A0A077Z9X8_TRITR Loading...

RNA polymerase II transcriptional coactivator

AlphaFold DB , UniProt , Accession A0A077Z9X8, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 102 aa.

						>A0A077Z9X8_TRITR|A0A077Z9X8
MSDSSSSGPEDRHVVVKKKKKTTEEPSADDDGRFEIGNKRFVCLNQFRGRTFIDIREYYTTGDGEEKPGKKGISLSVEQFKKFVSLVPKIEDVLRDKYDETL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53.1	Low	64.6	Low	236 Å²	236	129.4 Å²	129.4	100%	1.163	80%	0.8	S	S	*	*				0	111.5	0	-66	-72.2	179.8	0	0	106.7
2	S	65.9	Low	63.9	Low	108 Å²	108	134.9 Å²	134.9	76%	0.755	80%	0.795	S	S	*	*			trans	48.2	138.3	152.6	-62.1	0	0	0	0	120.7
3	D	68.2	Low	63.2	Low	137 Å²	137	137.6 Å²	137.6	73%	0.733	80%	0.795	S	S	*	*			cis	-165.4	119.2	-5.6	-102.6	-71.5	0	0	0	102.8
4	S	63.4	Low	62.6	Low	109 Å²	109	137.1 Å²	137.1	76%	0.762	80%	0.795	S	S	*	*				39.2	109.1	111	-74.5	0	0	0	0	116.6
5	S	73.2	Confident	62.2	Low	131 Å²	131	135.3 Å²	135.3	92%	0.916	79%	0.786	S	S	*	*				177.3	137.1	109.6	-82.5	0	0	0	0	111.9
6	S	67.7	Low	61.5	Low	103 Å²	103	134.9 Å²	134.9	72%	0.72	79%	0.786	S	S	*	*			trans	-123.8	156.3	-170.6	166.8	0	0	0	0	108.3
7	S	65.9	Low	60.9	Low	118 Å²	118	138.2 Å²	138.2	83%	0.825	79%	0.788	S	S	*	*			trans	72.3	140.7	157.2	-55	0	0	0	0	117.1
8	G	69.3	Low	60.3	Low	70 Å²	70	141.4 Å²	141.4	72%	0.722	79%	0.792	S	S	*	*			cis	-167.2	-173.5	10.7	0	0	0	0	0	112
9	P	60.8	Low	59.7	Low	117 Å²	117	145.2 Å²	145.2	76%	0.76	80%	0.799	S	S	*	*			trans	-104.6	179.2	-173	38.1	-28.1	0	0	0	113.9
10	E	57.8	Low	59.1	Low	182 Å²	182	147.7 Å²	147.7	85%	0.85	80%	0.802	S	S	*	*			trans	94.1	144.7	156.7	-60.1	-172.5	100.4	0	0	121.1
11	D	64.9	Low	58.2	Low	112 Å²	112	150.3 Å²	150.3	60%	0.599	81%	0.805	S	S	*	*			trans	102.7	104	152.7	-131.3	-112.4	0	0	0	119.5
12	R	56.6	Low	57.5	Low	196 Å²	196	144.4 Å²	144.4	74%	0.74	78%	0.783	S	S	*	*			trans	50.9	120.5	133.3	-62.4	-176.8	-171.6	126.7	-9.3	119.1
13	H	55.3	Low	56.4	Low	170 Å²	170	144.7 Å²	144.7	79%	0.787	78%	0.78	S	S	*	*				-176	131.1	100.8	-115.7	-95.5	0	0	0	111.3	V15	H13-V15 PolarHBondContact O-N 3.23Å
14	V	54.5	Low	55.2	Low	131 Å²	131	146 Å²	146	79%	0.794	78%	0.782	S	S	*	*			trans	-65.4	112.1	164.5	175.9	0	0	0	0	107.8	V16	V14-V16 PolarHBondContact O-N 3.46Å
15	V	56.5	Low	54.4	Low	110 Å²	110	148.5 Å²	148.5	67%	0.667	78%	0.781	S	S	*	*			trans	-92.8	98.6	175.1	-174.8	0	0	0	0	109.4	H13 K17	H13-V15 PolarHBondContact O-N 3.23Å; V15-K17 HydrophobicContact CG1-CG 3.96Å; V15-K17 PolarHBondContact O-N 3.18Å
16	V	51.6	Low	52.9	Low	129 Å²	129	146.2 Å²	146.2	78%	0.782	76%	0.764	S	S	*	*			trans	-65.6	103.7	162.5	179.3	0	0	0	0	108.4	V14 K18	V14-V16 PolarHBondContact O-N 3.46Å; V16-K18 PolarHBondContact O-N 3.39Å
17	K	50.3	Low	51.6	Low	190 Å²	190	145.7 Å²	145.7	83%	0.826	76%	0.76	S	S	*	*			trans	-90.2	94.2	170.2	-80.3	-174.2	176.7	171.1	0	110.8	V15	V15-K17 HydrophobicContact CG1-CG 3.96Å; V15-K17 PolarHBondContact O-N 3.18Å
18	K	50.1	Low	50.5	Low	197 Å²	197	144.2 Å²	144.2	86%	0.857	75%	0.754	S	S	*	*			trans	25.3	100.6	146.3	-73	177	173.8	170.9	0	117.4	V16 K20	V16-K18 PolarHBondContact O-N 3.39Å; K18-K20 PolarHBondContact O-N 3.31Å
19	K	49.4	Very low	49.5	Very low	212 Å²	212	148.3 Å²	148.3	92%	0.922	76%	0.76	S	S	*	*			trans	-63.7	112.9	155.6	-139.5	174.1	-175.3	-179.6	0	108.4
20	K	48	Very low	49.2	Very low	196 Å²	196	150.6 Å²	150.6	85%	0.852	77%	0.766	S	S	*	*			trans	-71.7	124.3	172.2	-146.5	176	-175.8	-176.8	0	106.8	K18 T22	K18-K20 PolarHBondContact O-N 3.31Å; K20-T22 PolarHBondContact O-N 3.27Å
21	K	40.1	Very low	49.2	Very low	202 Å²	202	146.1 Å²	146.1	88%	0.878	75%	0.748	S	S	*	*			trans	-56.3	100.6	170.9	-98.8	175.3	166.5	-179.2	0	108.9
22	T	37.7	Very low	49.7	Very low	113 Å²	113	141.6 Å²	141.6	69%	0.693	73%	0.727	S	S	*	*			trans	-75.2	109.3	147.6	0.5	0	0	0	0	105	K20 E24	K20-T22 PolarHBondContact O-N 3.27Å; T22-E24 PolarHBondContact O-N 3.3Å
23	T	43.3	Very low	51.2	Low	113 Å²	113	137 Å²	137	69%	0.693	71%	0.71	S	S	*	*			trans	-61.8	94.5	150.3	-55.1	0	0	0	0	103.5	E25	T23-E25 PolarHBondContact O-N 3.03Å
24	E	43.3	Very low	53	Low	165 Å²	165	134.8 Å²	134.8	77%	0.771	70%	0.698	S	S	*	*			trans	-63.9	99.7	165.6	-74.1	174.8	161.9	0	0	104.4	T22	T22-E24 PolarHBondContact O-N 3.3Å
25	E	46.4	Very low	54.9	Low	162 Å²	162	134.6 Å²	134.6	76%	0.757	69%	0.689	S	S	*	*	P	Polyproline II helix	trans	-51.1	120.2	161.5	-65.7	-87.6	115.8	0	0	105.5	T23 S27	T23-E25 PolarHBondContact O-N 3.03Å; E25-S27 PolarHBondContact O-N 2.98Å
26	P	41.4	Very low	56.7	Low	83 Å²	83	134.1 Å²	134.1	54%	0.539	68%	0.681	S	S	.	*	P	Polyproline II helix	trans	-57.9	117.8	-178.6	22.1	-31.3	0	0	0	108.7	A28 D31	P26-A28 PolarHBondContact O-N 2.98Å; P26-D31 HydrophobicContact CB-CB 3.53Å; P26-D31 WeakPolarHBondContact CB-OD1 3.36Å
27	S	39.7	Very low	58.7	Low	91 Å²	91	129.3 Å²	129.3	64%	0.636	66%	0.657	S	S	*	*	P	Polyproline II helix	trans	-59.8	129.6	179	43.7	0	0	0	0	109.6	E25 D29	E25-S27 PolarHBondContact O-N 2.98Å; S27-D29 PolarHBondContact O-N 2.85Å
28	A	43.5	Very low	60.8	Low	87 Å²	87	126.9 Å²	126.9	72%	0.719	65%	0.654	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.3	7.5	-149.1	0	0	0	0	0	118.8	P26	P26-A28 PolarHBondContact O-N 2.98Å
