A0A077ZA26_TRITR Loading...

NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

AlphaFold DB , UniProt , Accession A0A077ZA26, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 126 aa.

						>A0A077ZA26_TRITR|A0A077ZA26
MPPPNVGITETSTDAPSQISGVPDEHQKQRRVRIFMPAKVATQAGTDNTHVWKIEVDTQQRWESLLTGWCSNADPLSNIAMALNFHTAEAAAQFCERIVPAQKHELFIKSYGANFSWDKRTRVAQK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50.4	Low	49.3	Very low	235 Å²	235	135.8 Å²	135.8	100%	1.158	79%	0.785	S	S	*	*				0	121.7	0	-71.3	-172.8	170.5	0	0	107.7
2	P	56.2	Low	49.6	Very low	119 Å²	119	130.5 Å²	130.5	77%	0.773	76%	0.761	S	S	*	*	P	Polyproline II helix	trans	-74.6	148.3	169.1	32.4	-30.1	0	0	0	109.2
3	P	58	Low	50.3	Low	116 Å²	116	127.7 Å²	127.7	75%	0.753	75%	0.747	S	S	*	*	P	Polyproline II helix	trans	-63.1	146.8	176.2	27.6	-33.2	0	0	0	110	N5	P3-N5 PolarHBondContact O-N 3.17Å; P3-N5 VanDerWaalsContact O-N 3.17Å
4	P	54.7	Low	50.9	Low	112 Å²	112	125.9 Å²	125.9	73%	0.727	73%	0.733	S	S	*	*	P	Polyproline II helix	trans	-60	123.7	177.4	25.4	-32.1	0	0	0	108.8	V6	P4-V6 VanDerWaalsContact C-N 3.27Å; P4-V6 PolarHBondContact O-N 3.06Å
5	N	51.8	Low	51.8	Low	160 Å²	160	120.3 Å²	120.3	86%	0.856	71%	0.708	S	S	*	*			trans	-64.6	91.6	172.2	-168.2	16	0	0	0	107	P3 G7	P3-N5 PolarHBondContact O-N 3.17Å; P3-N5 VanDerWaalsContact O-N 3.17Å; N5-G7 VanDerWaalsContact C-N 3.26Å; N5-G7 PolarHBondContact O-N 2.9Å
6	V	51.8	Low	53	Low	123 Å²	123	118.4 Å²	118.4	75%	0.745	70%	0.699	S	S	*	*			trans	-67.6	97.8	171.3	-176.1	0	0	0	0	104.8	P4 I8	P4-V6 VanDerWaalsContact C-N 3.27Å; P4-V6 PolarHBondContact O-N 3.06Å; V6-I8 PolarHBondContact O-N 2.86Å
7	G	41.9	Very low	54	Low	48 Å²	48	113.8 Å²	113.8	50%	0.495	68%	0.675	S	S	.	*			trans	-48.6	127.7	174.9	0	0	0	0	0	108.1	N5 T9	N5-G7 VanDerWaalsContact C-N 3.26Å; N5-G7 PolarHBondContact O-N 2.9Å; G7-T9 VanDerWaalsContact C-N 3.3Å; G7-T9 PolarHBondContact O-N 2.81Å
8	I	41.7	Very low	55.2	Low	163 Å²	163	116.6 Å²	116.6	84%	0.836	68%	0.68	S	S	*	*			trans	-52.7	103.6	172.3	-56.9	159.7	0	0	0	104.8	V6 E10	V6-I8 PolarHBondContact O-N 2.86Å; I8-E10 PolarHBondContact O-N 3.22Å
9	T	42	Very low	56.7	Low	112 Å²	112	118 Å²	118	69%	0.687	68%	0.683	S	S	*	*			trans	-60.4	115.7	172.2	46.6	0	0	0	0	104.8	G7 T11	G7-T9 VanDerWaalsContact C-N 3.3Å; G7-T9 PolarHBondContact O-N 2.81Å; T9-T11 PolarHBondContact O-N 2.73Å
10	E	47.3	Very low	57.9	Low	188 Å²	188	115.4 Å²	115.4	88%	0.879	67%	0.672	S	S	*	*			trans	-56.3	93.4	175.4	-68.1	179.9	163.6	0	0	107.8	I8 S12	I8-E10 PolarHBondContact O-N 3.22Å; E10-S12 PolarHBondContact O-N 2.88Å
11	T	46.8	Very low	59.1	Low	118 Å²	118	113.2 Å²	113.2	72%	0.724	67%	0.674	S	S	*	*			trans	-72.6	87	169.2	50.1	0	0	0	0	105.1	T9 T13	T9-T11 PolarHBondContact O-N 2.73Å; T11-T13 PolarHBondContact O-N 2.82Å
12	S	52.6	Low	60.8	Low	72 Å²	72	104.5 Å²	104.5	50%	0.503	63%	0.634	S	S	.	*			trans	-50.1	113.2	168.3	169.1	0	0	0	0	107.6	E10 D14 A15	E10-S12 PolarHBondContact O-N 2.88Å; S12-D14 PolarHBondContact O-N 3.04Å; S12-A15 WeakPolarHBondContact O-CB 3.01Å; S12-A15 PolarHBondContact O-N 3Å
13	T	58.6	Low	62.2	Low	94 Å²	94	102.5 Å²	102.5	58%	0.577	62%	0.621	S	S	*	*	T	Hydrogen-bonded Turn	trans	-55.1	-24.8	-177.7	-46.2	0	0	0	0	111.8	T11 E96	T11-T13 PolarHBondContact O-N 2.82Å; T13-E96 WeakPolarHBondContact CG2-OE1 3.38Å
14	D	58.3	Low	63.5	Low	102 Å²	102	101.5 Å²	101.5	55%	0.545	61%	0.61	S	S	.	*	T	Hydrogen-bonded Turn	trans	-88.7	-5.5	-178.7	-62.9	-53.1	0	0	0	114.7	S12 S17 Q18	S12-D14 PolarHBondContact O-N 3.04Å; D14-S17 PolarHBondContact O-N 2.82Å; D14-S17 PolarHBondContact O-OG 3.35Å; D14-Q18 PolarHBondContact O-N 3.15Å
15	A	65.4	Low	64.9	Low	43 Å²	43	101.8 Å²	101.8	36%	0.355	60%	0.601	S	S	.	*	H	α-helix	trans	-57.3	-45.4	-176.3	0	0	0	0	0	115.1	S12 S17 I19	S12-A15 WeakPolarHBondContact O-CB 3.01Å; S12-A15 PolarHBondContact O-N 3Å; A15-S17 VanDerWaalsContact C-N 3.32Å; A15-S17 PolarHBondContact O-N 3.01Å; A15-I19 WeakPolarHBondContact O-CD1 3.43Å; A15-I19 WeakPolarHBondContact O-CG1 3.46Å
16	P	70	Confident	66.5	Low	89 Å²	89	95.8 Å²	95.8	58%	0.578	57%	0.568	S	S	*	*	H	α-helix	trans	-70.8	-29	-177	27	-33.2	0	0	0	112.9	I19 S20	P16-I19 PolarHBondContact O-N 3.42Å; P16-S20 PolarHBondContact O-N 3.49Å
17	S	70.7	Confident	67.9	Low	40 Å²	40	92.9 Å²	92.9	28%	0.28	55%	0.546	S	S	.	.	H	α-helix	trans	-68.9	-36.7	-177.8	69.1	0	0	0	0	111.7	D14 A15 S20 Q27	D14-S17 PolarHBondContact O-N 2.82Å; D14-S17 PolarHBondContact O-OG 3.35Å; A15-S17 VanDerWaalsContact C-N 3.32Å; A15-S17 PolarHBondContact O-N 3.01Å; S17-S20 PolarHBondContact O-OG 3.06Å; S17-Q27 PolarHBondContact O-NE2 2.96Å
18	Q	75.3	Confident	69.7	Low	164 Å²	164	98.1 Å²	98.1	77%	0.766	56%	0.555	S	S	*	*	H	α-helix	trans	-70.7	-28.9	177.3	-65.7	-169.2	-17.5	0	0	113.8	D14	D14-Q18 PolarHBondContact O-N 3.15Å
19	I	83.2	Confident	71.8	Confident	144 Å²	144	96.4 Å²	96.4	74%	0.738	54%	0.544	S	S	*	.	H	α-helix	trans	-86.2	-26	-177.8	-60.3	165.7	0	0	0	111.4	A15 P16 G21	A15-I19 WeakPolarHBondContact O-CD1 3.43Å; A15-I19 WeakPolarHBondContact O-CG1 3.46Å; P16-I19 PolarHBondContact O-N 3.42Å; I19-G21 PolarHBondContact O-N 3.38Å; I19-G21 VanDerWaalsContact O-N 3.1Å
20	S	80.4	Confident	73.8	Confident	65 Å²	65	92.8 Å²	92.8	46%	0.455	52%	0.518	S	S	.	.	S	Bend	trans	-63.5	-18.6	-172	74.2	0	0	0	0	115.4	P16 S17 V22 Q27	P16-S20 PolarHBondContact O-N 3.49Å; S17-S20 PolarHBondContact O-OG 3.06Å; S20-V22 PolarHBondContact O-N 2.98Å; S20-V22 VanDerWaalsContact O-N 3.16Å; S20-V22 PolarHBondContact OG-N 3.2Å; S20-Q27 PolarHBondContact OG-NE2 3.4Å
21	G	83.9	Confident	75.6	Confident	71 Å²	71	92.6 Å²	92.6	73%	0.732	51%	0.509	S	S	*	.			trans	68.7	4.2	-176.1	0	0	0	0	0	114.6	I19	I19-G21 PolarHBondContact O-N 3.38Å; I19-G21 VanDerWaalsContact O-N 3.1Å
22	V	85.5	Confident	77.6	Confident	52 Å²	52	89.3 Å²	89.3	32%	0.315	49%	0.488	S	S	.	.			trans	-74.9	129.5	176.3	179.7	0	0	0	0	109	S20 H26 Q27	S20-V22 PolarHBondContact O-N 2.98Å; S20-V22 VanDerWaalsContact O-N 3.16Å; S20-V22 PolarHBondContact OG-N 3.2Å; V22-H26 HydrophobicContact CG1-CB 3.8Å; V22-Q27 HydrophobicContact CB-CG 4.19Å; V22-Q27 HydrophobicContact CG1-CG 3.91Å; V22-Q27 PolarHBondContact O-NE2 3.36Å
