	52%	0.515	60%	0.596	S	S	.	*	H	α-helix	trans	-62.8	-41.1	175.5	170.6	0	0	0	0	110.9	L24 Y25 S31 N32	L24-V28 HydrophobicContact CD1-CG2 4.37Å; L24-V28 VanDerWaalsContact O-CG2 3.31Å; L24-V28 WeakPolarHBondContact O-CG2 3.41Å; L24-V28 PolarHBondContact O-N 3.47Å; Y25-V28 PolarHBondContact O-N 3.38Å; V28-S31 CarbonylContact O-C 3.53Å; V28-N32 WeakPolarHBondContact O-CB 3.31Å; V28-N32 PolarHBondContact O-N 3.47Å
29	T	89.8	Confident	81.2	Confident	73 Å²	73	120.7 Å²	120.7	45%	0.448	62%	0.619	S	S	.	*	H	α-helix	trans	-69.5	-42.4	-179.9	-49.5	0	0	0	0	111.7	Y25 H26 Y27 N32	Y25-T29 WeakPolarHBondContact O-CB 3.23Å; Y25-T29 PolarHBondContact O-N 3.49Å; Y25-T29 PolarHBondContact O-OG1 3.36Å; H26-T29 PolarHBondContact O-N 2.86Å; Y27-T29 VanDerWaalsContact C-N 3.33Å; Y27-T29 PolarHBondContact O-N 2.94Å; T29-N32 PolarHBondContact O-N 2.83Å
30	A	86.6	Confident	79.7	Confident	71 Å²	71	121.3 Å²	121.3	59%	0.587	63%	0.628	S	S	*	*	H	α-helix	trans	-70.2	-39.9	176.4	0	0	0	0	0	112	H26 Y27 N32	H26-A30 VanDerWaalsContact O-CB 3.24Å; H26-A30 WeakPolarHBondContact O-CB 3.4Å; H26-A30 PolarHBondContact O-N 2.82Å; Y27-A30 PolarHBondContact O-N 3.26Å; A30-N32 PolarHBondContact O-N 2.68Å
31	S	83.4	Confident	78.2	Confident	70 Å²	70	124.6 Å²	124.6	49%	0.49	64%	0.637	S	S	.	*	T	Hydrogen-bonded Turn	trans	-78.4	1.7	175	-173.6	0	0	0	0	112.9	Y27 V28 P33	Y27-S31 WeakPolarHBondContact O-CA 2.98Å; Y27-S31 WeakPolarHBondContact O-CB 3.37Å; Y27-S31 PolarHBondContact O-N 2.75Å; V28-S31 CarbonylContact O-C 3.53Å; S31-P33 WeakPolarHBondContact O-CD 2.76Å
32	N	72.2	Confident	76.6	Confident	98 Å²	98	135.1 Å²	135.1	52%	0.524	67%	0.67	S	S	.	*			trans	-88.4	88.4	163.9	-161	98.6	0	0	0	106	V28 T29 A30 R34	V28-N32 WeakPolarHBondContact O-CB 3.31Å; V28-N32 PolarHBondContact O-N 3.47Å; T29-N32 PolarHBondContact O-N 2.83Å; A30-N32 PolarHBondContact O-N 2.68Å; N32-R34 PolarHBondContact ND2-N 3.5Å; N32-R34 PolarHBondContact O-N 2.76Å
33	P	65.3	Low	75.5	Confident	107 Å²	107	136.7 Å²	136.7	70%	0.695	68%	0.677	S	S	*	*			trans	-62.5	90.8	161.1	29.9	-32.6	0	0	0	104	S31 R35	S31-P33 WeakPolarHBondContact O-CD 2.76Å; P33-R35 PolarHBondContact O-N 2.66Å
34	R	63.2	Low	74.5	Confident	218 Å²	218	139 Å²	139	82%	0.823	69%	0.687	S	S	*	*			trans	-47.7	106.2	156.9	-78.8	-179.8	161.5	-100	-3.2	102.4	N32 S36	N32-R34 PolarHBondContact ND2-N 3.5Å; N32-R34 PolarHBondContact O-N 2.76Å; R34-S36 VanDerWaalsContact C-N 3.25Å; R34-S36 PolarHBondContact O-N 3.35Å
35	R	58.1	Low	73.3	Confident	242 Å²	242	141.4 Å²	141.4	91%	0.913	70%	0.698	S	S	*	*			trans	-28.4	96.5	176.5	-75.6	171.8	166.3	168.7	-6	107.1	P33 G37	P33-R35 PolarHBondContact O-N 2.66Å; R35-G37 PolarHBondContact O-N 2.75Å
36	S	59.6	Low	72.1	Confident	102 Å²	102	140 Å²	140	71%	0.713	70%	0.701	S	S	*	*			trans	-64.5	96.2	158.2	171.6	0	0	0	0	100.7	R34 S38	R34-S36 VanDerWaalsContact C-N 3.25Å; R34-S36 PolarHBondContact O-N 3.35Å; S36-S38 PolarHBondContact O-N 2.82Å
37	G	57.9	Low	70.9	Confident	69 Å²	69	140.4 Å²	140.4	71%	0.711	71%	0.706	S	S	*	*			trans	-67.5	69.3	172.5	0	0	0	0	0	107.3	R35 R39	R35-G37 PolarHBondContact O-N 2.75Å; G37-R39 PolarHBondContact O-N 3.23Å
38	S	59.5	Low	69.5	Low	90 Å²	90	139.1 Å²	139.1	63%	0.629	71%	0.711	S	S	*	*			trans	-85.4	65.2	150.5	55.8	0	0	0	0	106	S36 D40	S36-S38 PolarHBondContact O-N 2.82Å; S38-D40 PolarHBondContact O-N 3.21Å; S38-D40 VanDerWaalsContact O-N 3.1Å
39	R	64.4	Low	68	Low	240 Å²	240	143 Å²	143	91%	0.906	73%	0.725	S	S	*	*			trans	-73	49.8	146	-171	-179.5	179.1	171	-0.4	106.8	G37 E41	G37-R39 PolarHBondContact O-N 3.23Å; R39-E41 VanDerWaalsContact C-N 3.27Å; R39-E41 PolarHBondContact O-N 3.1Å
40	D	63.6	Low	66.3	Low	141 Å²	141	148.4 Å²	148.4	75%	0.754	75%	0.746	S	S	*	*			trans	-91.8	77.8	178.1	-162.6	29.8	0	0	0	106.4	S38	S38-D40 PolarHBondContact O-N 3.21Å; S38-D40 VanDerWaalsContact O-N 3.1Å
41	E	65.8	Low	64.6	Low	160 Å²	160	154.8 Å²	154.8	75%	0.748	76%	0.76	S	S	*	*				41.9	83.4	129.2	-152.6	97.2	122.5	0	0	117.1	R39	R39-E41 VanDerWaalsContact C-N 3.27Å; R39-E41 PolarHBondContact O-N 3.1Å
42	R	62	Low	62.9	Low	321 Å²	321	162.5 Å²	162.5	100%	1.211	78%	0.784	S	S	*	*				-156.4	0	129.5	-66.9	-156.1	-162.8	-81.2	-8.7	111

Retrieved 42 of 42 residues in 28.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).