29	D	48	Very low	62.8	Low	157 Å²	157	122.1 Å²	122.1	84%	0.84	63%	0.633	S	S	*	*	T	Hydrogen-bonded Turn	trans	-137.9	4.5	-167.3	-72.9	-83.3	0	0	0	117.1	S27	S27-D29 PolarHBondContact O-N 2.85Å
30	D	54	Low	65.1	Low	164 Å²	164	117.3 Å²	117.3	88%	0.877	61%	0.609	S	S	*	*	T	Hydrogen-bonded Turn	trans	-148.8	6.9	172.1	-147.3	-116.6	0	0	0	114.7	G32	D30-G32 VanDerWaalsContact C-N 3.33Å; D30-G32 PolarHBondContact O-N 3.46Å; D30-G32 VanDerWaalsContact O-N 3.09Å
31	D	59.3	Low	67.3	Low	89 Å²	89	108.8 Å²	108.8	48%	0.476	57%	0.572	S	S	.	*	S	Bend	trans	-89.3	34	-162.5	-139	-79.1	0	0	0	115.3	P26 R33	P26-D31 HydrophobicContact CB-CB 3.53Å; P26-D31 WeakPolarHBondContact CB-OD1 3.36Å; D31-R33 VanDerWaalsContact C-N 3.35Å; D31-R33 PolarHBondContact O-N 3.17Å
32	G	74.8	Confident	70	Confident	16 Å²	16	100.4 Å²	100.4	17%	0.165	54%	0.537	C	S	.	.	S	Bend	trans	67.8	31.1	178.8	0	0	0	0	0	114.5	D30 C43 L44	D30-G32 VanDerWaalsContact C-N 3.33Å; D30-G32 PolarHBondContact O-N 3.46Å; D30-G32 VanDerWaalsContact O-N 3.09Å; G32-C43 CarbonylContact O-C 3.49Å; G32-C43 VanDerWaalsContact O-CA 3.26Å; G32-C43 WeakPolarHBondContact O-CA 3.35Å; G32-L44 PolarHBondContact O-N 3.37Å
33	R	87.5	Confident	72.7	Confident	100 Å²	100	95.8 Å²	95.8	38%	0.377	51%	0.51	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.8	112	169	178.5	171.9	-177.1	-159.9	-5.1	109.7	D31 F41 V42 E66	D31-R33 VanDerWaalsContact C-N 3.35Å; D31-R33 PolarHBondContact O-N 3.17Å; R33-F41 HydrophobicContact CG-CB 4Å; R33-F41 HydrophobicContact CG-CD1 3.67Å; R33-F41 HydrophobicContact CG-CG 4.11Å; R33-F41 VanDerWaalsContact NE-CG 3.32Å; R33-F41 VanDerWaalsContact NH2-CD2 3.29Å; R33-V42 CarbonylContact C-O 3.55Å; R33-V42 WeakPolarHBondContact CA-O 3.14Å; R33-E66 IonicContact CZ-OE2 3.62Å; R33-E66 IonicContact NH1-OE2 3.64Å; R33-E66 IonicContact NH2-OE2 2.75Å; R33-E66 PolarHBondContact NH2-OE2 2.76Å
34	F	93.5	Very high	75.1	Confident	124 Å²	124	95 Å²	95	54%	0.544	50%	0.501	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.4	119.8	-178.8	-53.1	-87	0	0	0	110.1	F41 V42	F34-F41 CarbonylContact O-C 3.56Å; F34-F41 VanDerWaalsContact O-CA 3.25Å; F34-F41 WeakPolarHBondContact O-CA 3.44Å; F34-V42 HydrophobicContact CB-CB 4.31Å; F34-V42 WeakPolarHBondContact CD2-O 3.39Å; F34-V42 PolarHBondContact N-O 3.03Å; F34-V42 PolarHBondContact O-N 2.92Å
35	E	94.4	Very high	77.4	Confident	127 Å²	127	90.8 Å²	90.8	59%	0.593	48%	0.484	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-74.9	133	175.1	-170.4	172.8	-173.3	0	0	111.1	F41	E35-F41 HydrophobicContact CB-CD1 3.78Å; E35-F41 HydrophobicContact CB-CE1 3.63Å; E35-F41 HydrophobicContact CB-CZ 4.49Å; E35-F41 HydrophobicContact CG-CD1 4.12Å; E35-F41 HydrophobicContact CG-CE1 3.74Å; E35-F41 HydrophobicContact CG-CZ 4.12Å
36	I	94.8	Very high	79.7	Confident	100 Å²	100	89.7 Å²	89.7	51%	0.513	48%	0.478	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.4	15.2	176.3	61.1	168.9	0	0	0	112.2	R40 V42 I55	I36-R40 HydrophobicContact CD1-CB 4.02Å; I36-R40 HydrophobicContact CG1-CB 3.65Å; I36-R40 WeakPolarHBondContact CG1-O 3.4Å; I36-R40 PolarHBondContact N-O 2.99Å; I36-V42 HydrophobicContact CD1-CG2 4.23Å; I36-V42 HydrophobicContact CG2-CG2 3.79Å; I36-I55 HydrophobicContact CD1-CG2 4.02Å
37	G	93.7	Very high	82	Confident	27 Å²	27	91.5 Å²	91.5	28%	0.278	48%	0.478	S	S	.	.	E	Extended strand (participates in β ladder)	trans	92.3	163.4	177.9	0	0	0	0	0	114.6	K39 R40	G37-K39 VanDerWaalsContact C-N 3.31Å; G37-K39 PolarHBondContact O-N 3.39Å; G37-R40 VanDerWaalsContact O-CB 3.24Å; G37-R40 WeakPolarHBondContact O-CB 3.45Å; G37-R40 PolarHBondContact O-N 3.12Å
38	N	93.6	Very high	84.6	Confident	140 Å²	140	97.7 Å²	97.7	75%	0.749	49%	0.488	S	S	*	.	T	Hydrogen-bonded Turn	trans	54	39.6	178.1	-60	-48.4	0	0	0	114.3	R40	N38-R40 PolarHBondContact O-N 3.19Å
39	K	93.5	Very high	87	Confident	96 Å²	96	96.7 Å²	96.7	42%	0.417	49%	0.485	S	S	.	.	T	Hydrogen-bonded Turn	trans	58.7	29	-174.4	-52.9	-175.6	176.7	-171.9	0	113.4	G37 Y58 T60	G37-K39 VanDerWaalsContact C-N 3.31Å; G37-K39 PolarHBondContact O-N 3.39Å; K39-Y58 WeakPolarHBondContact CB-O 3.37Å; K39-Y58 PolarHBondContact O-N 2.86Å; K39-T60 PolarHBondContact NZ-OG1 2.82Å
40	R	96.5	Very high	89.2	Confident	112 Å²	112	97.8 Å²	97.8	42%	0.423	48%	0.478	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.2	136	174.9	-62.2	172.6	179.2	173.2	2.6	109.7	I36 G37 N38 R56 E57	I36-R40 HydrophobicContact CD1-CB 4.02Å; I36-R40 HydrophobicContact CG1-CB 3.65Å; I36-R40 WeakPolarHBondContact CG1-O 3.4Å; I36-R40 PolarHBondContact N-O 2.99Å; G37-R40 VanDerWaalsContact O-CB 3.24Å; G37-R40 WeakPolarHBondContact O-CB 3.45Å; G37-R40 PolarHBondContact O-N 3.12Å; N38-R40 PolarHBondContact O-N 3.19Å; R40-R56 WeakPolarHBondContact CA-O 3.45Å; R40-E57 HydrophobicContact CG-CB 4.02Å; R40-E57 HydrophobicContact CG-CG 4.26Å; R40-E57 IonicContact CZ-OE2 3.79Å; R40-E57 IonicContact NE-OE2 3.37Å; R40-E57 PolarHBondContact NE-OE2 2.78Å; R40-E57 IonicContact NH2-OE2 3.26Å; R40-E57 PolarHBondContact NH2-OE2 2.89Å