23	P	87.2	Confident	79.2	Confident	77 Å²	77	92.4 Å²	92.4	50%	0.5	49%	0.489	S	S	.	.			trans	-58.6	141.3	177.8	-23.4	32.3	0	0	0	112.6	E25 H26 Q27	P23-E25 PolarHBondContact O-N 3.34Å; P23-H26 PolarHBondContact O-N 3.49Å; P23-Q27 PolarHBondContact O-N 3.35Å
24	D	84.3	Confident	80.6	Confident	95 Å²	95	88 Å²	88	51%	0.508	46%	0.462	S	S	.	.	H	α-helix	trans	-48.4	-35.6	178.4	-88.3	30.4	0	0	0	114.2	H26 Q27 K28	D24-H26 VanDerWaalsContact C-N 3.28Å; D24-H26 PolarHBondContact O-N 3.1Å; D24-Q27 PolarHBondContact O-N 2.86Å; D24-Q27 VanDerWaalsContact O-N 3.15Å; D24-K28 PolarHBondContact O-N 2.65Å; D24-K28 IonicContact OD2-NZ 2.82Å; D24-K28 PolarHBondContact OD2-NZ 2.95Å
25	E	85	Confident	82.1	Confident	117 Å²	117	84.5 Å²	84.5	55%	0.547	44%	0.442	S	S	.	.	H	α-helix	trans	-57.3	-43.2	178.7	-166.8	172	-163.2	0	0	111.6	P23 Q29	P23-E25 PolarHBondContact O-N 3.34Å; E25-Q29 VanDerWaalsContact O-CB 3.29Å; E25-Q29 WeakPolarHBondContact O-CB 3.12Å; E25-Q29 WeakPolarHBondContact O-CG 3.23Å; E25-Q29 PolarHBondContact O-N 3.05Å
26	H	84.2	Confident	83.2	Confident	34 Å²	34	85.7 Å²	85.7	16%	0.157	44%	0.441	C	S	.	.	H	α-helix	trans	-77	-25.2	178.5	-67.9	106.6	0	0	0	113	V22 P23 D24 R30 L76	V22-H26 HydrophobicContact CG1-CB 3.8Å; P23-H26 PolarHBondContact O-N 3.49Å; D24-H26 VanDerWaalsContact C-N 3.28Å; D24-H26 PolarHBondContact O-N 3.1Å; H26-R30 PolarHBondContact CD2-NH2 3.16Å; H26-R30 PolarHBondContact NE2-NH2 2.81Å; H26-R30 WeakPolarHBondContact O-CB 3.35Å; H26-R30 VanDerWaalsContact O-CG 3.23Å; H26-R30 WeakPolarHBondContact O-CG 3.39Å; H26-L76 HydrophobicContact CB-CD1 3.88Å
27	Q	81	Confident	84.1	Confident	63 Å²	63	82.5 Å²	82.5	29%	0.294	42%	0.42	S	S	.	.	H	α-helix	trans	-80.2	-44.1	-179.6	-60.4	-171.7	14.2	0	0	112.5	S17 S20 V22 P23 D24	S17-Q27 PolarHBondContact O-NE2 2.96Å; S20-Q27 PolarHBondContact OG-NE2 3.4Å; V22-Q27 HydrophobicContact CB-CG 4.19Å; V22-Q27 HydrophobicContact CG1-CG 3.91Å; V22-Q27 PolarHBondContact O-NE2 3.36Å; P23-Q27 PolarHBondContact O-N 3.35Å; D24-Q27 PolarHBondContact O-N 2.86Å; D24-Q27 VanDerWaalsContact O-N 3.15Å
28	K	80.9	Confident	85	Confident	157 Å²	157	85 Å²	85	68%	0.683	44%	0.443	S	S	*	.	H	α-helix	trans	-91.5	-34.1	-170.6	-67.5	171.9	-178	156.6	0	113.9	D24	D24-K28 PolarHBondContact O-N 2.65Å; D24-K28 IonicContact OD2-NZ 2.82Å; D24-K28 PolarHBondContact OD2-NZ 2.95Å
29	Q	84.8	Confident	85.7	Confident	128 Å²	128	81.6 Å²	81.6	60%	0.598	43%	0.426	S	S	*	.	S	Bend	trans	-86.7	-23.5	-172.6	-59	-178.4	2.9	0	0	113.1	E25	E25-Q29 VanDerWaalsContact O-CB 3.29Å; E25-Q29 WeakPolarHBondContact O-CB 3.12Å; E25-Q29 WeakPolarHBondContact O-CG 3.23Å; E25-Q29 PolarHBondContact O-N 3.05Å
30	R	84.5	Confident	86.1	Confident	36 Å²	36	78.3 Å²	78.3	14%	0.136	41%	0.412	C	S	.	.			trans	-83.1	146.1	-174.4	-66.8	-72.4	-157.3	-85.8	-7.4	111.2	H26 V56 D57 D74 L76	H26-R30 PolarHBondContact CD2-NH2 3.16Å; H26-R30 PolarHBondContact NE2-NH2 2.81Å; H26-R30 WeakPolarHBondContact O-CB 3.35Å; H26-R30 VanDerWaalsContact O-CG 3.23Å; H26-R30 WeakPolarHBondContact O-CG 3.39Å; R30-V56 HydrophobicContact CB-CG1 3.73Å; R30-V56 HydrophobicContact CG-CG1 4Å; R30-D57 VanDerWaalsContact CA-OD1 3.26Å; R30-D57 WeakPolarHBondContact CA-OD1 3.4Å; R30-D57 WeakPolarHBondContact CB-OD1 3.34Å; R30-D57 WeakPolarHBondContact CD-OD1 3.44Å; R30-D74 IonicContact CZ-OD1 3.65Å; R30-D74 IonicContact NE-OD1 3.63Å; R30-D74 VanDerWaalsContact NH2-CG 3.32Å; R30-D74 IonicContact NH2-OD1 2.79Å; R30-D74 PolarHBondContact NH2-OD1 2.87Å; R30-D74 IonicContact NH2-OD2 3.98Å; R30-L76 HydrophobicContact CG-CD1 4.47Å
31	R	86	Confident	86.5	Confident	183 Å²	183	79.9 Å²	79.9	69%	0.691	43%	0.429	S	S	*	.			trans	-107.4	128.5	175.2	-74.1	-173.5	168.4	-152.2	-2.6	109.7	D57	R31-D57 PolarHBondContact N-OD1 3.21Å; R31-D57 PolarHBondContact O-N 3.2Å
32	V	87	Confident	87.1	Confident	49 Å²	49	82.8 Å²	82.8	30%	0.297	43%	0.433	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.9	135.3	176.5	-176.1	0	0	0	0	110.6	I54 E55 C95	V32-I54 HydrophobicContact CG1-CG2 3.18Å; V32-E55 WeakPolarHBondContact CA-O 3.29Å; V32-C95 HydrophobicContact CG1-CB 4.3Å
33	R	86.8	Confident	87.5	Confident	137 Å²	137	85.8 Å²	85.8	52%	0.517	44%	0.444	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.3	116.1	172.9	-175.9	-174.7	179.3	-178.2	-0.2	109.2	F35 I54 E55	R33-F35 HydrophobicContact CG-CB 4.5Å; R33-F35 HydrophobicContact CG-CD1 3.96Å; R33-I54 WeakPolarHBondContact O-CA 3.47Å; R33-E55 PolarHBondContact N-O 3.42Å; R33-E55 PolarHBondContact O-N 3.29Å
34	I	88.4	Confident	87.7	Confident	1 Å²	1	86.6 Å²	86.6	1%	0.005	46%	0.457	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.6	124.1	170.1	-52.8	-174.9	0	0	0	108.1	W52 K53 I54 A91 C95 R97 I98 V99	I34-W52 HydrophobicContact CG2-CE3 3.69Å; I34-W52 HydrophobicContact CG2-CZ3 4.12Å; I34-K53 WeakPolarHBondContact CA-O 3.42Å; I34-I54 HydrophobicContact CG1-CD1 4.38Å; I34-I54 HydrophobicContact CG1-CG1 4.25Å; I34-A91 HydrophobicContact CD1-CB 4.01Å; I34-A91 VanDerWaalsContact CD1-O 3.28Å; I34-A91 WeakPolarHBondContact CD1-O 3.47Å; I34-A91 HydrophobicContact CG2-CB 3.67Å; I34-C95 HydrophobicContact CD1-CB 4Å; I34-R97 WeakPolarHBondContact CD1-O 3.28Å; I34-R97 WeakPolarHBondContact CG1-O 3.35Å; I34-I98 HydrophobicContact CD1-CG1 4.13Å; I34-V99 WeakPolarHBondContact O-CB 3.42Å
35	F	88.8	Confident	88	Confident	30 Å²	30	84.7 Å²	84.7	13%	0.132	46%	0.46	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-153.5	156.3	-179	68.8	-72.7	0	0	0	112.5	R33 P37 K53 E55	R33-F35 HydrophobicContact CG-CB 4.5Å; R33-F35 HydrophobicContact CG-CD1 3.96Å; F35-P37 HydrophobicContact CE2-CB 4.23Å; F35-K53 HydrophobicContact CE1-CB 4.26Å; F35-K53 HydrophobicContact CZ-CB 4.37Å; F35-K53 PolarHBondContact N-O 2.77Å; F35-K53 PolarHBondContact O-N 3.14Å; F35-E55 HydrophobicContact CE1-CB 3.82Å; F35-E55 HydrophobicContact CE1-CG 3.68Å; F35-E55 WeakPolarHBondContact CE1-OE2 3.47Å; F35-E55 VanDerWaalsContact CZ-CD 3.43Å; F35-E55 HydrophobicContact CZ-CG 4.05Å; F35-E55 VanDerWaalsContact CZ-OE2 3.32Å; F35-E55 WeakPolarHBondContact CZ-OE2 3.28Å
36	M	88.6	Confident	88.1	Confident	67 Å²	67	82.6 Å²	82.6	33%	0.33	46%	0.455	S	S	.	.	P	Polyproline II helix	trans	-84.8	128.8	160.7	-73.2	-178.3	172.3	0	0	108.5	W52 A101	M36-W52 HydrophobicContact CE-CD2 4.23Å; M36-W52 HydrophobicContact CE-CZ2 3.58Å; M36-W52 HydrophobicContact CG-CD2 3.89Å; M36-W52 HydrophobicContact CG-CE3 4.1Å; M36-W52 HydrophobicContact CG-CG 4.4Å; M36-W52 HydrophobicContact CG-CH2 4.41Å; M36-W52 HydrophobicContact CG-CZ2 4.13Å; M36-W52 HydrophobicContact CG-CZ3 4.37Å; M36-W52 HydrophobicContact SD-CZ2 4.29Å; M36-A101 HydrophobicContact CE-CB 4.43Å; M36-A101 HydrophobicContact CG-CB 4.16Å; M36-A101 HydrophobicContact SD-CB 3.71Å
37	P	89.8	Confident	88.4	Confident	23 Å²	23	87.4 Å²	87.4	15%	0.149	48%	0.482	C	S	.	.	P	Polyproline II helix	trans	-63.8	139.5	179.6	28.7	-34.5	0	0	0	110.3	F35 N48 T49 V51 K53	F35-P37 HydrophobicContact CE2-CB 4.23Å; P37-N48 WeakPolarHBondContact CG-O 3.15Å; P37-T49 WeakPolarHBondContact O-CG2 3.26Å; P37-V51 WeakPolarHBondContact CD-O 3.24Å; P37-V51 HydrophobicContact CG-CG2 4.49Å; P37-K53 HydrophobicContact CG-CD 4.4Å
38	A	88.9	Confident	88.7	Confident	92 Å²	92	90 Å²	90	76%	0.76	50%	0.498	S	S	*	.	P	Polyproline II helix	trans	-67.7	147.9	176.9	0	0	0	0	0	110.7	V40	A38-V40 PolarHBondContact O-N 2.79Å
39	K	90.2	Very high	89	Confident	92 Å²	92	83.9 Å²	83.9	40%	0.4	47%	0.474	S	S	.	.	P	Polyproline II helix	trans	-60.2	132.5	171.6	-169.1	-173.3	70.4	64.9	0	109.4	A41 Q43 G45 T46 T49	K39-A41 PolarHBondContact O-N 2.8Å; K39-Q43 PolarHBondContact NZ-O 3.4Å; K39-G45 WeakPolarHBondContact CG-O 3.49Å; K39-T46 HydrophobicContact CD-CG2 3.8Å; K39-T46 HydrophobicContact CG-CG2 4.29Å; K39-T49 HydrophobicContact CB-CG2 4Å
40	V	91.3	Very high	89.2	Confident	75 Å²	75	83.3 Å²	83.3	46%	0.455	47%	0.471	S	S	.	.	P	Polyproline II helix	trans	-58.7	127.9	171.8	179.9	0	0	0	0	109	A38 T42 Q43	A38-V40 PolarHBondContact O-N 2.79Å; V40-T42 VanDerWaalsContact C-N 3.31Å; V40-T42 VanDerWaalsContact CG1-OG1 3.31Å; V40-T42 WeakPolarHBondContact CG1-OG1 2.95Å; V40-T42 PolarHBondContact O-N 3.18Å; V40-Q43 HydrophobicContact CB-CB 4.36Å; V40-Q43 HydrophobicContact CG1-CG 4.36Å; V40-Q43 PolarHBondContact O-N 3.22Å
41	A	90.3	Very high	89.5	Confident	98 Å²	98	83.6 Å²	83.6	81%	0.81	48%	0.477	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.1	-35.7	-173.3	0	0	0	0	0	112.6	K39 Q43	K39-A41 PolarHBondContact O-N 2.8Å; A41-Q43 VanDerWaalsContact C-N 3.29Å; A41-Q43 PolarHBondContact O-N 3.3Å
42	T	95.3	Very high	89.6	Confident	132 Å²	132	75.8 Å²	75.8	81%	0.81	45%	0.447	S	S	*	.	T	Hydrogen-bonded Turn	trans	-75.9	-12.9	-178.9	54.8	0	0	0	0	113.9	V40	V40-T42 VanDerWaalsContact C-N 3.31Å; V40-T42 VanDerWaalsContact CG1-OG1 3.31Å; V40-T42 WeakPolarHBondContact CG1-OG1 2.95Å; V40-T42 PolarHBondContact O-N 3.18Å
43	Q	93.4	Very high	89.8	Confident	115 Å²	115	76.4 Å²	76.4	54%	0.537	45%	0.446	S	S	.	.			trans	-117.7	143.7	-177.8	-65.3	-177.4	-17.6	0	0	111.2	K39 V40 A41	K39-Q43 PolarHBondContact NZ-O 3.4Å; V40-Q43 HydrophobicContact CB-CB 4.36Å; V40-Q43 HydrophobicContact CG1-CG 4.36Å; V40-Q43 PolarHBondContact O-N 3.22Å; A41-Q43 VanDerWaalsContact C-N 3.29Å; A41-Q43 PolarHBondContact O-N 3.3Å
44	A	91.4	Very high	89.9	Confident	95 Å²	95	70.1 Å²	70.1	79%	0.785	42%	0.422	S	S	*	.			trans	-84.7	-18.4	175.6	0	0	0	0	0	113.2
45	G	90.9	Very high	89.9	Confident	55 Å²	55	73.9 Å²	73.9	57%	0.567	44%	0.44	S	S	*	.			trans	-62.6	139.6	-178.7	0	0	0	0	0	112.8	K39	K39-G45 WeakPolarHBondContact CG-O 3.49Å
46	T	88.7	Confident	89.9	Confident	73 Å²	73	73.8 Å²	73.8	45%	0.448	44%	0.442	S	S	.	.			trans	-114.9	-1.5	-177	24.4	0	0	0	0	113.9	K39 N48 T49 H50	K39-T46 HydrophobicContact CD-CG2 3.8Å; K39-T46 HydrophobicContact CG-CG2 4.29Å; T46-N48 VanDerWaalsContact C-N 3.26Å; T46-N48 PolarHBondContact O-N 3.19Å; T46-N48 VanDerWaalsContact O-N 3.14Å; T46-T49 WeakPolarHBondContact O-CB 3.38Å; T46-T49 PolarHBondContact O-N 3.05Å; T46-T49 PolarHBondContact O-OG1 2.82Å; T46-H50 PolarHBondContact O-NE2 3.36Å
47	D	89.7	Confident	89.9	Confident	134 Å²	134	72.9 Å²	72.9	72%	0.717	44%	0.438	S	S	*	.	G	3₁₀ helix	trans	-56.2	-39.5	-171.8	-162.2	38.6	0	0	0	113.1	T49 H50	D47-T49 PolarHBondContact O-N 3.1Å; D47-T49 VanDerWaalsContact O-N 3.11Å; D47-H50 PolarHBondContact O-CD2 3.18Å
48	N	86.8	Confident	89.9	Confident	119 Å²	119	76.6 Å²	76.6	64%	0.636	46%	0.461	S	S	*	.	G	3₁₀ helix	trans	-69.6	-9.6	179.5	-68.8	-17.1	0	0	0	114.6	P37 T46	P37-N48 WeakPolarHBondContact CG-O 3.15Å; T46-N48 VanDerWaalsContact C-N 3.26Å; T46-N48 PolarHBondContact O-N 3.19Å; T46-N48 VanDerWaalsContact O-N 3.14Å
49	T	87.4	Confident	89.9	Confident	28 Å²	28	75.8 Å²	75.8	17%	0.172	44%	0.441	C	S	.	.	G	3₁₀ helix	trans	-91.6	-3	-174.5	66.8	0	0	0	0	113.8	P37 K39 T46 D47	P37-T49 WeakPolarHBondContact O-CG2 3.26Å; K39-T49 HydrophobicContact CB-CG2 4Å; T46-T49 WeakPolarHBondContact O-CB 3.38Å; T46-T49 PolarHBondContact O-N 3.05Å; T46-T49 PolarHBondContact O-OG1 2.82Å; D47-T49 PolarHBondContact O-N 3.1Å; D47-T49 VanDerWaalsContact O-N 3.11Å
50	H	88.3	Confident	90	Very high	116 Å²	116	78.7 Å²	78.7	54%	0.537	46%	0.456	S	S	.	.	S	Bend	trans	-90.6	0.7	-176.5	-57.3	-54.9	0	0	0	114.6	T46 D47	T46-H50 PolarHBondContact O-NE2 3.36Å; D47-H50 PolarHBondContact O-CD2 3.18Å
51	V	90.8	Very high	90.1	Very high	42 Å²	42	80.7 Å²	80.7	26%	0.255	46%	0.455	S	S	.	.	S	Bend	trans	-110	142.1	-179.7	-65.8	0	0	0	0	111.2	P37 K53	P37-V51 WeakPolarHBondContact CD-O 3.24Å; P37-V51 HydrophobicContact CG-CG2 4.49Å; V51-K53 HydrophobicContact CG2-CG 4.41Å