41	F	95.4	Very high	91.1	Very high	17 Å²	17	93.1 Å²	93.1	8%	0.075	46%	0.455	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.4	147	-176.9	-59.1	-96.3	0	0	0	110.3	R33 F34 E35 I55 R56 Y58	R33-F41 HydrophobicContact CG-CB 4Å; R33-F41 HydrophobicContact CG-CD1 3.67Å; R33-F41 HydrophobicContact CG-CG 4.11Å; R33-F41 VanDerWaalsContact NE-CG 3.32Å; R33-F41 VanDerWaalsContact NH2-CD2 3.29Å; F34-F41 CarbonylContact O-C 3.56Å; F34-F41 VanDerWaalsContact O-CA 3.25Å; F34-F41 WeakPolarHBondContact O-CA 3.44Å; E35-F41 HydrophobicContact CB-CD1 3.78Å; E35-F41 HydrophobicContact CB-CE1 3.63Å; E35-F41 HydrophobicContact CB-CZ 4.49Å; E35-F41 HydrophobicContact CG-CD1 4.12Å; E35-F41 HydrophobicContact CG-CE1 3.74Å; E35-F41 HydrophobicContact CG-CZ 4.12Å; F41-I55 WeakPolarHBondContact O-CA 3.31Å; F41-R56 PolarHBondContact N-O 2.96Å; F41-R56 PolarHBondContact O-N 3.1Å; F41-Y58 HydrophobicContact CB-CD2 4.37Å; F41-Y58 HydrophobicContact CB-CE2 4.04Å; F41-Y58 AromaticContact CD2-CD2 3.49Å; F41-Y58 HydrophobicContact CD2-CD2 3.49Å; F41-Y58 VanDerWaalsContact CD2-CD2 3.49Å; F41-Y58 AromaticContact CD2-CE2 3.98Å; F41-Y58 HydrophobicContact CD2-CE2 3.98Å; F41-Y58 HydrophobicContact CD2-CG 4.02Å; F41-Y58 HydrophobicContact CE2-CD2 4.24Å; F41-Y58 HydrophobicContact CE2-CG 4.34Å; F41-Y58 HydrophobicContact CG-CD2 4.32Å; F41-Y58 HydrophobicContact CG-CE2 4.37Å
42	V	96.2	Very high	92.9	Very high	25 Å²	25	91.1 Å²	91.1	15%	0.152	44%	0.442	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101	114.5	165.3	-176.5	0	0	0	0	107	R33 F34 I36 I53 D54 I55	R33-V42 CarbonylContact C-O 3.55Å; R33-V42 WeakPolarHBondContact CA-O 3.14Å; F34-V42 HydrophobicContact CB-CB 4.31Å; F34-V42 WeakPolarHBondContact CD2-O 3.39Å; F34-V42 PolarHBondContact N-O 3.03Å; F34-V42 PolarHBondContact O-N 2.92Å; I36-V42 HydrophobicContact CD1-CG2 4.23Å; I36-V42 HydrophobicContact CG2-CG2 3.79Å; V42-I53 HydrophobicContact CG1-CG2 3.53Å; V42-D54 CarbonylContact C-O 3.43Å; V42-D54 VanDerWaalsContact CA-O 3.24Å; V42-D54 WeakPolarHBondContact CA-O 3.41Å; V42-I55 HydrophobicContact CG1-CG1 4.38Å; V42-I55 HydrophobicContact CG2-CG1 4.17Å; V42-I55 HydrophobicContact CG2-CG2 4.41Å
43	C	94.2	Very high	93.9	Very high	16 Å²	16	90.7 Å²	90.7	11%	0.108	44%	0.436	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.4	141.5	179.9	-54.7	0	0	0	0	110.7	G32 I53 D54	G32-C43 CarbonylContact O-C 3.49Å; G32-C43 VanDerWaalsContact O-CA 3.26Å; G32-C43 WeakPolarHBondContact O-CA 3.35Å; C43-I53 CarbonylContact O-C 3.59Å; C43-I53 WeakPolarHBondContact O-CA 3.26Å; C43-D54 HydrophobicContact CB-CB 4.35Å; C43-D54 PolarHBondContact N-O 3.33Å; C43-D54 PolarHBondContact O-N 3.09Å
44	L	93.9	Very high	94.3	Very high	96 Å²	96	86.8 Å²	86.8	50%	0.503	42%	0.423	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.2	129.5	164	-62.9	179.6	0	0	0	109.3	G32 I53	G32-L44 PolarHBondContact O-N 3.37Å; L44-I53 HydrophobicContact CD2-CG1 3.77Å
45	N	91.7	Very high	94.4	Very high	78 Å²	78	83.1 Å²	83.1	42%	0.417	41%	0.408	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.5	146.7	-177.3	-169.7	4	0	0	0	110.7	T51 F52 D54	N45-T51 CarbonylContact O-C 3.54Å; N45-T51 WeakPolarHBondContact O-CA 3.45Å; N45-F52 PolarHBondContact N-O 2.68Å; N45-F52 PolarHBondContact O-N 3.41Å; N45-D54 WeakPolarHBondContact CB-OD2 3.38Å; N45-D54 PolarHBondContact ND2-OD2 3.48Å
46	Q	93.3	Very high	94.5	Very high	138 Å²	138	79.5 Å²	79.5	65%	0.645	39%	0.389	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-116.5	114.4	176.4	-162.4	178.1	32.2	0	0	111	R50	Q46-R50 CarbonylContact C-O 3.5Å; Q46-R50 WeakPolarHBondContact CA-O 3.27Å
47	F	91.4	Very high	94.6	Very high	121 Å²	121	77 Å²	77	53%	0.531	38%	0.376	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.7	123.2	178.2	-174.1	-109.7	0	0	0	111	G49 R50 F52	F47-G49 VanDerWaalsContact C-N 3.27Å; F47-G49 PolarHBondContact O-N 3.33Å; F47-R50 PolarHBondContact N-O 3.32Å; F47-R50 PolarHBondContact O-N 3.39Å; F47-F52 HydrophobicContact CB-CD2 4.04Å; F47-F52 HydrophobicContact CB-CE2 3.93Å
48	R	93.5	Very high	94.7	Very high	222 Å²	222	77.5 Å²	77.5	84%	0.838	37%	0.369	S	S	*	.	T	Hydrogen-bonded Turn	trans	50.8	44.6	-179.4	-63.9	-175.3	170.5	-175.2	-3	113.2	R50	R48-R50 PolarHBondContact O-N 2.98Å
49	G	94	Very high	94.8	Very high	65 Å²	65	76.5 Å²	76.5	67%	0.67	36%	0.356	S	S	*	.	T	Hydrogen-bonded Turn	trans	73.5	7.3	178.7	0	0	0	0	0	114.7	F47	F47-G49 VanDerWaalsContact C-N 3.27Å; F47-G49 PolarHBondContact O-N 3.33Å
50	R	94.5	Very high	94.8	Very high	180 Å²	180	74.9 Å²	74.9	68%	0.679	35%	0.354	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-111.9	140.7	175.3	-60.9	-179.8	-178	-174	-1	109.8	Q46 F47 R48 F52	Q46-R50 CarbonylContact C-O 3.5Å; Q46-R50 WeakPolarHBondContact CA-O 3.27Å; F47-R50 PolarHBondContact N-O 3.32Å; F47-R50 PolarHBondContact O-N 3.39Å; R48-R50 PolarHBondContact O-N 2.98Å; R50-F52 HydrophobicContact CB-CD2 4.43Å; R50-F52 HydrophobicContact CB-CE2 3.65Å; R50-F52 HydrophobicContact CB-CZ 4.05Å; R50-F52 WeakPolarHBondContact O-CD2 3.49Å
51	T	94	Very high	94.7	Very high	66 Å²	66	70.8 Å²	70.8	41%	0.405	34%	0.341	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.1	137.6	174.4	-52.3	0	0	0	0	110.1	N45 V77	N45-T51 CarbonylContact O-C 3.54Å; N45-T51 WeakPolarHBondContact O-CA 3.45Å; T51-V77 HydrophobicContact CG2-CG2 4.3Å