52	W	89.5	Confident	90.2	Very high	19 Å²	19	81.5 Å²	81.5	7%	0.072	44%	0.438	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.3	125.5	170.1	-72.8	90.7	0	0	0	109.4	I34 M36 N84 F85 A88 A91 A101	I34-W52 HydrophobicContact CG2-CE3 3.69Å; I34-W52 HydrophobicContact CG2-CZ3 4.12Å; M36-W52 HydrophobicContact CE-CD2 4.23Å; M36-W52 HydrophobicContact CE-CZ2 3.58Å; M36-W52 HydrophobicContact CG-CD2 3.89Å; M36-W52 HydrophobicContact CG-CE3 4.1Å; M36-W52 HydrophobicContact CG-CG 4.4Å; M36-W52 HydrophobicContact CG-CH2 4.41Å; M36-W52 HydrophobicContact CG-CZ2 4.13Å; M36-W52 HydrophobicContact CG-CZ3 4.37Å; M36-W52 HydrophobicContact SD-CZ2 4.29Å; W52-N84 WeakPolarHBondContact O-CA 3.49Å; W52-F85 HydrophobicContact CB-CB 3.97Å; W52-F85 PolarHBondContact N-O 2.81Å; W52-F85 PolarHBondContact O-N 3.07Å; W52-A88 HydrophobicContact CD2-CB 4.19Å; W52-A88 HydrophobicContact CH2-CB 3.83Å; W52-A88 HydrophobicContact CZ2-CB 3.38Å; W52-A88 HydrophobicContact CZ3-CB 4.44Å; W52-A91 HydrophobicContact CB-CB 4.5Å; W52-A101 HydrophobicContact CH2-CB 3.46Å; W52-A101 VanDerWaalsContact CH2-CB 3.46Å; W52-A101 HydrophobicContact CZ2-CB 3.78Å; W52-A101 HydrophobicContact CZ3-CB 4.28Å
53	K	90.3	Very high	90.2	Very high	62 Å²	62	82.1 Å²	82.1	27%	0.27	43%	0.431	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.4	150.2	177.3	-66.3	-165.4	174.5	-163.9	0	110.6	I34 F35 P37 V51 N84	I34-K53 WeakPolarHBondContact CA-O 3.42Å; F35-K53 HydrophobicContact CE1-CB 4.26Å; F35-K53 HydrophobicContact CZ-CB 4.37Å; F35-K53 PolarHBondContact N-O 2.77Å; F35-K53 PolarHBondContact O-N 3.14Å; P37-K53 HydrophobicContact CG-CD 4.4Å; V51-K53 HydrophobicContact CG2-CG 4.41Å; K53-N84 WeakPolarHBondContact CE-OD1 3.48Å
54	I	89.5	Confident	90.1	Very high	5 Å²	5	78.2 Å²	78.2	3%	0.026	42%	0.417	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.3	118.4	174.3	-60	-165.5	0	0	0	108	V32 R33 I34 A80 F85 A91 F94	V32-I54 HydrophobicContact CG1-CG2 3.18Å; R33-I54 WeakPolarHBondContact O-CA 3.47Å; I34-I54 HydrophobicContact CG1-CD1 4.38Å; I34-I54 HydrophobicContact CG1-CG1 4.25Å; I54-A80 WeakPolarHBondContact O-CA 3.45Å; I54-A80 WeakPolarHBondContact O-CB 3.49Å; I54-F85 HydrophobicContact CD1-CD2 3.86Å; I54-F85 HydrophobicContact CD1-CE2 3.18Å; I54-F85 HydrophobicContact CD1-CZ 3.77Å; I54-F85 HydrophobicContact CG1-CD2 3.91Å; I54-F85 HydrophobicContact CG1-CE2 3.58Å; I54-A91 HydrophobicContact CD1-CB 4.25Å; I54-F94 HydrophobicContact CD1-CD1 3.78Å
55	E	88.5	Confident	90.1	Very high	80 Å²	80	82.5 Å²	82.5	37%	0.374	43%	0.426	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.4	144	170.5	-87.3	175.6	175.3	0	0	110.5	V32 R33 F35 A80	V32-E55 WeakPolarHBondContact CA-O 3.29Å; R33-E55 PolarHBondContact N-O 3.42Å; R33-E55 PolarHBondContact O-N 3.29Å; F35-E55 HydrophobicContact CE1-CB 3.82Å; F35-E55 HydrophobicContact CE1-CG 3.68Å; F35-E55 WeakPolarHBondContact CE1-OE2 3.47Å; F35-E55 VanDerWaalsContact CZ-CD 3.43Å; F35-E55 HydrophobicContact CZ-CG 4.05Å; F35-E55 VanDerWaalsContact CZ-OE2 3.32Å; F35-E55 WeakPolarHBondContact CZ-OE2 3.28Å; E55-A80 HydrophobicContact CB-CB 4.47Å; E55-A80 HydrophobicContact CG-CB 3.35Å
56	V	88.7	Confident	90.2	Very high	27 Å²	27	87.6 Å²	87.6	16%	0.164	44%	0.439	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.1	153.2	168.3	-171.1	0	0	0	0	108.2	R30 T58 L76	R30-V56 HydrophobicContact CB-CG1 3.73Å; R30-V56 HydrophobicContact CG-CG1 4Å; V56-T58 PolarHBondContact O-N 3.4Å; V56-L76 HydrophobicContact CG1-CB 4.48Å; V56-L76 HydrophobicContact CG2-CB 4.29Å
57	D	89.5	Confident	90.5	Very high	48 Å²	48	87.5 Å²	87.5	26%	0.257	44%	0.438	S	S	.	.	P	Polyproline II helix	trans	-54.5	138.9	175.3	61.9	-68.9	0	0	0	112	R30 R31 Q59	R30-D57 VanDerWaalsContact CA-OD1 3.26Å; R30-D57 WeakPolarHBondContact CA-OD1 3.4Å; R30-D57 WeakPolarHBondContact CB-OD1 3.34Å; R30-D57 WeakPolarHBondContact CD-OD1 3.44Å; R31-D57 PolarHBondContact N-OD1 3.21Å; R31-D57 PolarHBondContact O-N 3.2Å; D57-Q59 PolarHBondContact O-N 3.3Å; D57-Q59 PolarHBondContact OD2-NE2 2.92Å
58	T	88.8	Confident	90.7	Very high	102 Å²	102	82.8 Å²	82.8	63%	0.626	42%	0.422	S	S	*	.	P	Polyproline II helix	trans	-79.1	122.8	-178.3	-70.3	0	0	0	0	110.9	V56	V56-T58 PolarHBondContact O-N 3.4Å
59	Q	89.4	Confident	91.1	Very high	74 Å²	74	86 Å²	86	35%	0.346	43%	0.425	S	S	.	.			trans	-89.4	175.1	175.3	-65.2	-68	-38.5	0	0	112.9	D57 R61 D74	D57-Q59 PolarHBondContact O-N 3.3Å; D57-Q59 PolarHBondContact OD2-NE2 2.92Å; Q59-R61 PolarHBondContact O-N 2.77Å; Q59-D74 HydrophobicContact CB-CB 3.99Å; Q59-D74 HydrophobicContact CG-CB 4.2Å
60	Q	90.9	Very high	91.3	Very high	153 Å²	153	90.1 Å²	90.1	72%	0.715	45%	0.453	S	S	*	.			trans	-59.6	128.9	-177.8	-173.9	174.8	7.9	0	0	111.9	N72	Q60-N72 PolarHBondContact O-OD1 3.38Å; Q60-N72 VanDerWaalsContact O-OD1 3.04Å
61	R	93.5	Very high	91.5	Very high	117 Å²	117	86.4 Å²	86.4	44%	0.442	44%	0.441	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.3	141.3	167.5	-64.4	-175.2	171.3	93.5	0.7	108.9	Q59 S71 N72	Q59-R61 PolarHBondContact O-N 2.77Å; R61-S71 WeakPolarHBondContact CA-O 3.41Å; R61-N72 HydrophobicContact CG-CB 4.2Å
62	W	93.7	Very high	91.6	Very high	115 Å²	115	86.6 Å²	86.6	44%	0.436	44%	0.44	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.2	163.5	179.6	62.7	90.8	0	0	0	111.5	C70 S71 A73	W62-C70 CarbonylContact O-C 3.59Å; W62-C70 WeakPolarHBondContact O-CA 3.46Å; W62-S71 PolarHBondContact N-O 3.47Å; W62-S71 VanDerWaalsContact NE1-CB 3.3Å; W62-S71 PolarHBondContact O-N 3.21Å; W62-A73 HydrophobicContact CH2-CB 3.54Å; W62-A73 HydrophobicContact CZ3-CB 3.99Å
63	E	94.1	Very high	91.6	Very high	146 Å²	146	89.4 Å²	89.4	68%	0.682	47%	0.468	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-84.1	132.2	177.7	-169.8	175.9	175.9	0	0	110.9	L65 G68 W69	E63-L65 PolarHBondContact O-N 3.08Å; E63-G68 WeakPolarHBondContact OE1-CA 3.3Å; E63-W69 CarbonylContact C-O 3.55Å; E63-W69 WeakPolarHBondContact CA-O 3.12Å
64	S	92	Very high	91.6	Very high	33 Å²	33	86.9 Å²	86.9	23%	0.231	46%	0.457	C	S	.	.			trans	-71.8	123.6	172.7	179.7	0	0	0	0	110.6	L66 T67 G68 W69	S64-L66 PolarHBondContact O-N 3.49Å; S64-T67 PolarHBondContact O-N 3.34Å; S64-T67 PolarHBondContact OG-OG1 3.18Å; S64-G68 WeakPolarHBondContact O-CA 3.48Å; S64-G68 PolarHBondContact O-N 3.5Å; S64-W69 PolarHBondContact N-O 2.79Å
65	L	91.8	Very high	91.6	Very high	185 Å²	185	91 Å²	91	97%	0.969	48%	0.484	S	S	*	.	T	Hydrogen-bonded Turn	trans	-55.2	-30	-174.3	-63.1	174.5	0	0	0	114.7	E63	E63-L65 PolarHBondContact O-N 3.08Å
66	L	92.1	Very high	91.5	Very high	162 Å²	162	88.7 Å²	88.7	85%	0.848	47%	0.474	S	S	*	.	T	Hydrogen-bonded Turn	trans	-91.3	-40.3	-176.2	-179	62	0	0	0	113.1	S64	S64-L66 PolarHBondContact O-N 3.49Å
67	T	96	Very high	91.4	Very high	70 Å²	70	88.9 Å²	88.9	43%	0.429	48%	0.477	S	S	.	.	T	Hydrogen-bonded Turn	trans	-117.4	-12.1	-166.3	57.1	0	0	0	0	114.5	S64 W69	S64-T67 PolarHBondContact O-N 3.34Å; S64-T67 PolarHBondContact OG-OG1 3.18Å; T67-W69 VanDerWaalsContact C-N 3.25Å; T67-W69 PolarHBondContact O-N 3.43Å; T67-W69 VanDerWaalsContact OG1-CG 3.29Å
68	G	92.6	Very high	91.3	Very high	36 Å²	36	91.3 Å²	91.3	37%	0.371	49%	0.489	S	S	.	.			trans	74.3	12.4	-174.5	0	0	0	0	0	114.4	E63 S64	E63-G68 WeakPolarHBondContact OE1-CA 3.3Å; S64-G68 WeakPolarHBondContact O-CA 3.48Å; S64-G68 PolarHBondContact O-N 3.5Å
69	W	95.2	Very high	91.1	Very high	187 Å²	187	88.9 Å²	88.9	71%	0.708	47%	0.472	S	S	*	.			trans	-73.6	150.1	-179.6	-66.9	-3.7	0	0	0	112.3	E63 S64 T67 S71	E63-W69 CarbonylContact C-O 3.55Å; E63-W69 WeakPolarHBondContact CA-O 3.12Å; S64-W69 PolarHBondContact N-O 2.79Å; T67-W69 VanDerWaalsContact C-N 3.25Å; T67-W69 PolarHBondContact O-N 3.43Å; T67-W69 VanDerWaalsContact OG1-CG 3.29Å; W69-S71 PolarHBondContact O-N 2.88Å
70	C	92.4	Very high	90.5	Very high	113 Å²	113	86 Å²	86	76%	0.764	46%	0.461	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-75.4	91.2	173	-70.4	0	0	0	0	110.8	W62	W62-C70 CarbonylContact O-C 3.59Å; W62-C70 WeakPolarHBondContact O-CA 3.46Å
71	S	92.6	Very high	89.6	Confident	39 Å²	39	85.9 Å²	85.9	27%	0.273	46%	0.462	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.7	152.8	173.4	-69.9	0	0	0	0	111.6	R61 W62 W69	R61-S71 WeakPolarHBondContact CA-O 3.41Å; W62-S71 PolarHBondContact N-O 3.47Å; W62-S71 VanDerWaalsContact NE1-CB 3.3Å; W62-S71 PolarHBondContact O-N 3.21Å; W69-S71 PolarHBondContact O-N 2.88Å
72	N	92.1	Very high	88.8	Confident	46 Å²	46	84.4 Å²	84.4	25%	0.246	48%	0.475	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-149.4	152.2	179	-165.7	-7.7	0	0	0	109.9	Q60 R61 D74	Q60-N72 PolarHBondContact O-OD1 3.38Å; Q60-N72 VanDerWaalsContact O-OD1 3.04Å; R61-N72 HydrophobicContact CG-CB 4.2Å; N72-D74 PolarHBondContact OD1-N 3.07Å; N72-D74 VanDerWaalsContact OD1-N 3.07Å
73	A	90.5	Very high	88.3	Confident	78 Å²	78	81.6 Å²	81.6	65%	0.645	47%	0.468	S	S	*	.			trans	-98.1	-5.9	174.1	0	0	0	0	0	112.8	W62 P75	W62-A73 HydrophobicContact CH2-CB 3.54Å; W62-A73 HydrophobicContact CZ3-CB 3.99Å; A73-P75 VanDerWaalsContact O-CD 3.3Å; A73-P75 WeakPolarHBondContact O-CD 3.32Å
74	D	90	Very high	88.1	Confident	9 Å²	9	78.5 Å²	78.5	5%	0.048	46%	0.456	C	S	.	.			trans	-90.3	112.4	-172.3	-177.4	27.3	0	0	0	113.3	R30 Q59 N72 L76 S77	R30-D74 IonicContact CZ-OD1 3.65Å; R30-D74 IonicContact NE-OD1 3.63Å; R30-D74 VanDerWaalsContact NH2-CG 3.32Å; R30-D74 IonicContact NH2-OD1 2.79Å; R30-D74 PolarHBondContact NH2-OD1 2.87Å; R30-D74 IonicContact NH2-OD2 3.98Å; Q59-D74 HydrophobicContact CB-CB 3.99Å; Q59-D74 HydrophobicContact CG-CB 4.2Å; N72-D74 PolarHBondContact OD1-N 3.07Å; N72-D74 VanDerWaalsContact OD1-N 3.07Å; D74-L76 VanDerWaalsContact C-N 3.28Å; D74-L76 PolarHBondContact O-N 2.82Å; D74-L76 PolarHBondContact OD1-N 3.3Å; D74-S77 PolarHBondContact O-N 3.23Å; D74-S77 PolarHBondContact O-OG 3.04Å; D74-S77 WeakPolarHBondContact OD2-CB 3.45Å; D74-S77 PolarHBondContact OD2-N 2.98Å
75	P	88.5	Confident	88	Confident	90 Å²	90	78.5 Å²	78.5	58%	0.584	45%	0.452	S	S	*	.	T	Hydrogen-bonded Turn	trans	-70.3	-24.8	178	29.7	-34.9	0	0	0	112.7	A73 S77	A73-P75 VanDerWaalsContact O-CD 3.3Å; A73-P75 WeakPolarHBondContact O-CD 3.32Å; P75-S77 VanDerWaalsContact C-N 3.32Å
76	L	87.8	Confident	87.8	Confident	33 Å²	33	77.8 Å²	77.8	17%	0.173	44%	0.443	C	S	.	.	T	Hydrogen-bonded Turn	trans	-84.9	-7.9	-176.2	-57.8	-175.4	0	0	0	113.2	H26 R30 V56 D74 N78 I79	H26-L76 HydrophobicContact CB-CD1 3.88Å; R30-L76 HydrophobicContact CG-CD1 4.47Å; V56-L76 HydrophobicContact CG1-CB 4.48Å; V56-L76 HydrophobicContact CG2-CB 4.29Å; D74-L76 VanDerWaalsContact C-N 3.28Å; D74-L76 PolarHBondContact O-N 2.82Å; D74-L76 PolarHBondContact OD1-N 3.3Å; L76-N78 PolarHBondContact O-N 2.85Å; L76-N78 VanDerWaalsContact O-N 3.08Å; L76-I79 HydrophobicContact CB-CD1 3.76Å; L76-I79 HydrophobicContact CD2-CD1 3.32Å; L76-I79 HydrophobicContact CG-CD1 4.07Å; L76-I79 WeakPolarHBondContact O-CB 3.49Å; L76-I79 WeakPolarHBondContact O-CG1 3.36Å; L76-I79 PolarHBondContact O-N 2.96Å
77	S	86.4	Confident	87.6	Confident	31 Å²	31	73.6 Å²	73.6	22%	0.217	43%	0.425	C	S	.	.	T	Hydrogen-bonded Turn	trans	-60.2	-26.1	-169	59.7	0	0	0	0	115.3	D74 P75	D74-S77 PolarHBondContact O-N 3.23Å; D74-S77 PolarHBondContact O-OG 3.04Å; D74-S77 WeakPolarHBondContact OD2-CB 3.45Å; D74-S77 PolarHBondContact OD2-N 2.98Å; P75-S77 VanDerWaalsContact C-N 3.32Å
78	N	87.9	Confident	87.1	Confident	98 Å²	98	71.6 Å²	71.6	52%	0.524	42%	0.415	S	S	.	.	T	Hydrogen-bonded Turn	trans	-109.3	10.8	-175.8	-62.8	-44.8	0	0	0	114	L76 A80 M81	L76-N78 PolarHBondContact O-N 2.85Å; L76-N78 VanDerWaalsContact O-N 3.08Å; N78-A80 PolarHBondContact O-N 3.19Å; N78-M81 WeakPolarHBondContact O-CB 3.33Å; N78-M81 PolarHBondContact O-N 3.21Å
79	I	84.5	Confident	86.8	Confident	51 Å²	51	76 Å²	76	26%	0.262	43%	0.427	S	S	.	.	G	3₁₀ helix	trans	-60.8	-31.3	-175	-80.5	176.1	0	0	0	113.5	L76 M81 A82 L83	L76-I79 HydrophobicContact CB-CD1 3.76Å; L76-I79 HydrophobicContact CD2-CD1 3.32Å; L76-I79 HydrophobicContact CG-CD1 4.07Å; L76-I79 WeakPolarHBondContact O-CB 3.49Å; L76-I79 WeakPolarHBondContact O-CG1 3.36Å; L76-I79 PolarHBondContact O-N 2.96Å; I79-M81 PolarHBondContact O-N 2.98Å; I79-A82 PolarHBondContact O-N 2.94Å; I79-L83 HydrophobicContact CG2-CB 4.29Å; I79-L83 HydrophobicContact CG2-CD1 3.39Å; I79-L83 HydrophobicContact CG2-CG 4.37Å; I79-L83 PolarHBondContact O-N 2.79Å
80	A	75.3	Confident	86.4	Confident	14 Å²	14	68.8 Å²	68.8	12%	0.116	41%	0.406	C	S	.	.	G	3₁₀ helix	trans	-60.5	-13.5	179.7	0	0	0	0	0	114.6	I54 E55 N78	I54-A80 WeakPolarHBondContact O-CA 3.45Å; I54-A80 WeakPolarHBondContact O-CB 3.49Å; E55-A80 HydrophobicContact CB-CB 4.47Å; E55-A80 HydrophobicContact CG-CB 3.35Å; N78-A80 PolarHBondContact O-N 3.19Å