52	F	95.8	Very high	94.7	Very high	47 Å²	47	74.2 Å²	74.2	21%	0.206	38%	0.381	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.5	151.8	176.4	-65.6	-86.8	0	0	0	109.9	N45 F47 R50 L75	N45-F52 PolarHBondContact N-O 2.68Å; N45-F52 PolarHBondContact O-N 3.41Å; F47-F52 HydrophobicContact CB-CD2 4.04Å; F47-F52 HydrophobicContact CB-CE2 3.93Å; R50-F52 HydrophobicContact CB-CD2 4.43Å; R50-F52 HydrophobicContact CB-CE2 3.65Å; R50-F52 HydrophobicContact CB-CZ 4.05Å; R50-F52 WeakPolarHBondContact O-CD2 3.49Å; F52-L75 CarbonylContact C-O 3.46Å; F52-L75 VanDerWaalsContact CA-O 3.27Å; F52-L75 WeakPolarHBondContact CA-O 3.45Å
53	I	96.2	Very high	94.7	Very high	8 Å²	8	79.6 Å²	79.6	4%	0.041	41%	0.41	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.6	110.1	173.2	-57.1	78.5	0	0	0	106.5	V42 C43 L44 L75 V77 F80	V42-I53 HydrophobicContact CG1-CG2 3.53Å; C43-I53 CarbonylContact O-C 3.59Å; C43-I53 WeakPolarHBondContact O-CA 3.26Å; L44-I53 HydrophobicContact CD2-CG1 3.77Å; I53-L75 HydrophobicContact CB-CB 4.48Å; I53-L75 PolarHBondContact N-O 2.87Å; I53-L75 PolarHBondContact O-N 2.53Å; I53-V77 HydrophobicContact CD1-CG2 4.11Å; I53-F80 HydrophobicContact CB-CB 4.49Å; I53-F80 HydrophobicContact CB-CD2 4.16Å; I53-F80 HydrophobicContact CB-CG 4.37Å; I53-F80 HydrophobicContact CD1-CB 3.69Å; I53-F80 HydrophobicContact CD1-CD1 4.38Å; I53-F80 HydrophobicContact CD1-CG 4Å; I53-F80 HydrophobicContact CG1-CB 4.07Å; I53-F80 HydrophobicContact CG1-CD1 4.28Å; I53-F80 HydrophobicContact CG1-CD2 4.1Å; I53-F80 HydrophobicContact CG1-CG 3.88Å; I53-F80 HydrophobicContact CG2-CD2 3.89Å; I53-F80 HydrophobicContact CG2-CE2 4.07Å
54	D	96	Very high	94.6	Very high	17 Å²	17	81.4 Å²	81.4	9%	0.091	43%	0.431	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.6	114.9	-177	-69.6	-21.7	0	0	0	109.9	V42 C43 N45 I73 S74	V42-D54 CarbonylContact C-O 3.43Å; V42-D54 VanDerWaalsContact CA-O 3.24Å; V42-D54 WeakPolarHBondContact CA-O 3.41Å; C43-D54 HydrophobicContact CB-CB 4.35Å; C43-D54 PolarHBondContact N-O 3.33Å; C43-D54 PolarHBondContact O-N 3.09Å; N45-D54 WeakPolarHBondContact CB-OD2 3.38Å; N45-D54 PolarHBondContact ND2-OD2 3.48Å; D54-I73 WeakPolarHBondContact CA-O 3.45Å; D54-S74 WeakPolarHBondContact OD1-CA 3.41Å; D54-S74 WeakPolarHBondContact OD1-CB 3.24Å; D54-S74 PolarHBondContact OD1-OG 2.95Å
55	I	96.7	Very high	94.6	Very high	47 Å²	47	81.8 Å²	81.8	24%	0.241	43%	0.43	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.8	108.7	171.8	-51.3	178.2	0	0	0	107.2	I36 F41 V42 G72 I73 L75	I36-I55 HydrophobicContact CD1-CG2 4.02Å; F41-I55 WeakPolarHBondContact O-CA 3.31Å; V42-I55 HydrophobicContact CG1-CG1 4.38Å; V42-I55 HydrophobicContact CG2-CG1 4.17Å; V42-I55 HydrophobicContact CG2-CG2 4.41Å; I55-G72 CarbonylContact O-C 3.53Å; I55-G72 WeakPolarHBondContact O-CA 3.5Å; I55-I73 HydrophobicContact CB-CG2 4.29Å; I55-I73 PolarHBondContact N-O 2.91Å; I55-I73 PolarHBondContact O-N 3Å; I55-L75 HydrophobicContact CD1-CD1 4.01Å
56	R	95.9	Very high	94.6	Very high	51 Å²	51	82 Å²	82	19%	0.192	43%	0.429	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.7	139.8	-166.4	-171.4	169	-62.4	-75.8	-5.4	114	R40 F41 Y58 P68 G69	R40-R56 WeakPolarHBondContact CA-O 3.45Å; F41-R56 PolarHBondContact N-O 2.96Å; F41-R56 PolarHBondContact O-N 3.1Å; R56-Y58 HydrophobicContact CB-CE2 4.07Å; R56-Y58 HydrophobicContact CG-CD2 4.48Å; R56-Y58 HydrophobicContact CG-CE2 4.28Å; R56-Y58 WeakPolarHBondContact O-CD2 3.4Å; R56-P68 HydrophobicContact CG-CB 4.33Å; R56-G69 PolarHBondContact NH1-O 2.86Å
57	E	96.2	Very high	94.5	Very high	49 Å²	49	79 Å²	79	23%	0.229	41%	0.414	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.6	129.1	168.3	-173.8	174.3	107.2	0	0	109.4	R40 G69 K71	R40-E57 HydrophobicContact CG-CB 4.02Å; R40-E57 HydrophobicContact CG-CG 4.26Å; R40-E57 IonicContact CZ-OE2 3.79Å; R40-E57 IonicContact NE-OE2 3.37Å; R40-E57 PolarHBondContact NE-OE2 2.78Å; R40-E57 IonicContact NH2-OE2 3.26Å; R40-E57 PolarHBondContact NH2-OE2 2.89Å; E57-G69 VanDerWaalsContact O-CA 3.23Å; E57-G69 WeakPolarHBondContact O-CA 3.34Å; E57-G69 PolarHBondContact O-N 3.25Å; E57-K71 HydrophobicContact CB-CB 4.1Å; E57-K71 PolarHBondContact N-O 3.07Å; E57-K71 WeakPolarHBondContact OE1-CD 3.49Å; E57-K71 IonicContact OE1-NZ 2.83Å; E57-K71 PolarHBondContact OE1-NZ 3Å; E57-K71 IonicContact OE2-NZ 3.6Å
58	Y	96.3	Very high	94.7	Very high	37 Å²	37	76.9 Å²	76.9	15%	0.145	41%	0.412	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.7	152.4	175.8	-75.4	-114.6	0	0	0	109.8	K39 F41 R56 E66 K67 P68	K39-Y58 WeakPolarHBondContact CB-O 3.37Å; K39-Y58 PolarHBondContact O-N 2.86Å; F41-Y58 HydrophobicContact CB-CD2 4.37Å; F41-Y58 HydrophobicContact CB-CE2 4.04Å; F41-Y58 AromaticContact CD2-CD2 3.49Å; F41-Y58 HydrophobicContact CD2-CD2 3.49Å; F41-Y58 VanDerWaalsContact CD2-CD2 3.49Å; F41-Y58 AromaticContact CD2-CE2 3.98Å; F41-Y58 HydrophobicContact CD2-CE2 3.98Å; F41-Y58 HydrophobicContact CD2-CG 4.02Å; F41-Y58 HydrophobicContact CE2-CD2 4.24Å; F41-Y58 HydrophobicContact CE2-CG 4.34Å; F41-Y58 HydrophobicContact CG-CD2 4.32Å; F41-Y58 HydrophobicContact CG-CE2 4.37Å; R56-Y58 HydrophobicContact CB-CE2 4.07Å; R56-Y58 HydrophobicContact CG-CD2 4.48Å; R56-Y58 HydrophobicContact CG-CE2 4.28Å; R56-Y58 WeakPolarHBondContact O-CD2 3.4Å; Y58-E66 HydrophobicContact CD1-CB 4.33Å; Y58-K67 CarbonylContact C-O 3.56Å; Y58-K67 VanDerWaalsContact CA-O 3.23Å; Y58-K67 WeakPolarHBondContact CA-O 3.35Å; Y58-K67 WeakPolarHBondContact CB-O 3.48Å; Y58-K67 WeakPolarHBondContact CD1-O 3.47Å; Y58-P68 HydrophobicContact CD1-CB 4.48Å; Y58-P68 HydrophobicContact CE1-CB 4.06Å