81	M	72.3	Confident	86.1	Confident	151 Å²	151	63.4 Å²	63.4	74%	0.744	37%	0.37	S	S	*	.	G	3₁₀ helix	trans	-76.2	-27.9	175	-60.8	-172.3	-178.9	0	0	112.7	N78 I79	N78-M81 WeakPolarHBondContact O-CB 3.33Å; N78-M81 PolarHBondContact O-N 3.21Å; I79-M81 PolarHBondContact O-N 2.98Å
82	A	76.4	Confident	85.7	Confident	85 Å²	85	62.5 Å²	62.5	70%	0.702	37%	0.365	S	S	*	.	T	Hydrogen-bonded Turn	trans	-107.6	-32.2	-172.7	0	0	0	0	0	113.6	I79 N84	I79-A82 PolarHBondContact O-N 2.94Å; A82-N84 PolarHBondContact O-N 3.5Å
83	L	84.1	Confident	85.3	Confident	56 Å²	56	67 Å²	67	29%	0.293	38%	0.384	S	S	.	.			trans	-92.3	90	-173.9	-89.3	154.2	0	0	0	111.7	I79 F85 F94	I79-L83 HydrophobicContact CG2-CB 4.29Å; I79-L83 HydrophobicContact CG2-CD1 3.39Å; I79-L83 HydrophobicContact CG2-CG 4.37Å; I79-L83 PolarHBondContact O-N 2.79Å; L83-F85 HydrophobicContact CB-CE2 4.27Å; L83-F85 HydrophobicContact CD2-CE2 3.86Å; L83-F85 HydrophobicContact CD2-CZ 3.7Å; L83-F94 HydrophobicContact CD2-CE1 4.5Å
84	N	88.7	Confident	84.9	Confident	81 Å²	81	69.2 Å²	69.2	43%	0.433	38%	0.38	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.7	134.2	173.4	-58.9	-60.3	0	0	0	110.4	W52 K53 A82	W52-N84 WeakPolarHBondContact O-CA 3.49Å; K53-N84 WeakPolarHBondContact CE-OD1 3.48Å; A82-N84 PolarHBondContact O-N 3.5Å
85	F	90.4	Very high	84.3	Confident	34 Å²	34	70.5 Å²	70.5	15%	0.149	39%	0.389	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.1	146.9	177.5	-62.1	-94.4	0	0	0	110.6	W52 I54 L83 A90 A91 F94	W52-F85 HydrophobicContact CB-CB 3.97Å; W52-F85 PolarHBondContact N-O 2.81Å; W52-F85 PolarHBondContact O-N 3.07Å; I54-F85 HydrophobicContact CD1-CD2 3.86Å; I54-F85 HydrophobicContact CD1-CE2 3.18Å; I54-F85 HydrophobicContact CD1-CZ 3.77Å; I54-F85 HydrophobicContact CG1-CD2 3.91Å; I54-F85 HydrophobicContact CG1-CE2 3.58Å; L83-F85 HydrophobicContact CB-CE2 4.27Å; L83-F85 HydrophobicContact CD2-CE2 3.86Å; L83-F85 HydrophobicContact CD2-CZ 3.7Å; F85-A90 HydrophobicContact CD1-CB 4.08Å; F85-A91 HydrophobicContact CB-CB 4.03Å; F85-A91 HydrophobicContact CD1-CB 4.35Å; F85-A91 HydrophobicContact CD2-CB 3.95Å; F85-A91 HydrophobicContact CG-CB 3.85Å; F85-F94 HydrophobicContact CE1-CB 4.11Å; F85-F94 HydrophobicContact CE1-CG 4.34Å; F85-F94 HydrophobicContact CZ-CB 4Å; F85-F94 AromaticContact CZ-CD1 3.92Å; F85-F94 HydrophobicContact CZ-CD1 3.92Å; F85-F94 AromaticContact CZ-CG 3.87Å; F85-F94 HydrophobicContact CZ-CG 3.87Å
86	H	88.4	Confident	83.6	Confident	169 Å²	169	73.5 Å²	73.5	78%	0.782	40%	0.395	S	S	*	.	S	Bend	trans	-80.4	-34.8	174.9	-79.4	-62	0	0	0	112.8
87	T	88.2	Confident	82	Confident	75 Å²	75	79.2 Å²	79.2	46%	0.46	41%	0.414	S	S	.	.	S	Bend	trans	-121.5	148.6	-176.1	57.2	0	0	0	0	111.4	E89 A90 A91	T87-E89 PolarHBondContact O-N 3.34Å; T87-A90 PolarHBondContact O-N 3.34Å; T87-A90 VanDerWaalsContact OG1-CB 3.24Å; T87-A90 WeakPolarHBondContact OG1-CB 3.36Å; T87-A90 PolarHBondContact OG1-N 3.48Å; T87-A91 PolarHBondContact O-N 3.43Å
88	A	85.1	Confident	80.5	Confident	28 Å²	28	81.4 Å²	81.4	23%	0.231	42%	0.423	C	S	.	.	H	α-helix	trans	-59	-41.7	173.9	0	0	0	0	0	110.2	W52 A91 A92 I98	W52-A88 HydrophobicContact CD2-CB 4.19Å; W52-A88 HydrophobicContact CH2-CB 3.83Å; W52-A88 HydrophobicContact CZ2-CB 3.38Å; W52-A88 HydrophobicContact CZ3-CB 4.44Å; A88-A91 CarbonylContact O-C 3.59Å; A88-A91 WeakPolarHBondContact O-CB 3.1Å; A88-A91 PolarHBondContact O-N 2.88Å; A88-A92 PolarHBondContact O-N 3.11Å; A88-I98 HydrophobicContact CB-CD1 4.13Å; A88-I98 WeakPolarHBondContact O-CD1 3.46Å
89	E	86.2	Confident	79	Confident	129 Å²	129	79.5 Å²	79.5	60%	0.603	41%	0.414	S	S	*	.	H	α-helix	trans	-63.6	-42.5	-177.7	-166.1	-177.3	166.4	0	0	112.4	T87 A91 A92 Q93	T87-E89 PolarHBondContact O-N 3.34Å; E89-A91 VanDerWaalsContact C-N 3.29Å; E89-A91 PolarHBondContact O-N 3.07Å; E89-A92 CarbonylContact O-C 3.56Å; E89-A92 WeakPolarHBondContact O-CB 3.43Å; E89-A92 PolarHBondContact O-N 3.46Å; E89-A92 VanDerWaalsContact O-N 3.14Å; E89-Q93 HydrophobicContact CG-CG 4.48Å; E89-Q93 WeakPolarHBondContact O-CB 3.47Å; E89-Q93 VanDerWaalsContact O-CG 3.28Å; E89-Q93 WeakPolarHBondContact O-CG 3.17Å; E89-Q93 PolarHBondContact O-N 3.42Å; E89-Q93 PolarHBondContact OE1-NE2 2.66Å
90	A	86.9	Confident	77.8	Confident	34 Å²	34	82.3 Å²	82.3	28%	0.281	44%	0.436	S	S	.	.	H	α-helix	trans	-63	-38.7	175.8	0	0	0	0	0	111.6	F85 T87 F94	F85-A90 HydrophobicContact CD1-CB 4.08Å; T87-A90 PolarHBondContact O-N 3.34Å; T87-A90 VanDerWaalsContact OG1-CB 3.24Å; T87-A90 WeakPolarHBondContact OG1-CB 3.36Å; T87-A90 PolarHBondContact OG1-N 3.48Å; A90-F94 PolarHBondContact O-N 2.91Å
91	A	85.6	Confident	77.4	Confident	0 Å²	0	83.3 Å²	83.3	0%	0	44%	0.444	C	S	.	.	H	α-helix	trans	-67.8	-38.7	173.8	0	0	0	0	0	111.7	I34 W52 I54 F85 T87 A88 E89 F94 C95	I34-A91 HydrophobicContact CD1-CB 4.01Å; I34-A91 VanDerWaalsContact CD1-O 3.28Å; I34-A91 WeakPolarHBondContact CD1-O 3.47Å; I34-A91 HydrophobicContact CG2-CB 3.67Å; W52-A91 HydrophobicContact CB-CB 4.5Å; I54-A91 HydrophobicContact CD1-CB 4.25Å; F85-A91 HydrophobicContact CB-CB 4.03Å; F85-A91 HydrophobicContact CD1-CB 4.35Å; F85-A91 HydrophobicContact CD2-CB 3.95Å; F85-A91 HydrophobicContact CG-CB 3.85Å; T87-A91 PolarHBondContact O-N 3.43Å; A88-A91 CarbonylContact O-C 3.59Å; A88-A91 WeakPolarHBondContact O-CB 3.1Å; A88-A91 PolarHBondContact O-N 2.88Å; E89-A91 VanDerWaalsContact C-N 3.29Å; E89-A91 PolarHBondContact O-N 3.07Å; A91-F94 PolarHBondContact O-N 3.14Å; A91-C95 PolarHBondContact O-N 3.28Å
92	A	83.7	Confident	77.2	Confident	20 Å²	20	85.3 Å²	85.3	17%	0.165	45%	0.452	C	S	.	.	H	α-helix	trans	-61.7	-47.9	173.8	0	0	0	0	0	111.6	A88 E89 F94 C95 E96 I98	A88-A92 PolarHBondContact O-N 3.11Å; E89-A92 CarbonylContact O-C 3.56Å; E89-A92 WeakPolarHBondContact O-CB 3.43Å; E89-A92 PolarHBondContact O-N 3.46Å; E89-A92 VanDerWaalsContact O-N 3.14Å; A92-F94 PolarHBondContact O-N 3.38Å; A92-C95 CarbonylContact O-C 3.48Å; A92-C95 PolarHBondContact O-N 3.44Å; A92-C95 VanDerWaalsContact O-N 3.1Å; A92-E96 WeakPolarHBondContact O-CA 3.39Å; A92-E96 PolarHBondContact O-N 2.67Å; A92-I98 HydrophobicContact CB-CD1 3.23Å; A92-I98 HydrophobicContact CB-CG1 3.58Å