59	Y	95.3	Very high	94.7	Very high	119 Å²	119	67 Å²	67	47%	0.467	38%	0.379	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.2	153.3	172.2	70.1	-83.3	0	0	0	109.7	T61 E66 K67	Y59-T61 HydrophobicContact CE2-CG2 3.93Å; Y59-E66 WeakPolarHBondContact O-CA 3.41Å; Y59-K67 HydrophobicContact CD1-CB 4.4Å; Y59-K67 VanDerWaalsContact CD1-O 3.27Å; Y59-K67 WeakPolarHBondContact CD1-O 3.4Å; Y59-K67 HydrophobicContact CE1-CB 3.76Å; Y59-K67 HydrophobicContact CE2-CB 4.31Å; Y59-K67 PolarHBondContact N-O 2.97Å; Y59-K67 PolarHBondContact O-N 3.25Å
60	T	94.7	Very high	94.8	Very high	61 Å²	61	73.9 Å²	73.9	37%	0.374	39%	0.39	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.6	127.7	177.2	-45.6	0	0	0	0	108.5	K39 E65	K39-T60 PolarHBondContact NZ-OG1 2.82Å; T60-E65 CarbonylContact C-O 3.58Å; T60-E65 WeakPolarHBondContact CA-O 3.45Å
61	T	94.6	Very high	94.9	Very high	26 Å²	26	71.6 Å²	71.6	16%	0.16	39%	0.385	C	S	.	.			trans	-73.6	168.5	173.4	65.9	0	0	0	0	111	Y59 D63 G64 E65 K67	Y59-T61 HydrophobicContact CE2-CG2 3.93Å; T61-D63 PolarHBondContact O-N 3.39Å; T61-D63 PolarHBondContact OG1-N 2.87Å; T61-G64 PolarHBondContact O-N 2.94Å; T61-E65 PolarHBondContact N-O 2.91Å; T61-E65 PolarHBondContact OG1-N 2.76Å; T61-E65 PolarHBondContact OG1-O 3.04Å; T61-K67 HydrophobicContact CG2-CB 4.5Å; T61-K67 HydrophobicContact CG2-CD 3.59Å; T61-K67 HydrophobicContact CG2-CG 3.98Å
62	G	95.2	Very high	95	Very high	89 Å²	89	70.5 Å²	70.5	92%	0.918	39%	0.388	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.1	-25.6	173.1	0	0	0	0	0	113.3	G64	G62-G64 VanDerWaalsContact C-N 3.27Å; G62-G64 PolarHBondContact O-N 2.78Å
63	D	95.2	Very high	95	Very high	139 Å²	139	72.8 Å²	72.8	74%	0.743	40%	0.401	S	S	*	.	T	Hydrogen-bonded Turn	trans	-81	-3.6	177.1	-42.1	-77.8	0	0	0	113.4	T61	T61-D63 PolarHBondContact O-N 3.39Å; T61-D63 PolarHBondContact OG1-N 2.87Å
64	G	93.3	Very high	95	Very high	54 Å²	54	75 Å²	75	56%	0.557	42%	0.417	S	S	*	.	S	Bend	trans	88.3	1.1	-178.3	0	0	0	0	0	115.2	T61 G62	T61-G64 PolarHBondContact O-N 2.94Å; G62-G64 VanDerWaalsContact C-N 3.27Å; G62-G64 PolarHBondContact O-N 2.78Å
65	E	92.9	Very high	95.1	Very high	104 Å²	104	75.2 Å²	75.2	49%	0.486	42%	0.418	S	S	.	.			trans	-79.8	139.8	179.6	-60	179.6	162.8	0	0	111.6	T60 T61 K67	T60-E65 CarbonylContact C-O 3.58Å; T60-E65 WeakPolarHBondContact CA-O 3.45Å; T61-E65 PolarHBondContact N-O 2.91Å; T61-E65 PolarHBondContact OG1-N 2.76Å; T61-E65 PolarHBondContact OG1-O 3.04Å; E65-K67 WeakPolarHBondContact OE2-CE 3.03Å; E65-K67 IonicContact OE2-NZ 2.75Å; E65-K67 PolarHBondContact OE2-NZ 3.17Å
66	E	91	Very high	95.1	Very high	82 Å²	82	74.6 Å²	74.6	38%	0.383	42%	0.418	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.6	124.2	170.8	-63.1	-160.6	124.3	0	0	111.2	R33 Y58 Y59	R33-E66 IonicContact CZ-OE2 3.62Å; R33-E66 IonicContact NH1-OE2 3.64Å; R33-E66 IonicContact NH2-OE2 2.75Å; R33-E66 PolarHBondContact NH2-OE2 2.76Å; Y58-E66 HydrophobicContact CD1-CB 4.33Å; Y59-E66 WeakPolarHBondContact O-CA 3.41Å
67	K	92.8	Very high	95.1	Very high	76 Å²	76	75 Å²	75	33%	0.33	43%	0.426	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.3	145.5	178.7	-69.2	-172.6	-177.8	161.5	0	112	Y58 Y59 T61 E65 G69	Y58-K67 CarbonylContact C-O 3.56Å; Y58-K67 VanDerWaalsContact CA-O 3.23Å; Y58-K67 WeakPolarHBondContact CA-O 3.35Å; Y58-K67 WeakPolarHBondContact CB-O 3.48Å; Y58-K67 WeakPolarHBondContact CD1-O 3.47Å; Y59-K67 HydrophobicContact CD1-CB 4.4Å; Y59-K67 VanDerWaalsContact CD1-O 3.27Å; Y59-K67 WeakPolarHBondContact CD1-O 3.4Å; Y59-K67 HydrophobicContact CE1-CB 3.76Å; Y59-K67 HydrophobicContact CE2-CB 4.31Å; Y59-K67 PolarHBondContact N-O 2.97Å; Y59-K67 PolarHBondContact O-N 3.25Å; T61-K67 HydrophobicContact CG2-CB 4.5Å; T61-K67 HydrophobicContact CG2-CD 3.59Å; T61-K67 HydrophobicContact CG2-CG 3.98Å; E65-K67 WeakPolarHBondContact OE2-CE 3.03Å; E65-K67 IonicContact OE2-NZ 2.75Å; E65-K67 PolarHBondContact OE2-NZ 3.17Å; K67-G69 PolarHBondContact O-N 3.18Å
68	P	94.7	Very high	95.1	Very high	75 Å²	75	80 Å²	80	49%	0.487	45%	0.45	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-62	123.7	177.4	24	-33.1	0	0	0	110.4	R56 Y58	R56-P68 HydrophobicContact CG-CB 4.33Å; Y58-P68 HydrophobicContact CD1-CB 4.48Å; Y58-P68 HydrophobicContact CE1-CB 4.06Å
69	G	94.6	Very high	95.2	Very high	15 Å²	15	83.2 Å²	83.2	16%	0.155	47%	0.466	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.4	174.4	175.6	0	0	0	0	0	113.1	R56 E57 K67 K71	R56-G69 PolarHBondContact NH1-O 2.86Å; E57-G69 VanDerWaalsContact O-CA 3.23Å; E57-G69 WeakPolarHBondContact O-CA 3.34Å; E57-G69 PolarHBondContact O-N 3.25Å; K67-G69 PolarHBondContact O-N 3.18Å; G69-K71 VanDerWaalsContact C-N 3.3Å; G69-K71 PolarHBondContact O-N 3.28Å
70	K	95	Very high	95.3	Very high	209 Å²	209	80.9 Å²	80.9	91%	0.909	46%	0.458	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-68.3	-28.9	175.6	-66.7	-177.6	-179.1	178.9	0	112.7	G72	K70-G72 PolarHBondContact O-N 2.85Å
71	K	96.5	Very high	95.4	Very high	132 Å²	132	84.8 Å²	84.8	57%	0.574	47%	0.47	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-78.9	114.9	-179.8	-62	-176.6	-159.6	150.9	0	110.3	E57 G69	E57-K71 HydrophobicContact CB-CB 4.1Å; E57-K71 PolarHBondContact N-O 3.07Å; E57-K71 WeakPolarHBondContact OE1-CD 3.49Å; E57-K71 IonicContact OE1-NZ 2.83Å; E57-K71 PolarHBondContact OE1-NZ 3Å; E57-K71 IonicContact OE2-NZ 3.6Å; G69-K71 VanDerWaalsContact C-N 3.3Å; G69-K71 PolarHBondContact O-N 3.28Å
72	G	95.6	Very high	95.5	Very high	44 Å²	44	90.5 Å²	90.5	45%	0.454	49%	0.492	S	S	.	.	E	Extended strand (participates in β ladder)	trans	160.6	170.8	176.4	0	0	0	0	0	111.9	I55 K70	I55-G72 CarbonylContact O-C 3.53Å; I55-G72 WeakPolarHBondContact O-CA 3.5Å; K70-G72 PolarHBondContact O-N 2.85Å
73	I	97.3	Very high	95.6	Very high	95 Å²	95	91 Å²	91	49%	0.487	47%	0.469	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.4	142.9	178.7	-171	165.1	0	0	0	109.9	D54 I55 L75	D54-I73 WeakPolarHBondContact CA-O 3.45Å; I55-I73 HydrophobicContact CB-CG2 4.29Å; I55-I73 PolarHBondContact N-O 2.91Å; I55-I73 PolarHBondContact O-N 3Å; I73-L75 HydrophobicContact CD1-CD2 3.79Å; I73-L75 HydrophobicContact CG1-CD2 3.93Å; I73-L75 HydrophobicContact CG2-CD2 4.26Å; I73-L75 HydrophobicContact CG2-CG 4.29Å
74	S	96.3	Very high	95.7	Very high	55 Å²	55	87.9 Å²	87.9	39%	0.385	46%	0.455	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.9	111.1	171.4	-63.8	0	0	0	0	108.3	D54	D54-S74 WeakPolarHBondContact OD1-CA 3.41Å; D54-S74 WeakPolarHBondContact OD1-CB 3.24Å; D54-S74 PolarHBondContact OD1-OG 2.95Å
75	L	97.2	Very high	95.9	Very high	21 Å²	21	89.2 Å²	89.2	11%	0.11	46%	0.456	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.1	138.6	-179.9	-60.2	176.8	0	0	0	110	F52 I53 I55 I73 Q79 F80	F52-L75 CarbonylContact C-O 3.46Å; F52-L75 VanDerWaalsContact CA-O 3.27Å; F52-L75 WeakPolarHBondContact CA-O 3.45Å; I53-L75 HydrophobicContact CB-CB 4.48Å; I53-L75 PolarHBondContact N-O 2.87Å; I53-L75 PolarHBondContact O-N 2.53Å; I55-L75 HydrophobicContact CD1-CD1 4.01Å; I73-L75 HydrophobicContact CD1-CD2 3.79Å; I73-L75 HydrophobicContact CG1-CD2 3.93Å; I73-L75 HydrophobicContact CG2-CD2 4.26Å; I73-L75 HydrophobicContact CG2-CG 4.29Å; L75-Q79 HydrophobicContact CB-CB 4.2Å; L75-Q79 HydrophobicContact CD2-CB 4.2Å; L75-F80 HydrophobicContact CB-CB 4.49Å; L75-F80 HydrophobicContact CD1-CD2 4.44Å
76	S	96.7	Very high	96.2	Very high	33 Å²	33	88 Å²	88	23%	0.231	45%	0.453	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-66.9	160	163.1	75.9	0	0	0	0	110.3	E78 Q79 F80	S76-E78 PolarHBondContact O-N 2.89Å; S76-E78 PolarHBondContact OG-N 2.75Å; S76-Q79 PolarHBondContact O-N 2.85Å; S76-Q79 VanDerWaalsContact O-N 3.12Å; S76-Q79 WeakPolarHBondContact OG-CG 3.25Å; S76-Q79 PolarHBondContact OG-N 2.78Å; S76-F80 PolarHBondContact O-N 2.9Å
77	V	95.8	Very high	96.5	Very high	59 Å²	59	86.2 Å²	86.2	36%	0.358	45%	0.447	S	S	.	.	H	α-helix	trans	-54.7	-36.5	173.7	179.1	0	0	0	0	111.9	T51 I53 K81	T51-V77 HydrophobicContact CG2-CG2 4.3Å; I53-V77 HydrophobicContact CD1-CG2 4.11Å; V77-K81 HydrophobicContact CG1-CD 4.3Å; V77-K81 VanDerWaalsContact O-CG 3.31Å; V77-K81 WeakPolarHBondContact O-CG 3.45Å; V77-K81 PolarHBondContact O-N 3.45Å
78	E	96.9	Very high	96.6	Very high	156 Å²	156	86 Å²	86	73%	0.729	45%	0.454	S	S	*	.	H	α-helix	trans	-66.7	-45.6	177.4	-174.2	-177.9	-179.8	0	0	112.1	S76 F80 K81 K82	S76-E78 PolarHBondContact O-N 2.89Å; S76-E78 PolarHBondContact OG-N 2.75Å; E78-F80 VanDerWaalsContact C-N 3.33Å; E78-F80 PolarHBondContact O-N 3.28Å; E78-K81 PolarHBondContact O-N 2.9Å; E78-K82 PolarHBondContact O-N 3.02Å
79	Q	97.6	Very high	96.7	Very high	103 Å²	103	89.2 Å²	89.2	48%	0.481	46%	0.46	S	S	.	.	H	α-helix	trans	-63	-41.4	176.4	-71.9	170.3	-29.6	0	0	111.3	L75 S76 K82 F83	L75-Q79 HydrophobicContact CB-CB 4.2Å; L75-Q79 HydrophobicContact CD2-CB 4.2Å; S76-Q79 PolarHBondContact O-N 2.85Å; S76-Q79 VanDerWaalsContact O-N 3.12Å; S76-Q79 WeakPolarHBondContact OG-CG 3.25Å; S76-Q79 PolarHBondContact OG-N 2.78Å; Q79-K82 PolarHBondContact O-N 3.34Å; Q79-F83 WeakPolarHBondContact O-CB 3.37Å; Q79-F83 PolarHBondContact O-N 3.27Å
80	F	96.8	Very high	96.7	Very high	70 Å²	70	91.9 Å²	91.9	31%	0.307	47%	0.47	S	S	.	.	H	α-helix	trans	-63.3	-45.8	177	-177.9	-101.8	0	0	0	111.9	I53 L75 S76 E78 K82 F83 V84	I53-F80 HydrophobicContact CB-CB 4.49Å; I53-F80 HydrophobicContact CB-CD2 4.16Å; I53-F80 HydrophobicContact CB-CG 4.37Å; I53-F80 HydrophobicContact CD1-CB 3.69Å; I53-F80 HydrophobicContact CD1-CD1 4.38Å; I53-F80 HydrophobicContact CD1-CG 4Å; I53-F80 HydrophobicContact CG1-CB 4.07Å; I53-F80 HydrophobicContact CG1-CD1 4.28Å; I53-F80 HydrophobicContact CG1-CD2 4.1Å; I53-F80 HydrophobicContact CG1-CG 3.88Å; I53-F80 HydrophobicContact CG2-CD2 3.89Å; I53-F80 HydrophobicContact CG2-CE2 4.07Å; L75-F80 HydrophobicContact CB-CB 4.49Å; L75-F80 HydrophobicContact CD1-CD2 4.44Å; S76-F80 PolarHBondContact O-N 2.9Å; E78-F80 VanDerWaalsContact C-N 3.33Å; E78-F80 PolarHBondContact O-N 3.28Å; F80-K82 VanDerWaalsContact C-N 3.3Å; F80-K82 PolarHBondContact O-N 3.43Å; F80-F83 WeakPolarHBondContact O-CB 3.27Å; F80-F83 PolarHBondContact O-N 3.45Å; F80-F83 VanDerWaalsContact O-N 3.17Å; F80-V84 HydrophobicContact CD1-CG2 4.2Å; F80-V84 HydrophobicContact CE1-CG2 3.78Å; F80-V84 HydrophobicContact CE2-CG2 4.25Å; F80-V84 HydrophobicContact CZ-CG2 3.81Å; F80-V84 WeakPolarHBondContact O-CG2 3.43Å; F80-V84 PolarHBondContact O-N 3.22Å