93	Q	84.5	Confident	77.2	Confident	140 Å²	140	90.4 Å²	90.4	65%	0.654	46%	0.458	S	S	*	.	H	α-helix	trans	-61	-30.5	-179.9	-72.4	173.3	5.5	0	0	110.8	E89	E89-Q93 HydrophobicContact CG-CG 4.48Å; E89-Q93 WeakPolarHBondContact O-CB 3.47Å; E89-Q93 VanDerWaalsContact O-CG 3.28Å; E89-Q93 WeakPolarHBondContact O-CG 3.17Å; E89-Q93 PolarHBondContact O-N 3.42Å; E89-Q93 PolarHBondContact OE1-NE2 2.66Å
94	F	81.7	Confident	76.6	Confident	126 Å²	126	94.8 Å²	94.8	55%	0.553	48%	0.477	S	S	*	.	H	α-helix	trans	-75	-28.7	176.1	-171.3	-103.5	0	0	0	114.3	I54 L83 F85 A90 A91 A92	I54-F94 HydrophobicContact CD1-CD1 3.78Å; L83-F94 HydrophobicContact CD2-CE1 4.5Å; F85-F94 HydrophobicContact CE1-CB 4.11Å; F85-F94 HydrophobicContact CE1-CG 4.34Å; F85-F94 HydrophobicContact CZ-CB 4Å; F85-F94 AromaticContact CZ-CD1 3.92Å; F85-F94 HydrophobicContact CZ-CD1 3.92Å; F85-F94 AromaticContact CZ-CG 3.87Å; F85-F94 HydrophobicContact CZ-CG 3.87Å; A90-F94 PolarHBondContact O-N 2.91Å; A91-F94 PolarHBondContact O-N 3.14Å; A92-F94 PolarHBondContact O-N 3.38Å
95	C	77.2	Confident	76.3	Confident	35 Å²	35	99.2 Å²	99.2	24%	0.236	50%	0.495	C	S	.	.	H	α-helix	trans	-128.3	5	-172.9	-76	0	0	0	0	115.1	V32 I34 A91 A92 R97	V32-C95 HydrophobicContact CG1-CB 4.3Å; I34-C95 HydrophobicContact CD1-CB 4Å; A91-C95 PolarHBondContact O-N 3.28Å; A92-C95 CarbonylContact O-C 3.48Å; A92-C95 PolarHBondContact O-N 3.44Å; A92-C95 VanDerWaalsContact O-N 3.1Å; C95-R97 PolarHBondContact O-N 3.29Å
96	E	74.2	Confident	76	Confident	154 Å²	154	105 Å²	105	72%	0.72	53%	0.526	S	S	*	.	S	Bend	trans	51.4	2.9	-172.3	-61.5	-169.2	151.5	0	0	116.7	T13 A92	T13-E96 WeakPolarHBondContact CG2-OE1 3.38Å; A92-E96 WeakPolarHBondContact O-CA 3.39Å; A92-E96 PolarHBondContact O-N 2.67Å
97	R	54.3	Low	75.7	Confident	153 Å²	153	103.4 Å²	103.4	58%	0.577	52%	0.518	S	S	*	.			trans	-145.5	127.7	-171.8	-148.1	176.1	84.3	117.4	3.9	114	I34 C95	I34-R97 WeakPolarHBondContact CD1-O 3.28Å; I34-R97 WeakPolarHBondContact CG1-O 3.35Å; C95-R97 PolarHBondContact O-N 3.29Å
98	I	54	Low	75.7	Confident	76 Å²	76	108.1 Å²	108.1	39%	0.39	54%	0.538	S	S	.	.			trans	-112.1	149.2	-178.1	-84.7	172.1	0	0	0	112.9	I34 A88 A92	I34-I98 HydrophobicContact CD1-CG1 4.13Å; A88-I98 HydrophobicContact CB-CD1 4.13Å; A88-I98 WeakPolarHBondContact O-CD1 3.46Å; A92-I98 HydrophobicContact CB-CD1 3.23Å; A92-I98 HydrophobicContact CB-CG1 3.58Å
99	V	57.1	Low	76	Confident	58 Å²	58	114.8 Å²	114.8	35%	0.352	56%	0.562	S	S	.	*			trans	-109.7	135.3	158.5	-175.1	0	0	0	0	108.4	I34	I34-V99 WeakPolarHBondContact O-CB 3.42Å
100	P	59.9	Low	76.2	Confident	111 Å²	111	112 Å²	112	72%	0.721	56%	0.557	S	S	*	*	P	Polyproline II helix	trans	-65.5	141	-175.7	24.6	-33.9	0	0	0	112.9
101	A	66.9	Low	76.5	Confident	34 Å²	34	117.5 Å²	117.5	28%	0.281	57%	0.571	S	S	.	*	P	Polyproline II helix	trans	-69.6	138.8	174.8	0	0	0	0	0	111.8	M36 W52	M36-A101 HydrophobicContact CE-CB 4.43Å; M36-A101 HydrophobicContact CG-CB 4.16Å; M36-A101 HydrophobicContact SD-CB 3.71Å; W52-A101 HydrophobicContact CH2-CB 3.46Å; W52-A101 VanDerWaalsContact CH2-CB 3.46Å; W52-A101 HydrophobicContact CZ2-CB 3.78Å; W52-A101 HydrophobicContact CZ3-CB 4.28Å
102	Q	68.6	Low	76.8	Confident	193 Å²	193	119.7 Å²	119.7	90%	0.902	59%	0.594	S	S	*	*	P	Polyproline II helix	trans	-79.7	120.7	168.9	-70.9	-156	-14.2	0	0	110.2
103	K	74.7	Confident	77.1	Confident	192 Å²	192	120.4 Å²	120.4	84%	0.835	60%	0.6	S	S	*	*	P	Polyproline II helix	trans	-93	140.9	175.1	-64.8	-178.5	-179.3	178.7	0	109.6
104	H	72.5	Confident	77.5	Confident	148 Å²	148	116 Å²	116	69%	0.685	58%	0.581	S	S	*	*	P	Polyproline II helix	trans	-73.5	137.2	168.6	84.9	-87	0	0	0	109.3	L106	H104-L106 WeakPolarHBondContact NE2-CD2 3.31Å
105	E	82.1	Confident	78	Confident	175 Å²	175	115.5 Å²	115.5	82%	0.818	58%	0.579	S	S	*	*	P	Polyproline II helix	trans	-80.1	134.4	172.2	-69.7	-178.9	172.5	0	0	110.1	F107	E105-F107 PolarHBondContact O-N 3.42Å
106	L	83.4	Confident	78.7	Confident	154 Å²	154	114.7 Å²	114.7	81%	0.806	57%	0.574	S	S	*	*	P	Polyproline II helix	trans	-79.5	116.7	175.6	-68.1	170.3	0	0	0	109.1	H104	H104-L106 WeakPolarHBondContact NE2-CD2 3.31Å
107	F	83.1	Confident	79.5	Confident	137 Å²	137	119.6 Å²	119.6	60%	0.601	59%	0.586	S	S	*	*	P	Polyproline II helix	trans	-93	143.1	170	49.4	-104.3	0	0	0	110.3	E105 K109	E105-F107 PolarHBondContact O-N 3.42Å; F107-K109 HydrophobicContact CD2-CB 4.49Å; F107-K109 HydrophobicContact CD2-CD 3.69Å; F107-K109 VanDerWaalsContact CD2-CE 3.43Å; F107-K109 HydrophobicContact CD2-CG 3.6Å; F107-K109 HydrophobicContact CE2-CD 3.3Å; F107-K109 HydrophobicContact CE2-CG 3.8Å; F107-K109 HydrophobicContact CZ-CD 4.28Å; F107-K109 PolarHBondContact O-N 3.38Å
108	I	88.4	Confident	81.3	Confident	173 Å²	173	117.6 Å²	117.6	89%	0.887	59%	0.586	S	S	*	*			trans	-84	112.4	171.9	-58.4	171.1	0	0	0	108
109	K	90.1	Very high	83.1	Confident	169 Å²	169	120 Å²	120	74%	0.735	59%	0.594	S	S	*	*			trans	-99.7	125.6	172.5	-86.6	172.4	-173.5	165.7	0	109.9	F107	F107-K109 HydrophobicContact CD2-CB 4.49Å; F107-K109 HydrophobicContact CD2-CD 3.69Å; F107-K109 VanDerWaalsContact CD2-CE 3.43Å; F107-K109 HydrophobicContact CD2-CG 3.6Å; F107-K109 HydrophobicContact CE2-CD 3.3Å; F107-K109 HydrophobicContact CE2-CG 3.8Å; F107-K109 HydrophobicContact CZ-CD 4.28Å; F107-K109 PolarHBondContact O-N 3.38Å
110	S	91.9	Very high	84.7	Confident	71 Å²	71	129.3 Å²	129.3	50%	0.497	62%	0.623	S	S	.	*			trans	-122	124.8	170.9	173.1	0	0	0	0	109.8	G112 A113	S110-G112 VanDerWaalsContact C-N 3.26Å; S110-G112 PolarHBondContact O-N 3.42Å; S110-G112 PolarHBondContact OG-N 3.4Å; S110-A113 WeakPolarHBondContact O-CB 3.25Å; S110-A113 PolarHBondContact O-N 3.21Å