81	K	97.3	Very high	96.7	Very high	143 Å²	143	86.4 Å²	86.4	62%	0.622	45%	0.448	S	S	*	.	H	α-helix	trans	-58.2	-42.8	174.8	-75.6	175.8	178.3	-176.4	0	112.2	V77 E78 V84 S85	V77-K81 HydrophobicContact CG1-CD 4.3Å; V77-K81 VanDerWaalsContact O-CG 3.31Å; V77-K81 WeakPolarHBondContact O-CG 3.45Å; V77-K81 PolarHBondContact O-N 3.45Å; E78-K81 PolarHBondContact O-N 2.9Å; K81-V84 PolarHBondContact O-N 3.21Å; K81-S85 PolarHBondContact O-N 2.96Å
82	K	97.8	Very high	96.5	Very high	146 Å²	146	84.3 Å²	84.3	64%	0.635	44%	0.443	S	S	*	.	H	α-helix	trans	-65.1	-41.4	176.5	-169.5	169.9	-174.9	172.6	0	111.7	E78 Q79 F80 S85 L86	E78-K82 PolarHBondContact O-N 3.02Å; Q79-K82 PolarHBondContact O-N 3.34Å; F80-K82 VanDerWaalsContact C-N 3.3Å; F80-K82 PolarHBondContact O-N 3.43Å; K82-S85 PolarHBondContact O-N 2.87Å; K82-S85 PolarHBondContact O-OG 2.87Å; K82-L86 WeakPolarHBondContact O-CG 3.29Å; K82-L86 PolarHBondContact O-N 3.21Å
83	F	97.3	Very high	96.4	Very high	99 Å²	99	85.3 Å²	85.3	43%	0.434	44%	0.44	S	S	.	.	H	α-helix	trans	-58.1	-50.8	173.9	174.7	-104.6	0	0	0	111.2	Q79 F80 S85 L86 V87 I90	Q79-F83 WeakPolarHBondContact O-CB 3.37Å; Q79-F83 PolarHBondContact O-N 3.27Å; F80-F83 WeakPolarHBondContact O-CB 3.27Å; F80-F83 PolarHBondContact O-N 3.45Å; F80-F83 VanDerWaalsContact O-N 3.17Å; F83-S85 VanDerWaalsContact C-N 3.31Å; F83-S85 PolarHBondContact O-N 3.47Å; F83-L86 WeakPolarHBondContact O-CA 3.48Å; F83-L86 WeakPolarHBondContact O-CB 2.99Å; F83-L86 PolarHBondContact O-N 2.75Å; F83-V87 HydrophobicContact CE1-CG2 4.39Å; F83-V87 PolarHBondContact O-N 3.27Å; F83-I90 HydrophobicContact CE2-CD1 4.12Å
84	V	97.3	Very high	96.2	Very high	74 Å²	74	84 Å²	84	45%	0.448	43%	0.433	S	S	.	.	H	α-helix	trans	-58.4	-40.9	177.5	175	0	0	0	0	111.8	F80 K81 L86 V87	F80-V84 HydrophobicContact CD1-CG2 4.2Å; F80-V84 HydrophobicContact CE1-CG2 3.78Å; F80-V84 HydrophobicContact CE2-CG2 4.25Å; F80-V84 HydrophobicContact CZ-CG2 3.81Å; F80-V84 WeakPolarHBondContact O-CG2 3.43Å; F80-V84 PolarHBondContact O-N 3.22Å; K81-V84 PolarHBondContact O-N 3.21Å; V84-L86 PolarHBondContact O-N 3.41Å; V84-V87 WeakPolarHBondContact O-CB 3.01Å; V84-V87 PolarHBondContact O-N 2.78Å; V84-V87 VanDerWaalsContact O-N 3.1Å
85	S	97.8	Very high	96	Very high	83 Å²	83	88.5 Å²	88.5	58%	0.58	44%	0.442	S	S	*	.	H	α-helix	trans	-63.9	-21.4	176.7	74.7	0	0	0	0	114.2	K81 K82 F83	K81-S85 PolarHBondContact O-N 2.96Å; K82-S85 PolarHBondContact O-N 2.87Å; K82-S85 PolarHBondContact O-OG 2.87Å; F83-S85 VanDerWaalsContact C-N 3.31Å; F83-S85 PolarHBondContact O-N 3.47Å
86	L	97.5	Very high	95.7	Very high	78 Å²	78	94 Å²	94	41%	0.408	47%	0.471	S	S	.	.	H	α-helix	trans	-92.3	-11.3	178.1	-67.8	170.5	0	0	0	112.4	K82 F83 V84 K89 I90	K82-L86 WeakPolarHBondContact O-CG 3.29Å; K82-L86 PolarHBondContact O-N 3.21Å; F83-L86 WeakPolarHBondContact O-CA 3.48Å; F83-L86 WeakPolarHBondContact O-CB 2.99Å; F83-L86 PolarHBondContact O-N 2.75Å; V84-L86 PolarHBondContact O-N 3.41Å; L86-K89 WeakPolarHBondContact O-CB 3.49Å; L86-K89 PolarHBondContact O-N 2.97Å; L86-K89 VanDerWaalsContact O-N 3.07Å; L86-I90 HydrophobicContact CB-CD1 4.21Å; L86-I90 WeakPolarHBondContact O-CG1 3.49Å; L86-I90 PolarHBondContact O-N 2.84Å
87	V	97	Very high	95.3	Very high	44 Å²	44	99.5 Å²	99.5	27%	0.267	49%	0.491	S	S	.	.	H	α-helix	trans	-52.6	-47.8	-177.6	169.2	0	0	0	0	112.4	F83 V84 K89 I90 E91	F83-V87 HydrophobicContact CE1-CG2 4.39Å; F83-V87 PolarHBondContact O-N 3.27Å; V84-V87 WeakPolarHBondContact O-CB 3.01Å; V84-V87 PolarHBondContact O-N 2.78Å; V84-V87 VanDerWaalsContact O-N 3.1Å; V87-K89 VanDerWaalsContact C-N 3.29Å; V87-K89 PolarHBondContact O-N 3.29Å; V87-I90 CarbonylContact O-C 3.54Å; V87-I90 WeakPolarHBondContact O-CA 3.23Å; V87-I90 WeakPolarHBondContact O-CB 3.47Å; V87-I90 PolarHBondContact O-N 2.91Å; V87-E91 HydrophobicContact CG1-CG 4.25Å; V87-E91 WeakPolarHBondContact CG1-OE1 3.24Å; V87-E91 WeakPolarHBondContact O-CG 3.32Å; V87-E91 PolarHBondContact O-N 2.79Å
88	P	96	Very high	94.7	Very high	72 Å²	72	104.5 Å²	104.5	47%	0.468	51%	0.505	S	S	.	.	H	α-helix	trans	-59.3	-40.6	178.5	-25.1	35	0	0	0	112.9	I90 E91 D92	P88-I90 VanDerWaalsContact C-N 3.31Å; P88-I90 PolarHBondContact O-N 2.94Å; P88-E91 WeakPolarHBondContact O-CB 3.42Å; P88-E91 PolarHBondContact O-N 3.42Å; P88-D92 PolarHBondContact O-N 2.93Å
89	K	95.8	Very high	93.4	Very high	142 Å²	142	104.3 Å²	104.3	62%	0.617	51%	0.509	S	S	*	.	H	α-helix	trans	-67.9	-33.5	176.7	-174.9	175.9	-178.2	175.5	0	112	L86 V87 V93	L86-K89 WeakPolarHBondContact O-CB 3.49Å; L86-K89 PolarHBondContact O-N 2.97Å; L86-K89 VanDerWaalsContact O-N 3.07Å; V87-K89 VanDerWaalsContact C-N 3.29Å; V87-K89 PolarHBondContact O-N 3.29Å; K89-V93 VanDerWaalsContact O-CG2 3.29Å; K89-V93 WeakPolarHBondContact O-CG2 3.39Å; K89-V93 PolarHBondContact O-N 3.29Å
90	I	95.3	Very high	91.6	Very high	71 Å²	71	107.3 Å²	107.3	36%	0.364	52%	0.523	S	S	.	.	H	α-helix	trans	-67.6	-43.9	174.5	-66.6	164.3	0	0	0	109.4	F83 L86 V87 P88 V93 L94	F83-I90 HydrophobicContact CE2-CD1 4.12Å; L86-I90 HydrophobicContact CB-CD1 4.21Å; L86-I90 WeakPolarHBondContact O-CG1 3.49Å; L86-I90 PolarHBondContact O-N 2.84Å; V87-I90 CarbonylContact O-C 3.54Å; V87-I90 WeakPolarHBondContact O-CA 3.23Å; V87-I90 WeakPolarHBondContact O-CB 3.47Å; V87-I90 PolarHBondContact O-N 2.91Å; P88-I90 VanDerWaalsContact C-N 3.31Å; P88-I90 PolarHBondContact O-N 2.94Å; I90-V93 PolarHBondContact O-N 3.43Å; I90-L94 HydrophobicContact CG2-CD1 3.87Å; I90-L94 HydrophobicContact CG2-CG 4.21Å; I90-L94 WeakPolarHBondContact O-CB 3.23Å; I90-L94 VanDerWaalsContact O-CG 3.27Å; I90-L94 WeakPolarHBondContact O-CG 3.27Å; I90-L94 PolarHBondContact O-N 3.17Å
91	E	94.3	Very high	89.6	Confident	94 Å²	94	110.9 Å²	110.9	44%	0.439	55%	0.55	S	S	.	*	H	α-helix	trans	-59.7	-44.8	176.1	-70.8	170.7	173	0	0	112	V87 P88 V93 L94 R95	V87-E91 HydrophobicContact CG1-CG 4.25Å; V87-E91 WeakPolarHBondContact CG1-OE1 3.24Å; V87-E91 WeakPolarHBondContact O-CG 3.32Å; V87-E91 PolarHBondContact O-N 2.79Å; P88-E91 WeakPolarHBondContact O-CB 3.42Å; P88-E91 PolarHBondContact O-N 3.42Å; E91-V93 PolarHBondContact O-N 3.42Å; E91-L94 PolarHBondContact O-N 2.81Å; E91-R95 WeakPolarHBondContact O-CB 3.36Å; E91-R95 PolarHBondContact O-N 3.37Å
92	D	93.9	Very high	87.4	Confident	89 Å²	89	112.1 Å²	112.1	48%	0.476	56%	0.563	S	S	.	*	H	α-helix	trans	-57.1	-48.4	174.6	-69.4	-26.3	0	0	0	111.2	P88 L94 R95 D96	P88-D92 PolarHBondContact O-N 2.93Å; D92-L94 VanDerWaalsContact C-N 3.33Å; D92-L94 PolarHBondContact O-N 3.23Å; D92-R95 PolarHBondContact O-N 3.48Å; D92-D96 PolarHBondContact O-N 3.01Å
93	V	93.3	Very high	86.9	Confident	65 Å²	65	110.4 Å²	110.4	39%	0.394	56%	0.559	S	S	.	*	H	α-helix	trans	-66.4	-34.6	178.9	173.4	0	0	0	0	112.1	K89 I90 E91 K97	K89-V93 VanDerWaalsContact O-CG2 3.29Å; K89-V93 WeakPolarHBondContact O-CG2 3.39Å; K89-V93 PolarHBondContact O-N 3.29Å; I90-V93 PolarHBondContact O-N 3.43Å; E91-V93 PolarHBondContact O-N 3.42Å; V93-K97 HydrophobicContact CG1-CD 4.11Å; V93-K97 WeakPolarHBondContact O-CB 3.47Å; V93-K97 WeakPolarHBondContact O-CG 3.49Å; V93-K97 PolarHBondContact O-N 3.37Å
94	L	93.3	Very high	86.4	Confident	66 Å²	66	111 Å²	111	35%	0.346	57%	0.566	S	S	.	*	H	α-helix	trans	-66.9	-44.5	176.5	-75.4	172.7	0	0	0	110.8	I90 E91 D92 K97 Y98 L102	I90-L94 HydrophobicContact CG2-CD1 3.87Å; I90-L94 HydrophobicContact CG2-CG 4.21Å; I90-L94 WeakPolarHBondContact O-CB 3.23Å; I90-L94 VanDerWaalsContact O-CG 3.27Å; I90-L94 WeakPolarHBondContact O-CG 3.27Å; I90-L94 PolarHBondContact O-N 3.17Å; E91-L94 PolarHBondContact O-N 2.81Å; D92-L94 VanDerWaalsContact C-N 3.33Å; D92-L94 PolarHBondContact O-N 3.23Å; L94-K97 PolarHBondContact O-N 3.44Å; L94-Y98 HydrophobicContact CD2-CD2 3.88Å; L94-Y98 HydrophobicContact CD2-CE2 4.16Å; L94-Y98 WeakPolarHBondContact O-CB 3.44Å; L94-Y98 PolarHBondContact O-N 2.81Å; L94-L102 HydrophobicContact CB-CD1 3.76Å; L94-L102 HydrophobicContact CD1-CD1 3.87Å; L94-L102 HydrophobicContact CG-CD1 4.45Å
95	R	91.1	Very high	85.8	Confident	150 Å²	150	113.1 Å²	113.1	57%	0.566	57%	0.573	S	S	*	*	H	α-helix	trans	-59.8	-46.9	176	-173.8	177.5	-67.5	155.8	1.2	111.6	E91 D92 K97 D99	E91-R95 WeakPolarHBondContact O-CB 3.36Å; E91-R95 PolarHBondContact O-N 3.37Å; D92-R95 PolarHBondContact O-N 3.48Å; R95-K97 PolarHBondContact O-N 2.83Å; R95-D99 PolarHBondContact O-N 3.26Å
96	D	90.4	Very high	85.1	Confident	136 Å²	136	114.8 Å²	114.8	73%	0.727	57%	0.572	S	S	*	*	H	α-helix	trans	-66.9	-32.5	-177.9	-73.4	-11.2	0	0	0	113.8	D92	D92-D96 PolarHBondContact O-N 3.01Å
97	K	88.9	Confident	84.3	Confident	150 Å²	150	117.1 Å²	117.1	65%	0.652	58%	0.582	S	S	*	*	H	α-helix	trans	-99	-29.7	-173.1	-73.4	-169.7	175.1	-173.9	0	114.8	V93 L94 R95	V93-K97 HydrophobicContact CG1-CD 4.11Å; V93-K97 WeakPolarHBondContact O-CB 3.47Å; V93-K97 WeakPolarHBondContact O-CG 3.49Å; V93-K97 PolarHBondContact O-N 3.37Å; L94-K97 PolarHBondContact O-N 3.44Å; R95-K97 PolarHBondContact O-N 2.83Å
98	Y	83.8	Confident	83.4	Confident	163 Å²	163	122 Å²	122	64%	0.639	60%	0.603	S	S	*	*	H	α-helix	trans	-118.9	2.2	-167.9	-63.3	-78.1	0	0	0	114	L94 E100	L94-Y98 HydrophobicContact CD2-CD2 3.88Å; L94-Y98 HydrophobicContact CD2-CE2 4.16Å; L94-Y98 WeakPolarHBondContact O-CB 3.44Å; L94-Y98 PolarHBondContact O-N 2.81Å; Y98-E100 PolarHBondContact O-N 2.91Å
99	D	69.5	Low	82.5	Confident	153 Å²	153	125.6 Å²	125.6	82%	0.818	61%	0.613	S	S	*	*			trans	40.5	34.8	160.2	-138.1	-3.5	0	0	0	116.3	R95	R95-D99 PolarHBondContact O-N 3.26Å
100	E	59.3	Low	81.5	Confident	166 Å²	166	124.3 Å²	124.3	78%	0.776	61%	0.613	S	S	*	*	S	Bend	trans	-142.6	121.8	175.7	-71.1	-147.8	155.9	0	0	110.1	Y98 L102	Y98-E100 PolarHBondContact O-N 2.91Å; E100-L102 PolarHBondContact O-N 3.2Å
101	T	54.7	Low	80.4	Confident	144 Å²	144	128.8 Å²	128.8	88%	0.883	63%	0.633	S	S	*	*			trans	0.8	95.9	164.8	50.1	0	0	0	0	116.4
102	L	52.1	Low	79.1	Confident	169 Å²	169	131.9 Å²	131.9	89%	0.885	65%	0.651	S	S	*	*			trans	-106.7	0	153.3	-83.9	165.4	0	0	0	108.8	L94 E100	L94-L102 HydrophobicContact CB-CD1 3.76Å; L94-L102 HydrophobicContact CD1-CD1 3.87Å; L94-L102 HydrophobicContact CG-CD1 4.45Å; E100-L102 PolarHBondContact O-N 3.2Å

Retrieved 102 of 102 residues in 38 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).