111	Y	92	Very high	86.2	Confident	148 Å²	148	127.7 Å²	127.7	58%	0.58	61%	0.611	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.9	-35.9	176.4	-176.4	-88.2	0	0	0	111.8	A113 N114 F115 K126	Y111-A113 VanDerWaalsContact C-N 3.26Å; Y111-A113 PolarHBondContact O-N 3.38Å; Y111-N114 VanDerWaalsContact O-CB 3.25Å; Y111-N114 WeakPolarHBondContact O-CB 3.37Å; Y111-N114 PolarHBondContact O-N 2.75Å; Y111-N114 VanDerWaalsContact O-N 3.16Å; Y111-N114 PolarHBondContact O-ND2 3.1Å; Y111-N114 VanDerWaalsContact O-ND2 3.17Å; Y111-F115 HydrophobicContact CD1-CE2 4.34Å; Y111-F115 HydrophobicContact CE1-CD2 4.16Å; Y111-F115 AromaticContact CE1-CE2 3.59Å; Y111-F115 HydrophobicContact CE1-CE2 3.59Å; Y111-F115 AromaticContact CZ-CE2 3.85Å; Y111-K126 HydrophobicContact CE2-CD 4.41Å; Y111-K126 VanDerWaalsContact CZ-CE 3.48Å; Y111-K126 WeakPolarHBondContact OH-CD 3.37Å; Y111-K126 WeakPolarHBondContact OH-CE 3.27Å; Y111-K126 PolarHBondContact OH-NZ 3.24Å
112	G	91.5	Very high	87.3	Confident	46 Å²	46	134.6 Å²	134.6	47%	0.474	63%	0.63	S	S	.	*	G	3₁₀ helix	trans	-65.1	-28.2	177.4	0	0	0	0	0	113.2	S110 N114 F115	S110-G112 VanDerWaalsContact C-N 3.26Å; S110-G112 PolarHBondContact O-N 3.42Å; S110-G112 PolarHBondContact OG-N 3.4Å; G112-N114 PolarHBondContact O-N 3.19Å; G112-F115 PolarHBondContact O-N 3.36Å; G112-F115 VanDerWaalsContact O-N 3.07Å
113	A	91.2	Very high	88.4	Confident	36 Å²	36	129 Å²	129	30%	0.298	61%	0.608	S	S	.	*	G	3₁₀ helix	trans	-63	-24.6	175.2	0	0	0	0	0	112.7	S110 Y111 F115 T121	S110-A113 WeakPolarHBondContact O-CB 3.25Å; S110-A113 PolarHBondContact O-N 3.21Å; Y111-A113 VanDerWaalsContact C-N 3.26Å; Y111-A113 PolarHBondContact O-N 3.38Å; A113-F115 PolarHBondContact O-N 3.21Å; A113-T121 CarbonylContact O-C 3.56Å; A113-T121 VanDerWaalsContact O-CB 3.27Å; A113-T121 WeakPolarHBondContact O-CB 3.07Å; A113-T121 PolarHBondContact O-OG1 3.25Å
114	N	93.5	Very high	89.1	Confident	47 Å²	47	124.8 Å²	124.8	25%	0.251	61%	0.609	S	S	.	*	G	3₁₀ helix	trans	-68.1	-14.3	175.9	-59.8	-38.7	0	0	0	113.5	Y111 G112 R122 V123	Y111-N114 VanDerWaalsContact O-CB 3.25Å; Y111-N114 WeakPolarHBondContact O-CB 3.37Å; Y111-N114 PolarHBondContact O-N 2.75Å; Y111-N114 VanDerWaalsContact O-N 3.16Å; Y111-N114 PolarHBondContact O-ND2 3.1Å; Y111-N114 VanDerWaalsContact O-ND2 3.17Å; G112-N114 PolarHBondContact O-N 3.19Å; N114-R122 VanDerWaalsContact O-CA 3.25Å; N114-R122 WeakPolarHBondContact O-CA 3.25Å; N114-V123 HydrophobicContact CB-CG2 3.74Å; N114-V123 PolarHBondContact O-N 3.07Å
115	F	92.3	Very high	89.7	Confident	115 Å²	115	126 Å²	126	50%	0.504	62%	0.615	S	S	.	*	G	3₁₀ helix	trans	-128.1	27.4	-177.9	-58.1	-75	0	0	0	112.4	Y111 G112 A113 W117 K126	Y111-F115 HydrophobicContact CD1-CE2 4.34Å; Y111-F115 HydrophobicContact CE1-CD2 4.16Å; Y111-F115 AromaticContact CE1-CE2 3.59Å; Y111-F115 HydrophobicContact CE1-CE2 3.59Å; Y111-F115 AromaticContact CZ-CE2 3.85Å; G112-F115 PolarHBondContact O-N 3.36Å; G112-F115 VanDerWaalsContact O-N 3.07Å; A113-F115 PolarHBondContact O-N 3.21Å; F115-W117 PolarHBondContact O-N 3.17Å; F115-K126 HydrophobicContact CE2-CD 4.26Å; F115-K126 HydrophobicContact CZ-CD 3.72Å
116	S	90	Very high	89.7	Confident	19 Å²	19	126 Å²	126	13%	0.133	61%	0.612	C	S	.	*			trans	-56.7	136.6	178	56.2	0	0	0	0	111.9	K119 T121	S116-K119 WeakPolarHBondContact OG-CB 3.28Å; S116-K119 PolarHBondContact OG-O 3.16Å; S116-T121 PolarHBondContact OG-OG1 2.99Å; S116-T121 VanDerWaalsContact OG-OG1 3.1Å
117	W	91.7	Very high	90	Very high	257 Å²	257	124.6 Å²	124.6	97%	0.973	60%	0.603	S	S	*	*	S	Bend	trans	-64	-41.5	177.8	171.7	-103.4	0	0	0	112.9	F115	F115-W117 PolarHBondContact O-N 3.17Å
118	D	92.5	Very high	90.4	Very high	111 Å²	111	123.9 Å²	123.9	59%	0.594	60%	0.603	S	S	*	*	S	Bend	trans	-121.1	-8.1	-169.9	72.3	-34	0	0	0	114.6
119	K	91.9	Very high	90.5	Very high	125 Å²	125	121.2 Å²	121.2	54%	0.543	59%	0.587	S	S	.	*	S	Bend	trans	-96.8	151.6	-178.4	-48.2	-53.4	-175.3	-152.7	0	112.6	S116 T121	S116-K119 WeakPolarHBondContact OG-CB 3.28Å; S116-K119 PolarHBondContact OG-O 3.16Å; K119-T121 PolarHBondContact O-N 2.97Å
120	R	91.4	Very high	90.5	Very high	255 Å²	255	118.4 Å²	118.4	96%	0.962	58%	0.578	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.4	1.7	174	-66.9	-173.7	-178.4	107.3	0.3	114.1	R122	R120-R122 PolarHBondContact O-N 3.47Å
121	T	90	Very high	90.4	Very high	76 Å²	76	121.3 Å²	121.3	47%	0.466	58%	0.584	S	S	.	*	T	Hydrogen-bonded Turn	trans	-75.4	-6.1	174.6	52	0	0	0	0	112.5	A113 S116 K119 V123	A113-T121 CarbonylContact O-C 3.56Å; A113-T121 VanDerWaalsContact O-CB 3.27Å; A113-T121 WeakPolarHBondContact O-CB 3.07Å; A113-T121 PolarHBondContact O-OG1 3.25Å; S116-T121 PolarHBondContact OG-OG1 2.99Å; S116-T121 VanDerWaalsContact OG-OG1 3.1Å; K119-T121 PolarHBondContact O-N 2.97Å; T121-V123 PolarHBondContact O-N 3.32Å
122	R	90.5	Very high	90.3	Very high	180 Å²	180	119.5 Å²	119.5	68%	0.679	58%	0.584	S	S	*	*			trans	-63.9	122	177.8	-166.6	175.3	76.9	137.6	2.1	111.5	N114 R120	N114-R122 VanDerWaalsContact O-CA 3.25Å; N114-R122 WeakPolarHBondContact O-CA 3.25Å; R120-R122 PolarHBondContact O-N 3.47Å
123	V	91.2	Very high	90.3	Very high	74 Å²	74	124.8 Å²	124.8	45%	0.448	59%	0.592	S	S	.	*			trans	-86.3	136.7	179.2	-159.5	0	0	0	0	109.2	N114 T121 Q125	N114-V123 HydrophobicContact CB-CG2 3.74Å; N114-V123 PolarHBondContact O-N 3.07Å; T121-V123 PolarHBondContact O-N 3.32Å; V123-Q125 VanDerWaalsContact CG1-O 3.28Å; V123-Q125 WeakPolarHBondContact CG1-O 3.46Å
124	A	89.1	Confident	90.2	Very high	104 Å²	104	131.6 Å²	131.6	86%	0.86	61%	0.614	S	S	*	*	S	Bend	trans	-73.5	-30.5	-176.8	0	0	0	0	0	113.4
125	Q	85.1	Confident	89.9	Confident	173 Å²	173	138.7 Å²	138.7	81%	0.808	64%	0.644	S	S	*	*			trans	-139.8	153.8	-176.8	-67.7	-176.6	-27.3	0	0	110.2	V123	V123-Q125 VanDerWaalsContact CG1-O 3.28Å; V123-Q125 WeakPolarHBondContact CG1-O 3.46Å
126	K	83.2	Confident	89.7	Confident	175 Å²	175	140.8 Å²	140.8	76%	0.761	66%	0.657	S	S	*	*			trans	-142.6	0	179.4	-169.8	161.9	-160.5	130.8	0	111.8	Y111 F115	Y111-K126 HydrophobicContact CE2-CD 4.41Å; Y111-K126 VanDerWaalsContact CZ-CE 3.48Å; Y111-K126 WeakPolarHBondContact OH-CD 3.37Å; Y111-K126 WeakPolarHBondContact OH-CE 3.27Å; Y111-K126 PolarHBondContact OH-NZ 3.24Å; F115-K126 HydrophobicContact CE2-CD 4.26Å; F115-K126 HydrophobicContact CZ-CD 3.72Å

Retrieved 126 of 126 residues in 509.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).